(data stored in ACNUC7421 zone)

EMBL: CP002292

ID   CP002292; SV 1; circular; genomic DNA; STD; PRO; 4014469 BP.
XX
AC   CP002292; ADFF01000000-ADFF01000097;
XX
PR   Project:PRJNA38253;
XX
DT   07-NOV-2010 (Rel. 106, Created)
DT   06-JAN-2014 (Rel. 119, Last updated, Version 3)
XX
DE   Rhodomicrobium vannielii ATCC 17100, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Rhodomicrobium vannielii ATCC 17100
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Hyphomicrobiaceae; Rhodomicrobium.
XX
RN   [1]
RP   1-4014469
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Zhang Z., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Brown P.J.B., Brun Y.V., Woyke T.;
RT   "Complete sequence of Rhodomicrobium vannielii ATCC 17100";
RL   Unpublished.
XX
RN   [2]
RP   1-4014469
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Zhang Z., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G.,
RA   Brown P.J.B., Brun Y.V., Woyke T.;
RT   ;
RL   Submitted (27-OCT-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 43d42f04de87690164a2b7a44192a4fa.
DR   BioSample; SAMN00007427.
DR   EnsemblGenomes-Gn; EBG00001061095.
DR   EnsemblGenomes-Gn; EBG00001061096.
DR   EnsemblGenomes-Gn; EBG00001061097.
DR   EnsemblGenomes-Gn; EBG00001061098.
DR   EnsemblGenomes-Gn; EBG00001061099.
DR   EnsemblGenomes-Gn; EBG00001061100.
DR   EnsemblGenomes-Gn; EBG00001061101.
DR   EnsemblGenomes-Gn; EBG00001061102.
DR   EnsemblGenomes-Gn; EBG00001061103.
DR   EnsemblGenomes-Gn; EBG00001061104.
DR   EnsemblGenomes-Gn; EBG00001061105.
DR   EnsemblGenomes-Gn; EBG00001061106.
DR   EnsemblGenomes-Gn; EBG00001061107.
DR   EnsemblGenomes-Gn; EBG00001061108.
DR   EnsemblGenomes-Gn; EBG00001061109.
DR   EnsemblGenomes-Gn; EBG00001061110.
DR   EnsemblGenomes-Gn; EBG00001061111.
DR   EnsemblGenomes-Gn; EBG00001061112.
DR   EnsemblGenomes-Gn; EBG00001061113.
DR   EnsemblGenomes-Gn; EBG00001061114.
DR   EnsemblGenomes-Gn; EBG00001061115.
DR   EnsemblGenomes-Gn; EBG00001061116.
DR   EnsemblGenomes-Gn; EBG00001061117.
DR   EnsemblGenomes-Gn; EBG00001061118.
DR   EnsemblGenomes-Gn; EBG00001061119.
DR   EnsemblGenomes-Gn; EBG00001061120.
DR   EnsemblGenomes-Gn; EBG00001061121.
DR   EnsemblGenomes-Gn; EBG00001061122.
DR   EnsemblGenomes-Gn; EBG00001061123.
DR   EnsemblGenomes-Gn; EBG00001061124.
DR   EnsemblGenomes-Gn; EBG00001061125.
DR   EnsemblGenomes-Gn; EBG00001061126.
DR   EnsemblGenomes-Gn; EBG00001061127.
DR   EnsemblGenomes-Gn; EBG00001061128.
DR   EnsemblGenomes-Gn; EBG00001061129.
DR   EnsemblGenomes-Gn; EBG00001061130.
DR   EnsemblGenomes-Gn; EBG00001061131.
DR   EnsemblGenomes-Gn; EBG00001061132.
DR   EnsemblGenomes-Gn; EBG00001061133.
DR   EnsemblGenomes-Gn; EBG00001061134.
DR   EnsemblGenomes-Gn; EBG00001061135.
DR   EnsemblGenomes-Gn; EBG00001061136.
DR   EnsemblGenomes-Gn; EBG00001061137.
DR   EnsemblGenomes-Gn; EBG00001061138.
DR   EnsemblGenomes-Gn; EBG00001061139.
DR   EnsemblGenomes-Gn; EBG00001061140.
DR   EnsemblGenomes-Gn; EBG00001061141.
DR   EnsemblGenomes-Gn; EBG00001061142.
DR   EnsemblGenomes-Gn; EBG00001061143.
DR   EnsemblGenomes-Gn; EBG00001061144.
DR   EnsemblGenomes-Gn; EBG00001061145.
DR   EnsemblGenomes-Gn; EBG00001061146.
DR   EnsemblGenomes-Gn; EBG00001061147.
DR   EnsemblGenomes-Gn; EBG00001061148.
DR   EnsemblGenomes-Gn; EBG00001061149.
DR   EnsemblGenomes-Gn; EBG00001061150.
DR   EnsemblGenomes-Gn; EBG00001061151.
DR   EnsemblGenomes-Gn; EBG00001061152.
DR   EnsemblGenomes-Gn; EBG00001061153.
DR   EnsemblGenomes-Gn; EBG00001061154.
DR   EnsemblGenomes-Gn; EBG00001061155.
DR   EnsemblGenomes-Gn; EBG00001061156.
DR   EnsemblGenomes-Gn; EBG00001061157.
DR   EnsemblGenomes-Gn; EBG00001061158.
DR   EnsemblGenomes-Gn; EBG00001061159.
DR   EnsemblGenomes-Gn; EBG00001061160.
DR   EnsemblGenomes-Gn; Rvan_R0001.
DR   EnsemblGenomes-Gn; Rvan_R0002.
DR   EnsemblGenomes-Gn; Rvan_R0003.
DR   EnsemblGenomes-Gn; Rvan_R0004.
DR   EnsemblGenomes-Gn; Rvan_R0005.
DR   EnsemblGenomes-Gn; Rvan_R0006.
DR   EnsemblGenomes-Gn; Rvan_R0007.
DR   EnsemblGenomes-Gn; Rvan_R0008.
DR   EnsemblGenomes-Gn; Rvan_R0009.
DR   EnsemblGenomes-Gn; Rvan_R0010.
DR   EnsemblGenomes-Gn; Rvan_R0011.
DR   EnsemblGenomes-Gn; Rvan_R0012.
DR   EnsemblGenomes-Gn; Rvan_R0013.
DR   EnsemblGenomes-Gn; Rvan_R0014.
DR   EnsemblGenomes-Gn; Rvan_R0015.
DR   EnsemblGenomes-Gn; Rvan_R0016.
DR   EnsemblGenomes-Gn; Rvan_R0017.
DR   EnsemblGenomes-Gn; Rvan_R0018.
DR   EnsemblGenomes-Gn; Rvan_R0019.
DR   EnsemblGenomes-Gn; Rvan_R0020.
DR   EnsemblGenomes-Gn; Rvan_R0021.
DR   EnsemblGenomes-Gn; Rvan_R0022.
DR   EnsemblGenomes-Gn; Rvan_R0023.
DR   EnsemblGenomes-Gn; Rvan_R0024.
DR   EnsemblGenomes-Gn; Rvan_R0025.
DR   EnsemblGenomes-Gn; Rvan_R0026.
DR   EnsemblGenomes-Gn; Rvan_R0027.
DR   EnsemblGenomes-Gn; Rvan_R0028.
DR   EnsemblGenomes-Gn; Rvan_R0029.
DR   EnsemblGenomes-Gn; Rvan_R0030.
DR   EnsemblGenomes-Gn; Rvan_R0031.
DR   EnsemblGenomes-Gn; Rvan_R0032.
DR   EnsemblGenomes-Gn; Rvan_R0033.
DR   EnsemblGenomes-Gn; Rvan_R0034.
DR   EnsemblGenomes-Gn; Rvan_R0035.
DR   EnsemblGenomes-Gn; Rvan_R0036.
DR   EnsemblGenomes-Gn; Rvan_R0037.
DR   EnsemblGenomes-Gn; Rvan_R0038.
DR   EnsemblGenomes-Gn; Rvan_R0039.
DR   EnsemblGenomes-Gn; Rvan_R0040.
DR   EnsemblGenomes-Gn; Rvan_R0041.
DR   EnsemblGenomes-Gn; Rvan_R0042.
DR   EnsemblGenomes-Gn; Rvan_R0043.
DR   EnsemblGenomes-Gn; Rvan_R0044.
DR   EnsemblGenomes-Gn; Rvan_R0045.
DR   EnsemblGenomes-Gn; Rvan_R0046.
DR   EnsemblGenomes-Gn; Rvan_R0047.
DR   EnsemblGenomes-Gn; Rvan_R0048.
DR   EnsemblGenomes-Gn; Rvan_R0049.
DR   EnsemblGenomes-Gn; Rvan_R0050.
DR   EnsemblGenomes-Gn; Rvan_R0051.
DR   EnsemblGenomes-Gn; Rvan_R0052.
DR   EnsemblGenomes-Gn; Rvan_R0053.
DR   EnsemblGenomes-Gn; Rvan_R0054.
DR   EnsemblGenomes-Gn; Rvan_R0055.
DR   EnsemblGenomes-Gn; Rvan_R0056.
DR   EnsemblGenomes-Gn; Rvan_R0057.
DR   EnsemblGenomes-Gn; Rvan_R0058.
DR   EnsemblGenomes-Tr; EBT00001663706.
DR   EnsemblGenomes-Tr; EBT00001663709.
DR   EnsemblGenomes-Tr; EBT00001663711.
DR   EnsemblGenomes-Tr; EBT00001663713.
DR   EnsemblGenomes-Tr; EBT00001663715.
DR   EnsemblGenomes-Tr; EBT00001663719.
DR   EnsemblGenomes-Tr; EBT00001663721.
DR   EnsemblGenomes-Tr; EBT00001663725.
DR   EnsemblGenomes-Tr; EBT00001663728.
DR   EnsemblGenomes-Tr; EBT00001663731.
DR   EnsemblGenomes-Tr; EBT00001663733.
DR   EnsemblGenomes-Tr; EBT00001663737.
DR   EnsemblGenomes-Tr; EBT00001663740.
DR   EnsemblGenomes-Tr; EBT00001663744.
DR   EnsemblGenomes-Tr; EBT00001663746.
DR   EnsemblGenomes-Tr; EBT00001663750.
DR   EnsemblGenomes-Tr; EBT00001663752.
DR   EnsemblGenomes-Tr; EBT00001663755.
DR   EnsemblGenomes-Tr; EBT00001663758.
DR   EnsemblGenomes-Tr; EBT00001663761.
DR   EnsemblGenomes-Tr; EBT00001663764.
DR   EnsemblGenomes-Tr; EBT00001663767.
DR   EnsemblGenomes-Tr; EBT00001663770.
DR   EnsemblGenomes-Tr; EBT00001663773.
DR   EnsemblGenomes-Tr; EBT00001663777.
DR   EnsemblGenomes-Tr; EBT00001663780.
DR   EnsemblGenomes-Tr; EBT00001663782.
DR   EnsemblGenomes-Tr; EBT00001663785.
DR   EnsemblGenomes-Tr; EBT00001663787.
DR   EnsemblGenomes-Tr; EBT00001663790.
DR   EnsemblGenomes-Tr; EBT00001663792.
DR   EnsemblGenomes-Tr; EBT00001663795.
DR   EnsemblGenomes-Tr; EBT00001663798.
DR   EnsemblGenomes-Tr; EBT00001663801.
DR   EnsemblGenomes-Tr; EBT00001663805.
DR   EnsemblGenomes-Tr; EBT00001663810.
DR   EnsemblGenomes-Tr; EBT00001663813.
DR   EnsemblGenomes-Tr; EBT00001663816.
DR   EnsemblGenomes-Tr; EBT00001663819.
DR   EnsemblGenomes-Tr; EBT00001663823.
DR   EnsemblGenomes-Tr; EBT00001663826.
DR   EnsemblGenomes-Tr; EBT00001663828.
DR   EnsemblGenomes-Tr; EBT00001663832.
DR   EnsemblGenomes-Tr; EBT00001663835.
DR   EnsemblGenomes-Tr; EBT00001663839.
DR   EnsemblGenomes-Tr; EBT00001663843.
DR   EnsemblGenomes-Tr; EBT00001663845.
DR   EnsemblGenomes-Tr; EBT00001663851.
DR   EnsemblGenomes-Tr; EBT00001663857.
DR   EnsemblGenomes-Tr; EBT00001663864.
DR   EnsemblGenomes-Tr; EBT00001663870.
DR   EnsemblGenomes-Tr; EBT00001663875.
DR   EnsemblGenomes-Tr; EBT00001663880.
DR   EnsemblGenomes-Tr; EBT00001663886.
DR   EnsemblGenomes-Tr; EBT00001663894.
DR   EnsemblGenomes-Tr; EBT00001663902.
DR   EnsemblGenomes-Tr; EBT00001663908.
DR   EnsemblGenomes-Tr; EBT00001663914.
DR   EnsemblGenomes-Tr; EBT00001663919.
DR   EnsemblGenomes-Tr; EBT00001663925.
DR   EnsemblGenomes-Tr; EBT00001663930.
DR   EnsemblGenomes-Tr; EBT00001663937.
DR   EnsemblGenomes-Tr; EBT00001663942.
DR   EnsemblGenomes-Tr; EBT00001663948.
DR   EnsemblGenomes-Tr; EBT00001663955.
DR   EnsemblGenomes-Tr; EBT00001663964.
DR   EnsemblGenomes-Tr; Rvan_R0001-1.
DR   EnsemblGenomes-Tr; Rvan_R0002-1.
DR   EnsemblGenomes-Tr; Rvan_R0003-1.
DR   EnsemblGenomes-Tr; Rvan_R0004-1.
DR   EnsemblGenomes-Tr; Rvan_R0005-1.
DR   EnsemblGenomes-Tr; Rvan_R0006-1.
DR   EnsemblGenomes-Tr; Rvan_R0007-1.
DR   EnsemblGenomes-Tr; Rvan_R0008-1.
DR   EnsemblGenomes-Tr; Rvan_R0009-1.
DR   EnsemblGenomes-Tr; Rvan_R0010-1.
DR   EnsemblGenomes-Tr; Rvan_R0011-1.
DR   EnsemblGenomes-Tr; Rvan_R0012-1.
DR   EnsemblGenomes-Tr; Rvan_R0013-1.
DR   EnsemblGenomes-Tr; Rvan_R0014-1.
DR   EnsemblGenomes-Tr; Rvan_R0015-1.
DR   EnsemblGenomes-Tr; Rvan_R0016-1.
DR   EnsemblGenomes-Tr; Rvan_R0017-1.
DR   EnsemblGenomes-Tr; Rvan_R0018-1.
DR   EnsemblGenomes-Tr; Rvan_R0019-1.
DR   EnsemblGenomes-Tr; Rvan_R0020-1.
DR   EnsemblGenomes-Tr; Rvan_R0021-1.
DR   EnsemblGenomes-Tr; Rvan_R0022-1.
DR   EnsemblGenomes-Tr; Rvan_R0023-1.
DR   EnsemblGenomes-Tr; Rvan_R0024-1.
DR   EnsemblGenomes-Tr; Rvan_R0025-1.
DR   EnsemblGenomes-Tr; Rvan_R0026-1.
DR   EnsemblGenomes-Tr; Rvan_R0027-1.
DR   EnsemblGenomes-Tr; Rvan_R0028-1.
DR   EnsemblGenomes-Tr; Rvan_R0029-1.
DR   EnsemblGenomes-Tr; Rvan_R0030-1.
DR   EnsemblGenomes-Tr; Rvan_R0031-1.
DR   EnsemblGenomes-Tr; Rvan_R0032-1.
DR   EnsemblGenomes-Tr; Rvan_R0033-1.
DR   EnsemblGenomes-Tr; Rvan_R0034-1.
DR   EnsemblGenomes-Tr; Rvan_R0035-1.
DR   EnsemblGenomes-Tr; Rvan_R0036-1.
DR   EnsemblGenomes-Tr; Rvan_R0037-1.
DR   EnsemblGenomes-Tr; Rvan_R0038-1.
DR   EnsemblGenomes-Tr; Rvan_R0039-1.
DR   EnsemblGenomes-Tr; Rvan_R0040-1.
DR   EnsemblGenomes-Tr; Rvan_R0041-1.
DR   EnsemblGenomes-Tr; Rvan_R0042-1.
DR   EnsemblGenomes-Tr; Rvan_R0043-1.
DR   EnsemblGenomes-Tr; Rvan_R0044-1.
DR   EnsemblGenomes-Tr; Rvan_R0045-1.
DR   EnsemblGenomes-Tr; Rvan_R0046-1.
DR   EnsemblGenomes-Tr; Rvan_R0047-1.
DR   EnsemblGenomes-Tr; Rvan_R0048-1.
DR   EnsemblGenomes-Tr; Rvan_R0049-1.
DR   EnsemblGenomes-Tr; Rvan_R0050-1.
DR   EnsemblGenomes-Tr; Rvan_R0051-1.
DR   EnsemblGenomes-Tr; Rvan_R0052-1.
DR   EnsemblGenomes-Tr; Rvan_R0053-1.
DR   EnsemblGenomes-Tr; Rvan_R0054-1.
DR   EnsemblGenomes-Tr; Rvan_R0055-1.
DR   EnsemblGenomes-Tr; Rvan_R0056-1.
DR   EnsemblGenomes-Tr; Rvan_R0057-1.
DR   EnsemblGenomes-Tr; Rvan_R0058-1.
DR   EuropePMC; PMC5571419; 28839033.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP002292.
DR   SILVA-SSU; CP002292.
DR   StrainInfo; 21289; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085652
CC   Source DNA available from Yves V. Brun (Ybrun@indiana.edu)
CC   Organism available from ATCC: ATCC 17100
CC   Contacts: Yves V. Brun (Ybrun@indiana.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Rhodomicrobium vannielii ATCC 17100
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Missing
CC   num_replicons       :: 1
CC   ref_biomaterial     :: ATCC 17100, NCIMB 10020
CC   biotic_relationship :: Free living
CC   trophic_level       :: Photoheterotroph
CC   rel_to_oxygen       :: Missing
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02056
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 4645
CC   Funding Program     :: DOE-CSP 2008
CC   Gene Calling Method :: Prodigal
CC   Isolation Comments  :: isolated by C B van Niel -- H C Douglas in
CC                          1949
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4014469
FT                   /organism="Rhodomicrobium vannielii ATCC 17100"
FT                   /strain="ATCC 17100"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:648757"
FT                   /culture_collection="ATCC:17100"
FT   gene            complement(24..752)
FT                   /locus_tag="Rvan_0001"
FT   CDS_pept        complement(24..752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0001"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_714 probable ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69292"
FT                   /db_xref="UniProtKB/TrEMBL:E3I473"
FT                   /inference="similar to AA sequence:KEGG:AGR_C_714"
FT                   /protein_id="ADP69292.1"
FT                   /translation="MLGRMAGHRGRKDRVGKIGSQVLKLPRRNIGLPGKGRVLGLQGFD
FT                   AVAAARPRHESVRMIRENRSHMARHRQFPRIYTYRLRQCRDAFTSHTSSSRPMPCGQKV
FT                   NTNPDRIRRAPTIHCLIMDIALHPWRPLHLAKLGTHYKVTLSGGEQPPFGDPTIQRLAL
FT                   RRKWAPPLPKLQMHTPRLHLERPVQAQNGSQATGIVNDSFTSASTQKMRGCLLAAPALV
FT                   ADFRRSHKRIQPSATGAFAR"
FT   gene            974..2467
FT                   /locus_tag="Rvan_0002"
FT   CDS_pept        974..2467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   rpt:Rpal_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69293"
FT                   /db_xref="GOA:E3I474"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E3I474"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADP69293.1"
FT                   /translation="MEALNLSTTSSIEQTSIEHKWRRIQSRLRAELGEDVFTSWFGRVE
FT                   LDSCDGRVVQVSVPTKFLRNWLQSHYSDKLLACCGTELNGVNRLEFRVRQPHLAPVEKK
FT                   ASPTASIAESTTPKAQTTPSSTVPLRVISTPVRDGRTGLEGFEGSPLDPRYTFQSFVVG
FT                   SPNRLAHAAAFQVAESTPEQPLKYNPLYIHARVGMGKTHLLHAIAWEMKARNPNAKVLY
FT                   LTAERFMYSFAEALQTRDAPAFKEKLRTIDLLIIDDMEFLQGRTFQQEFCHTLNSLIDG
FT                   GKQVVVAADCAPLLLESFDARMRSRLSGGLVAEMSALDFDLRLKILQRRAAEKISLSRG
FT                   FEVPGDVLEYLATQLTENGRELEGAITRLHATWQLTGEKVTVDAAENTIGDLIRSKEPK
FT                   RVKIDDILRIVAKHYGVQRGDLLSSRRNQSIVRPRQIGMYLAKTLTSRSLPEIGRRFGG
FT                   RDHTTVLHAIRKIESLKQADGVLKDELDSLSRMLKDGNV"
FT   gene            2561..3682
FT                   /locus_tag="Rvan_0003"
FT   CDS_pept        2561..3682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: mno:Mnod_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69294"
FT                   /db_xref="GOA:E3I475"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3I475"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP69294.1"
FT                   /translation="MRFVVDRNAMLRALGHITGIVERRNTIPILSNILIGADRDGGLTF
FT                   KATDLDMEAVEAVPAKVEVTGAVTVPAHTLHDIVRKLPDGAEIRIERKGEEGRLKVATG
FT                   RASFELAILPADDFPDMGQTELPTRFTVDSGELKRLFEKARFAISTEETRYYLNGIYLH
FT                   AVDGPEGGKLRAVATDGHRLAQVETACPAGAGGMPGVIVPRKAVGEVIKLLESGAAPVE
FT                   VTLSPAKIRFAVGDVVLTSKLIDGSFPDYARVIPTTNKKLLLLENADLVKAVDRVSTLS
FT                   SEKGRAVKLNAAEGRLVVSANNPESGSATEEISAEYQDEPLEIGFNARYLLDITGQIDG
FT                   TKALFKLADGSSPTLISDETDASALYVLMPMRV"
FT   gene            4163..5365
FT                   /locus_tag="Rvan_0004"
FT   CDS_pept        4163..5365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: mlo:mll5578 recombination protein F; TIGRFAM:
FT                   DNA replication and repair protein RecF; PFAM: SMC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69295"
FT                   /db_xref="GOA:E3I476"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E3I476"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADP69295.1"
FT                   /translation="MPATDRIAIAKLTLTDFRNYRAVTLVTGLGPVVLAGANGAGKTNC
FT                   LEAVSLLTAGRGLRSLPFPELARSGGSGGWAVAAELGVAGEDMHIGTGIQLPPDGMLTP
FT                   RAARTVKIDHALAKGSGALVRIRMLWLTPSMDGLFTGPAAERRRFLDRLVLSLDPGYGA
FT                   AASAFERAMRQRNKALEEFDSPPMLTAIEAQMAAAAVAMAVARARAIAALSGEIEAERN
FT                   RDPDSLFPWAALTLNGTLEEQAAALSEDTMRDELRDGYARALAQGRDRDRAAGRTLSGP
FT                   HRSDLDVAHGPKAMPARMCSTGEQKALLVGLVLAQARLIKRAADGIAPLILLDEIAAHL
FT                   DIGRREALFSSIVALNAQVWMTGTDLATFTPLRNATETQLFVVSNGTIMPANDAERAAK
FT                   H"
FT   gene            5415..7850
FT                   /locus_tag="Rvan_0005"
FT   CDS_pept        5415..7850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: pla:Plav_0007 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69296"
FT                   /db_xref="GOA:E3I477"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3I477"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADP69296.1"
FT                   /translation="MEAARRRDAEVEAYGAESIKVLKGLDAVRKRPGMYIGDTDDGSGL
FT                   HHMVYEVVDNAIDEALGGYADYVSVTLNADGSVTVEDNGRGIPTEIHSQEGVSAAEVIM
FT                   TQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSTRLELTIWRSGHEHFMAFADGVPVEPL
FT                   KIVGPAPDLRGTRVTFTPSPATFTMVDFDYATLEFRLRELAFLNSGVYIRLNDLRGVEP
FT                   VKSEFKYEGGLKAFVEYLDRARTPLFPVPVFVRADREGVAVEAALWWNDGYHENVLCFT
FT                   NNIPQRDGGTHLAGFRAALTRTINTYAAATGVAKREKVQLTGDDAREGLTCVLSVKVAD
FT                   PKFSSQTKDKLVSSEVRPAVESIMTDILGTWFEEHPVEGKLILLKVAEAAAAREAARKA
FT                   RELTRRKGVLDVANLPGKLADCQERDPAKSEVFLVEGDSAGGSAKQGRDRSNQAVLPLR
FT                   GKILNVERARFDKMLSSQEIGTLITALGTGIGRDDFDIAKLRYHRIIIMTDADVDGAHI
FT                   RTLLLTFFYRQMPQLIESGHIYIAQPPLYKVKRGSSENYLKDQRAFEDFLIDGGLEGSV
FT                   FVNDNGERRSGRDLRQAVERARSFSHVLDGMHMRYSRAVVEQAAIAGLLNPKLLDDDEE
FT                   EAGRLADKVVERMKALSEEAEQGWSWSRGVDRGFVFEREVRSVREAHAIDSALSHSADA
FT                   RKLHTYHPELAELFSGKTVLERKGTETPLHGPRDLLNAVFAAGRAGVTMQRYKGLGEMN
FT                   PEQLRETTLDPNVRTLLQVKLGELADADEIFAKLMGDVVEPRRDFIQQNALSVSNLDI"
FT   gene            7981..8634
FT                   /locus_tag="Rvan_0006"
FT   CDS_pept        7981..8634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:571621 similar to Nuclear pore complex
FT                   protein Nup153 (Nucleoporin Nup153) (153 kDa nucleoporin)"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69297"
FT                   /db_xref="UniProtKB/TrEMBL:E3I478"
FT                   /inference="similar to AA sequence:KEGG:571621"
FT                   /protein_id="ADP69297.1"
FT                   /translation="MFPFLAFAPAGQTQSRPASSGASINYFAAPWATAPLPKPEPARPR
FT                   DFGDFYVDFLREAISFWARHYETLGNRSHLLFTQIAAALAFERAARETSAAVTQAYAAF
FT                   GLKPPPSAIPQWSQPQLLAPLTSFAPLSSFAPGTALAPWAAFNPWLNPALAQNAFNPWG
FT                   AVAESFNVWTKVWQPATPKNAPAPQTNAALVPAKPFTANVTAPGGFNWAFSFGV"
FT   gene            complement(8921..9586)
FT                   /locus_tag="Rvan_0007"
FT   CDS_pept        complement(8921..9586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0007"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   ribulose-phosphate 3-epimerase; PFAM: ribulose-phosphate
FT                   3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69298"
FT                   /db_xref="GOA:E3I479"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E3I479"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADP69298.1"
FT                   /translation="MSSLPLIAPSILSADFARFGEEVRAIDEAGADWVHVDVMDGHFVP
FT                   NITFGPRLVECIRPWTKKLLDVHLMIAPADPYLEAFAKAGSDIITVHAEAGPHLDRSLQ
FT                   VIRSLGKKAGVSLNPSTPESVIEYVLDKIDLVLVMSVNPGFGGQAFLPSQVEKVRRIAA
FT                   MIQGRPIALEVDGGVTPETAPLLVQAGATALVAGSAVFKGGEYAKNIAAIRDACLLTA"
FT   gene            complement(9607..10533)
FT                   /locus_tag="Rvan_0008"
FT   CDS_pept        complement(9607..10533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0008"
FT                   /product="CbbX protein"
FT                   /note="TIGRFAM: CbbX protein; PFAM: AAA ATPase central
FT                   domain protein; KEGG: rsp:RSP_1280 CbbX protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69299"
FT                   /db_xref="GOA:E3I480"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:E3I480"
FT                   /inference="protein motif:TFAM:TIGR02880"
FT                   /protein_id="ADP69299.1"
FT                   /translation="MSVTAEQNENAAANETIDLRRDYEESGVGEVLDQLDRELIGLKPV
FT                   KTRLREIAALLLVERARKRLGLVNEAPTLHMSFTGNPGTGKTTVAMRMANILHRLGYVR
FT                   RGQLVSVTRDDLVGQYIGHTAPKTKEVLKKAMGGVLFIDEAYYLYRPENERDYGQESIE
FT                   ILLQVMENQREDLVVILAGYSDRMDKFFTANPGFRSRIAHHIDFPDYSDGELLEIADKM
FT                   LDHQNYYLSPEAKVALADYIEKRRQQPHFSNARSIRNALDRARLRQANRLFAHTGGALT
FT                   ANQLSEITAEDILASRVFKVAAESQNQ"
FT   gene            complement(10695..11117)
FT                   /locus_tag="Rvan_0009"
FT   CDS_pept        complement(10695..11117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0009"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: ribulose-bisphosphate carboxylase; PFAM:
FT                   ribulose bisphosphate carboxylase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69300"
FT                   /db_xref="GOA:E3I481"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:E3I481"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADP69300.1"
FT                   /translation="MRITQGQFSFLPDLTDEQIAKQVQYAIEKGWAVNIEFTDDPHPRN
FT                   SYWEMWGLPMFDIKDAAAVVSELQACRKVYSGRYYIRISAFDATHGWESLRMSFIVDRP
FT                   AEEPGFDLERQEVDGRNIRYTTRPYATVKPSGQRYS"
FT   gene            complement(11210..12667)
FT                   /locus_tag="Rvan_0010"
FT   CDS_pept        complement(11210..12667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0010"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: nwi:Nwi_2929 ribulose bisophosphate
FT                   carboxylase; PFAM: ribulose bisphosphate carboxylase large
FT                   chain; Ribulose bisphosphate carboxylase, large
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69301"
FT                   /db_xref="GOA:E3I482"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:E3I482"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADP69301.1"
FT                   /translation="MSDKSETVKGEDRYKAGVMSYKKMGYWEPDYQPKETDLIALFRVT
FT                   PQDGVDPIEASAAVAGESSTATWTVVWTDRLTASEKYRAKCYRVDPVPNAPGSYFAYIA
FT                   YDLDLFEGGSISNLTASIIGNVFGFKPLKALRLEDMRLPVAYVKTFDGPPAGIIVERER
FT                   LDKFGRPLLGATVKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLY
FT                   CMEAVNKAQAETGEIKGSYLNITAGTMEEMYKRAEYAKELGSCIVMIDLVIGYVAIQSI
FT                   SKWARDNNMLLHLHRAGHSTYTRQKSHGVSFRVISKWMRLAGVDHIHAGTVVGKLEGDP
FT                   LTTAGYYDILREDFVPQNLEHGVFFDQPWASLGKVMPVASGGIHAGQMHQLIHYLGEDV
FT                   VLQFGGGTIGHPYGIQAGATANRVALEAMIFARNEGRDYLAEGPQILKDAAKTCTPLRQ
FT                   ALDTWGDVTFDYTSTDTPDFVPTPTAS"
FT   gene            complement(12731..14725)
FT                   /locus_tag="Rvan_0011"
FT   CDS_pept        complement(12731..14725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0011"
FT                   /product="transketolase"
FT                   /note="KEGG: rpc:RPC_2897 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain-containing
FT                   protein; Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69302"
FT                   /db_xref="GOA:E3I483"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E3I483"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADP69302.1"
FT                   /translation="MTTPVSNPSQRDLANAIRALSMDAVEAANSGHPGMPMGMADVAAV
FT                   LFTKFLKFDASAPKWPDRDRFVLSAGHGSMLLYSLLYLTGSPDVTIEEVKKFRQLHSKT
FT                   PGHPEYGHTQGVETTTGPLGQGISTAVGMAIAERLLGARFGDKVVDHHTYAIVGDGCLM
FT                   EGISHEAIDLAGHLKLNKLIVLWDDNSISIDGSTSLSTSTDQVKRFEAAGWNAVRVDGH
FT                   NAAEVEAAIAKAKTSDKPTLIACKTIIGFGAPNKQGSEKTHGAPLGKDEIAAAREFLGW
FT                   PYAPFEVPEPILSTWRAAGTRGKAEHAAWHERLSQLTADERAHFERMIEGELPASVKEA
FT                   LDAFIAKNVAEKPKLATRKSSEMALQVINDATDMTIGGSADLTHSNYTITRGMKSITPD
FT                   DFTGRYLHYGIREHIMGAAMNGIALHGGFVPYGGTFLVFSDYLRGSIRLSALMGLRVLY
FT                   VLTHDSIGVGEDGPTHQPIEHLASLRALPNVNVFRPADIVETAEAYEIALASKHTPSVL
FT                   ALSRQNLPTVRTEASSENLTAKGAYVLRGDAKAPRDVTLIATGSEIELAVSAAEQLNAE
FT                   GVKTVVVSMPCFELFEAQPEAYRAEVLGTAPRIAIEAAGRFGWDRWIGDKGAFVGMNGF
FT                   GASGPAPQVYKEFGITVEAVIAAAKKLVA"
FT   gene            complement(14761..15642)
FT                   /locus_tag="Rvan_0012"
FT   CDS_pept        complement(14761..15642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0012"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="KEGG: rpt:Rpal_5125 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69303"
FT                   /db_xref="GOA:E3I484"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I484"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ADP69303.1"
FT                   /translation="MSSKFPIISVTGSSGAGTSTVKHTFEQIFRREGIQPAFIEGDAYH
FT                   LYDRASMKKAMAEEEARGNRHLSHFGPDANLLKELEETFRSYGATGTGKTRHYVHDAVE
FT                   AEKFGVPAGTFTEWQDLPEGSDILFYEGLHGAVMLKEQGINIAKHADLKIGVVPVINLE
FT                   WIQKMHRDNKMRGYTPEDVTKTILRRMPDYVHYITPQFSETDINFQRVPTVDTSNPFVA
FT                   RWIPTPDESLVVIRFKDPRGIDFAYLKTMIQDSFMSRANSIVIPGGKLDLAMQLILTPM
FT                   IHRLVDLKRRSS"
FT   gene            complement(15652..16686)
FT                   /locus_tag="Rvan_0013"
FT   CDS_pept        complement(15652..16686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0013"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: inositol
FT                   phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69304"
FT                   /db_xref="GOA:E3I485"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:E3I485"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADP69304.1"
FT                   /translation="MGVHASLREHLAEWAAEDAQKRAVAETVENLAKAGIEIAKIIALG
FT                   PLAGDMASARGEGGGGDTQKELDFLSNKIVTDALKASPVAWLGSEEDEKAVALNAGAPL
FT                   AVNTDPLDGSSNIDTNMSIGTIFSILPNKEQAALLQPGRNQLCAGYIVYGPQTAIVLTV
FT                   GQGTHIFWLDPRTGEFVLGKANVQIPVETKEYAINSSNFRHWDDKMKSYIVDCKLGKDG
FT                   PRKKDFNMRWLGSLVADGFRILTRGGIYLYPADIRKGYTNGRLRLLYEANPIGMLIEQA
FT                   GGACTQGKTRILDLEPISLHQHVPLVFGSKKEVEEVAYYYNQPPATGEHSPLFSQRGLF
FT                   SSVR"
FT   gene            16860..17789
FT                   /locus_tag="Rvan_0014"
FT   CDS_pept        16860..17789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0014"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69305"
FT                   /db_xref="GOA:E3I486"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I486"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP69305.1"
FT                   /translation="MKNITLKHFRVLSAVTKMGSMAGAARSLHVTPPAITVQIQQLEQA
FT                   VGLPLLERIGDKTTATSAGQIMLRTAQRIELLLAECRQEVEQLKGVAGGHVSAGVVSTA
FT                   KYFAPKALAAFRQRHPGVEVRLAVGNRQETIRALRDLELDIALMGRPPENLDLQSASLG
FT                   PHPHIIVAAATHPLAGQKISITDLTNETFFIREPGSGTRILMERLFEEARFDPIVGMEI
FT                   GSNETIKQAVIAGLGIAFISAHTVAVEIADGRLVMLDVAGLPMMRQWYVVRLKEKAVMP
FT                   AAQVMWAFLASEGHSFLPQPIAEWKSTL"
FT   gene            17861..18928
FT                   /locus_tag="Rvan_0015"
FT   CDS_pept        17861..18928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0015"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; Ada metal-binding
FT                   domain-containing protein; helix-turn-helix- domain
FT                   containing protein AraC type; methylguanine DNA
FT                   methyltransferase ribonuclease domain protein; KEGG:
FT                   mpo:Mpop_4835 transcriptional regulator, AraC family;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69306"
FT                   /db_xref="GOA:E3I487"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E3I487"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADP69306.1"
FT                   /translation="MTLAARPAFDRALWESDCWARLEQRQADADRAFVYGVVSTGIYCR
FT                   PGCPSRLPRRENVRFFADAAAARRAGFRACLRCDPDGASRAEREAALVAKAVALIESAE
FT                   GRPAFDAIARSCGMSRHHFHRMFKAATSMTPGSYFAAIKKRRALDSLGQGESVTTAIAA
FT                   AGYGSPSRFYEGVADLGARPRALSRGGAGEHIRFTVAACSLGFVLVAATQKGICAIELG
FT                   DGADALAADFRRRFARACLAEDAAFSQAVADVVTLVEEPSRAFALPLDVRGTVFQEKIW
FT                   RLLREIPPGETMTYGELAAKAGCPSAVRAVARACASNAIAVAIPCHRVVGKGGTLTGYR
FT                   WGVERKAALLKREGR"
FT   gene            19022..20053
FT                   /locus_tag="Rvan_0016"
FT   CDS_pept        19022..20053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0016"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mrd:Mrad2831_1476 L-threonine-O-3-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69307"
FT                   /db_xref="GOA:E3I488"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3I488"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADP69307.1"
FT                   /translation="MAFLFRPAEKIDPRFVEGDGRLDAARALYPDAPTPWLDLSRAAAP
FT                   WPYPAPNLAADDFARGIDMHAIAALAALAAKAYRAPQSVEVVPLPGADAGLRLLPWLYR
FT                   SPKRVAFLAPADAGLRAAWEAAGHSTSEIASLDAVGKADILIVDNPGHADGRLAPHADL
FT                   AAVLPALKRRDGLLVIDETLADADESASILASVARLDSTIVLRSANALHGAGGIPLGFA
FT                   ITSHPIAARFRAAFGANAVSAQAAAFGRAALADAGFAAEQRARLADMGGKLEAALTQAG
FT                   LRITGGTALFRLAGTDLPHSLFDSLARAGILARPFPKLNALRFSLPKDDADLARLQAAL
FT                   ASA"
FT   gene            20191..21174
FT                   /locus_tag="Rvan_0017"
FT   CDS_pept        20191..21174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0017"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: avi:Avi_2926 transcriptional regulator ArsR
FT                   family; PFAM: Methyltransferase type 11; regulatory protein
FT                   ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69308"
FT                   /db_xref="GOA:E3I489"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I489"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP69308.1"
FT                   /translation="MGSFDDIVGMLRAAGEPTRLRILRLLQHGEFNVTDLTQLLGQSQP
FT                   RVSRHIKLLDDAALIERYQEGSFVFVRASGDAHVQGFLASALSMVAPDDPQFARDAERA
FT                   DQIRARRAELAQGYFDANAVQWDRIRSLHVPEPDVEAAILDALGPGPYELLLDLGTGTG
FT                   RILELASDRAERLVGIDTNREMLKCARVRLESAGATKCSVRQGDIYNLPFAEGSAGAVV
FT                   VHQVLHFLAWPKTALAEAVRVLEPDGRLVVVDFAPHNLEFLREEHAHVRLGFGADEIKG
FT                   WLAECGLGQTAYRELKANDARENALTVAIWSGKKKGAAAQKWRAAS"
FT   gene            21171..22079
FT                   /locus_tag="Rvan_0018"
FT   CDS_pept        21171..22079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0018"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   KEGG: mno:Mnod_4919 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69309"
FT                   /db_xref="GOA:E3I490"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:E3I490"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ADP69309.1"
FT                   /translation="MTEAGTQRRAHAPISVSFEFFPPKTDAMEASLWQAIRKLEPLAPE
FT                   FVSVTYGAGGSTRERTHSTVSRILAETSLKPAAHLTCVAATKDEVDAVVRDYWDVGVRH
FT                   IVALRGDPPAGAGTAYAAHPGGYQSSADLVAGLKTIGDFEVSVSAYPEKHPESGSFDVD
FT                   LDVLQAKVDAGATRAITQFFFDNDHYWRYLDRVRARGINIPIVPGQIPIHNFKQIAGFA
FT                   ARCGATMPASTGARFEGLADDPETTQLVAAAVAAEQVRDLVKGGVTEFHFYTLNRAPLV
FT                   NAICHTLGIKPHAPAASAVNA"
FT   gene            22089..23150
FT                   /locus_tag="Rvan_0019"
FT   CDS_pept        22089..23150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0019"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   pag:PLES_34821 B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69310"
FT                   /db_xref="GOA:E3I491"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:E3I491"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADP69310.1"
FT                   /translation="MNRTDRIAALKAAAKERILILDGGMGTMIQRHKPTEADYRGERFK
FT                   DWPSDLKGNNDLLVLTQPAIIKGVHEAYFEAGADIIETNSFNAQRISMADYGMEALSAE
FT                   INLAAAKLAREAADAYTAKTPEKPRFVAGSIGPTNRTASLSPDVNNPGFRNISFDELVD
FT                   AYGEQTRALIEGGVDAILIETIFDTLNAKAAGFAVKKAFDETGVELPLMLSGTVTDLSG
FT                   RNLSGQTPEAFWYSLRHLKPFSVGMNCAFGAEQLRPPVALLSKVADTYMSVYANAGLPN
FT                   EMGEYDETPEDMARAMASWAADGLLNIVGGCCGTTPDHIAAIAKAVAPYPPRRIPELEP
FT                   RLRLSGLEAFVQG"
FT   gene            23334..24815
FT                   /locus_tag="Rvan_0020"
FT   CDS_pept        23334..24815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0020"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: azl:AZL_012800 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69311"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:E3I492"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADP69311.1"
FT                   /translation="MATITALKNPSTVAPLDNYNAGHFYCELLGSPDNRNRHLTALWHR
FT                   LQQLELLHLRERAADAERELFNLGITFTVYSDRTAIDRILPFDVIPRVITAEDWKTLDR
FT                   GVKQRIKALNLFLWDVYHDRKILKDGLVPEDLVLGNANYRPEMIGYDPPCGTYIHIGGI
FT                   DVIRDPRGEFFVLEDNGRTPSGVSYVVENRHLMQRAFPDLMHGFAIESVSEYGTQLGDK
FT                   LIECAPAGVSEPQIALLSPGVFNSAYFEHVFLAREIGIPLVEGRDLFVDDDKVFMKTVS
FT                   GPKPVHVIYRRINDEFLDPEAFRPDSALGVKGLMRAVRKGNVTLANAVGTGVADDKAVY
FT                   AYLPRIIKYYLDEHPVLPNVQTNICREKDGLGYTLDNLDKLVVKPVGESGGYGICVGPK
FT                   ATKAEIDLCRNQLKADPSNYISQPMIELSVCPTLTDQGVEPRHVDLRPFAVTGQETWVL
FT                   PGGLTRVALKRGSIIVNSSQGGGTKDTWVLKEDNA"
FT   gene            24812..25846
FT                   /locus_tag="Rvan_0021"
FT   CDS_pept        24812..25846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0021"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   rce:RC1_1363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69312"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:E3I493"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ADP69312.1"
FT                   /translation="MSSLLSRHAESVFWMARYFERTESLGRVIETQTSFQRGRDDDNGW
FT                   LWIVALYSDEEAFAKAFPEANAENVIRFYMAHTENPGSIQSSIKSARENARALRPMLSI
FT                   DMWYQLNDFCNRVFAFSNTELSEVRLSRTCDAIKRGCYAQIGVAENTLYHDETWPFFRL
FT                   GLFLERADQTSRLLDVRFAQQQTGLATDEGHYDHTFWSILLRAASAYHAYRRVHPRHID
FT                   PHEVARFLIFDPRLPRSIAYCLSEMQAMIELLRRNFGLRNAGPAAERVEAMIDGLQTAS
FT                   LDDNLLQNLHAFNDWVQSSLILLNDELGKAFFGYAKALEAAVPLPAPVAIGQTQSQSQT
FT                   QVVR"
FT   gene            complement(26060..26782)
FT                   /locus_tag="Rvan_0022"
FT   CDS_pept        complement(26060..26782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0022"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="KEGG: pla:Plav_1574 acetoacetyl-CoA reductase;
FT                   TIGRFAM: acetoacetyl-CoA reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69313"
FT                   /db_xref="GOA:E3I494"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I494"
FT                   /inference="protein motif:TFAM:TIGR01829"
FT                   /protein_id="ADP69313.1"
FT                   /translation="MSKVAIVTGGTRGIGQAISVELKHHGFRVAANYAGNDEAAQKFNA
FT                   EFGIPVFKWDVGDYDACVAGLAEVEKEVGPIDIIVNNAGITRDAMLHRMTPQQWREVMR
FT                   VDLDSLFNMVHPVINGMRERNFGRIISISSINGQKGQMGQTNYSAAKAGMIGFTKALAL
FT                   ENAKKGITANVVAPGYIDTEMVQAVPGNVLDSIIAQIPVGRLGKAQEIAKCVSFLASRD
FT                   AGFITGSTITANGGQYIA"
FT   gene            complement(27050..28240)
FT                   /locus_tag="Rvan_0023"
FT   CDS_pept        complement(27050..28240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0023"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   azl:AZL_023130 acetyl-CoA C-acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69314"
FT                   /db_xref="GOA:E3I495"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3I495"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP69314.1"
FT                   /translation="MARHDDDIVIASAARTPVGSFNGSLATLPAHELGRIVITEALKRA
FT                   NVDAGEVSEVILGQVLTAGQGQNPARQASIAASLPIETTAMSVNFVCGSGLRTVAMAAQ
FT                   AIRNGDSDIVVAGGQENMSLSPHVAYLRNGQRMGNLEMIDTMIKDGLWDAFNGYHMGIT
FT                   AENVARQWQITREDQDALALGSQHKAAVAKKDGRFNDEIVPVTIKTRKGEVVFAADEFI
FT                   RENATVEDLAKLRPAFNPKEGTVTAGNASGINDGAAALVVMKRSDAEKRGLEPLARIVS
FT                   FATAGVDPSIMGTGPIPASKRALEKAGWSKDDLDLIEANEAFAAQAAAVNKALGWDIEK
FT                   VNVNGGAIAIGHPIGASGARILTTLLYELKRRDAKKGLATLCIGGGMGIAMCVERD"
FT   gene            28456..29169
FT                   /locus_tag="Rvan_0024"
FT   CDS_pept        28456..29169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0024"
FT                   /product="polyhydroxyalkonate synthesis repressor, PhaR"
FT                   /note="KEGG: bbt:BBta_7615 putative polyhydroxyalkanoate
FT                   synthesis repressor PhaR-like protein; TIGRFAM:
FT                   polyhydroxyalkanoate synthesis repressor PhaR; PFAM: PHA
FT                   accumulation regulator DNA-binding protein; PHB
FT                   accumulation regulatory domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69315"
FT                   /db_xref="GOA:E3I496"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:E3I496"
FT                   /inference="protein motif:TFAM:TIGR01848"
FT                   /protein_id="ADP69315.1"
FT                   /translation="MTEPAEKLSRGSGYGDGAKTVPLSAVGKKVSELDKSKPVIIKKYA
FT                   NRRLYNTETSSYVTLEDLGEMVRSERDFLVYDAKTGEDLTHTVLTQIIVEEEGKTGSNL
FT                   LPIGFLRQLIRFYGHSIEQIVPKYLEFSLTALTREQEKYHKQFTDTFGNVAFGAMQEQA
FT                   RQNMVIFERAFSMFAPFAKIEAPAEGDKPQAAKKPDATEAASTTPELAELKAQLAAMQA
FT                   QIDRLTKAKADEEKR"
FT   gene            29582..29922
FT                   /pseudo
FT                   /locus_tag="Rvan_0025"
FT   gene            30045..30245
FT                   /locus_tag="Rvan_0026"
FT   CDS_pept        30045..30245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afm:AFUA_8G02570 flavin-binding monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69316"
FT                   /db_xref="UniProtKB/TrEMBL:E3I497"
FT                   /inference="similar to AA sequence:KEGG:AFUA_8G02570"
FT                   /protein_id="ADP69316.1"
FT                   /translation="MLEDKIEVAGYSSLVLANTKNAIPDKQDWLRTSGNQLPGTPNYSF
FT                   GIGVLLGDGEPGYARVGMSLR"
FT   gene            30556..31566
FT                   /locus_tag="Rvan_0027"
FT   CDS_pept        30556..31566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0027"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   aca:ACP_0749 NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69317"
FT                   /db_xref="GOA:E3I498"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I498"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP69317.1"
FT                   /translation="MPPKDAKILVAGAGGFIGGHLVAKLRSLGYSDIRAVDIKPLTYWY
FT                   QRSDEVDNCVLDLNRRDACFDAVDGAHTVYNLAANMGGMGFIENNKALCMLSVLINTHL
FT                   LEAAKHRKLPGRFFYSSSACVYNGAKQTRTDVTALKEEDAYPADAEDGYGWEKLFSERM
FT                   CRHFREDFGVVTRVARFHNVYGPHGTYAGGREKAPAAICRKVIDAQMTGKPFIEIWGDG
FT                   EQTRSFMYITDCIDGIFDITNSGIEYPINLGSSELVSINQLVDIVESIASVRLDRRYNL
FT                   DAPKGVRGRNSDNTLIRKELNWEPSVKLRDGMEKTYRWIWDEMHKAGNESVVNLT"
FT   gene            31623..32708
FT                   /locus_tag="Rvan_0028"
FT   CDS_pept        31623..32708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0028"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   met:M446_5589 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69318"
FT                   /db_xref="GOA:E3I0E5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:E3I0E5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP69318.1"
FT                   /translation="MAQTVCILLSSEDRSRLAAVIGDRNSPQKHAQRAKIVLHSAERRS
FT                   VFDVARLSGVSRPAVWRWQRRYAEKGVDGLLRDQTRKPGKPPLSAKSVAKVLALPCSEP
FT                   PGNATHWTGRAVAKAAGVSLRTVQRIWGAHRLQPHRLRTFKKSNDPAFAEKVEDVVGLY
FT                   MSPPCHAVVLSIDEKSQIQALDRTQPGLPLKPGKCATMTHDYKRNGTTTLFAALNVLDG
FT                   TVLGRCMKRHRHQEFIKFLNAVERKVPAGKIIHVILDNYGTHKHPKVDAWLADHPRWVF
FT                   HFTPTSASWLNAVENFFSAITRRRIRRGVFKSVADLEDAIKRYIADHNRNAKPFVWTKT
FT                   ADEIFDKLNRLNLHLLNESVH"
FT   gene            32855..34291
FT                   /locus_tag="Rvan_0029"
FT   CDS_pept        32855..34291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0029"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   afw:Anae109_4434 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69319"
FT                   /db_xref="GOA:E3I4A0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4A0"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69319.1"
FT                   /translation="MAENLVSVGRIAFESDASPSNRKEEVSAAVGRGGVPGRLMILTQV
FT                   YVPDPAAVGQHMHDFAAAMAARGHEVIVYCSSRGYDDPRQSFPRFEIRDGVKIIRYSLP
FT                   IFTKSNMLLRIVGSVWAQLALFFHALFTLRTEMIFFSTSPPMIGVTATLVAKLKSLFSF
FT                   GKQAQLVYWAMDLNPDQLVAMRKLRAGSLAHRLLEAANRFVLRNADLTIALDRFMEARL
FT                   KQHGRAPQKVLVLPPWSHEKPDAPLPHPANWFRDKHGLQGRFVVMYSGNHSPANPIDTL
FT                   LAAALAFKDDDTIRFAFIGGGAAKKQVNEHIERHGLRNCLSLPYQPLSDLRYSLGAADV
FT                   HAVSLGEHMVGIVHPCKVYGAMAVGRPILYLGPRPSHVSDLIEGEGIGWRIAHGDVAGC
FT                   VTAIQEMKDLASPDLAAKGARAQAALRSSLAPTHLLNVMCKAIEGLLAGRIAEKSAYVE
FT                   QHTAEQASTARSDKVHNMIE"
FT   gene            complement(34546..36099)
FT                   /locus_tag="Rvan_0030"
FT   CDS_pept        complement(34546..36099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0030"
FT                   /product="glycine dehydrogenase subunit 2"
FT                   /note="KEGG: bid:Bind_0736 glycine dehydrogenase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69320"
FT                   /db_xref="GOA:E3I4A1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4A1"
FT                   /inference="similar to AA sequence:KEGG:Bind_0736"
FT                   /protein_id="ADP69320.1"
FT                   /translation="MVEMPKVILPAAEAAAPAPTFTGNRALQIEEPLIFEIGSAETSGV
FT                   DFEEPAETETRLGGLERTEVIGLAGLSEPETMRHYVRLSQKNYSIDTGIFPLGSCTMKH
FT                   NPRLNEKMARLPGFADIHPLQPEKTVQGALALMTELSRWLLELTGMHAIALSPKAGAHG
FT                   EFCGMAAIKAALEARGEADTRRVVLVPVSAHGTNPATAAHLGFTVRAVEAGPDGTVSVD
FT                   AVRAALGPDVAAMMLTNPNTCGLFEPHIREIADALHEAGAYLYCDGANFNAIAGKVRPG
FT                   DLGADAMHINLHKTFSTPHGGGGPGAGPVVLSEALAAYAPVPFVRREGDAFRLVEHAAD
FT                   APEGAAPFGRLAAFHGQMGMFVRALAYMMSHGADGIRQASEDAVLNANYVRARLADVLT
FT                   QPFPEGAMHEVLFDDRFLKGTGVSTLDFAKALIDEGFHPMTVYFPLVVSGAMLVEPTES
FT                   ESKQSLDQFIDAVRALALAAKAGDAARFTEAPRFAPRSRLDETRAARDPVLSYREKMPE
FT                   "
FT   gene            complement(36092..37435)
FT                   /locus_tag="Rvan_0031"
FT   CDS_pept        complement(36092..37435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0031"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="KEGG: pla:Plav_0690 glycine dehydrogenase subunit 1;
FT                   PFAM: Glycine cleavage system P-protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69321"
FT                   /db_xref="GOA:E3I4A2"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4A2"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ADP69321.1"
FT                   /translation="MRYLPHTDADRRAMLDAIGVADIDALFAAVPEGALRRELPDLPRA
FT                   QSEIAVERALSRLAARNVPASSVPFFAGAGAYKHHIPATVDHIIQRSEFMTAYTPYQPE
FT                   IAQGTLQYLFEFQSQVAALTGMEVANASMYDGSTAAGEAVLMAHRVTRRGKAVVAGGVH
FT                   PHYRAVIETVSRLGGFEVDARAVDPEATFEADADKDTSCIVVQMPDAFGRVADLSALAE
FT                   KAHEAGALLVVVVTEAVSFGALKSPGAMGADIVVAEGQSIGNGLNFGGPYLGLFATRKK
FT                   FVRQMPGRLCGETVDHDGRRGFVLTLSTREQHIRREKATSNICTNSGLCALAFTAHLTL
FT                   LGEAGLKTLARINHANAVALAKALESVPGVDVVTPAFFNEFTIRTPKLGAAVIDALADR
FT                   GIIGGVPASRLWPDEPTLANAIVVASTETTTPDDIAAFRAALEEVLHG"
FT   gene            complement(37435..37812)
FT                   /locus_tag="Rvan_0032"
FT   CDS_pept        complement(37435..37812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0032"
FT                   /product="glycine cleavage system H protein"
FT                   /note="KEGG: tma:TM0212 glycine cleavage system protein H;
FT                   TIGRFAM: glycine cleavage system H protein; PFAM: glycine
FT                   cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69322"
FT                   /db_xref="GOA:E3I4A3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4A3"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ADP69322.1"
FT                   /translation="MALIKYTEDHEYISVEDGVGTIGITDYAQGKLGDVTFVELPKIGE
FT                   KVKQGQPIAVVESVKAASDIYSPVSGEVVEINEILNDKPELINQEPEAGAWIYKLTLSD
FT                   VAELDKLMDQDAYLAYASAEG"
FT   gene            complement(37831..38982)
FT                   /locus_tag="Rvan_0033"
FT   CDS_pept        complement(37831..38982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0033"
FT                   /product="glycine cleavage system T protein"
FT                   /note="KEGG: azc:AZC_4245 glycine cleavage system T
FT                   protein; TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69323"
FT                   /db_xref="GOA:E3I4A4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4A4"
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /protein_id="ADP69323.1"
FT                   /translation="MSAAPATHRETTPPLRQTPLAALHHELGAKLVPFAGYEMPVSYAT
FT                   GIVKEHAHVRERAGFFDVSHMGQARIAGPDFATVAAAFERLVPGDIAGLKPGQIRYTQL
FT                   LNDEGGIIDDLMATREADGTGLFLVVNASRKEVDFAHIAAHLPPSVTLAPLADRSLVAL
FT                   QGPEAARVLKRQMPEAGGLAFMTAAPLDWRGTAVFVSRSGYTGEDGFEISVPADAAEAF
FT                   ARSLLAHPEVAPIGLGARDTLRLEAGLPLYGQDMDETTSPIEAALEFSIGKRRRRDGGF
FT                   IGAERVQRELAEGPARVRVGLRLEGRSAARTHMKIASETGETMGEITSGAYTPTAAASI
FT                   AFGYVPPRSSTAGTRVAVEIRGAFQPALVVDLPFVPHRYVRKV"
FT   misc_binding    complement(39025..39144)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   38.97"
FT   misc_binding    complement(39145..39228)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   48.55"
FT   gene            39521..40588
FT                   /locus_tag="Rvan_0034"
FT   CDS_pept        39521..40588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0034"
FT                   /product="6-hydroxycyclohex-1-ene-1-carbonyl-CoA
FT                   dehydrogenase"
FT                   /note="KEGG: geo:Geob_0097
FT                   6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase;
FT                   TIGRFAM: 6-hydroxycyclohex-1-ene-1-carbonyl-CoA
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES domain
FT                   protein; Alcohol dehydrogenase zinc-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69324"
FT                   /db_xref="GOA:E3I4A5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4A5"
FT                   /inference="protein motif:TFAM:TIGR03201"
FT                   /protein_id="ADP69324.1"
FT                   /translation="MPIAAYRWVMTSVGEPLIRQSFELGAPAAGEVTVEIAGCGVCHTD
FT                   LGYYYDGVRTNQPLPLTLGHEISGRVVAAGTGAEHWLGRAVIIPAVIPCGTCDACKRGK
FT                   GTICAKQVMPGNDIEGGFASHITVPSFGLCAVNENRLEAAGLKLSDVSVVADAVTTPYQ
FT                   AVIQAGVGPGTLCIVIGVGGVGGHCAQVASAFGGTVVAIDVDDVKLAAIAAHGVAKTFN
FT                   ARRVDPKALKKEIAGFAKENGLSTREWVIFECSGTAAGQSTAWSLLVHGATLAVVGFTM
FT                   DKVEVRLSNLMAFHARALGNWGCATELYPGALDLVLDRKIELAAFIERHPLDSINEIFA
FT                   MAHEHKLTRRAILVP"
FT   gene            40627..41763
FT                   /locus_tag="Rvan_0035"
FT   CDS_pept        40627..41763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0035"
FT                   /product="6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase"
FT                   /note="KEGG: mag:amb2143 dihydroxynaphthoic acid synthase;
FT                   TIGRFAM: 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase;
FT                   PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69325"
FT                   /db_xref="GOA:E3I4X1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017613"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X1"
FT                   /inference="protein motif:TFAM:TIGR03200"
FT                   /protein_id="ADP69325.1"
FT                   /translation="MTLTTASIARATAPEALHDHNLAEIVVPGVRYEKRPARTPDGEIV
FT                   PGLYNAWITLDNPAQYNSYTTEMVKAVILAFRAASNARDVVATVFTGAGDKAFCTGGNT
FT                   KEYAEYYAGNPQEYRQYMRLFNDMVSAILGCDKPVVCRVNGMRIGGGQEIGMACDFTIA
FT                   QDLARFGQAGPKHGSAPIGGATDFLPVMVGAEMAMVSGSLCEPWTAHKAYRLGMITDIV
FT                   PALKVDGRFVANPLVITDRYVDEYGRIVHGEPKTGAELAAGKDVLKKGTVDLSLLDAKI
FT                   EELCGKILLTFPDCFTKTIEELRKPKINAWNANKENSRAWLALNMMTEARAGFRAFNEG
FT                   TKDDREIDFIALRQALAAGAPWTPELTEALLPAARGAK"
FT   gene            41760..42530
FT                   /locus_tag="Rvan_0036"
FT   CDS_pept        41760..42530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0036"
FT                   /product="cyclohexa-1,5-dienecarbonyl-CoA hydratase"
FT                   /note="KEGG: gme:Gmet_2150 enoyl-CoA hydratase/isomerase;
FT                   TIGRFAM: cyclohexa-1,5-dienecarbonyl-CoA hydratase; PFAM:
FT                   Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69326"
FT                   /db_xref="GOA:E3I4X2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR017602"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X2"
FT                   /inference="protein motif:TFAM:TIGR03189"
FT                   /protein_id="ADP69326.1"
FT                   /translation="MTIEPLKVWHDRGGALLRLRLARPKANIVDAQMIAALTAALDAHM
FT                   NDPAILAVLIDHEGPHFSFGASVQEHLPDQCDAMLKSFNALVMRLVAAPVPVLVAVRGQ
FT                   CLGGGMEVAIAGSRIFATPDAKFGQPEIILGVFAPPASCILPEKIARSAAEDILLSGRS
FT                   ISGEQAFGLGLVSEITPEPEAAALSYFDHALAALSPSSLRIAVKAARLDMVERIRTKLC
FT                   NLEHLYLEKLMSTKDAVEGLTAFIEKRPAQWEAR"
FT   gene            42533..43696
FT                   /locus_tag="Rvan_0037"
FT   CDS_pept        42533..43696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0037"
FT                   /product="benzoyl-CoA reductase, subunit C"
FT                   /EC_number="1.3.7.8"
FT                   /note="TIGRFAM: benzoyl-CoA reductase, subunit C; KEGG:
FT                   mag:amb2141 C-subunit of benzoyl-CoA reductase; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69327"
FT                   /db_xref="GOA:E3I4X3"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR011958"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X3"
FT                   /inference="protein motif:TFAM:TIGR02263"
FT                   /protein_id="ADP69327.1"
FT                   /translation="MTTTAEIVSRCEAIFEDLDFTAARAWKDAVPGRKVVGFLPLYAPL
FT                   ELIHAAGCLPLGLFGGGDKLEVIHGDAFYQSYICRIPRSTVELGMTKRLDFVDGMIFPF
FT                   VCDVIRNLSGMWKIMFPNVWTKFFDTPQNFDPEIGGSYYVTELQEMRDGLETLTGRKIS
FT                   DDDLRRSIALYNENRRLVRQLYAFRARQPWKAPTSEVYLLMRAGLMIDVAEHNALLLDY
FT                   MAAAEKEDRPKRDNVRVAIYGSFCEQPPLNLIKSIEMAGCYVVEDDYILVNRFLTEDVA
FT                   LDIDPLEALATAYIAHSVETSCKYVPREGEKGKFHVDQIRKAGAEGVIYATPSFCDPAL
FT                   LDRPMICKKLTEEGIPHISFKYAENSGQMQPVREQAGTFADSIKLWS"
FT   gene            43700..44983
FT                   /locus_tag="Rvan_0038"
FT   CDS_pept        43700..44983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0038"
FT                   /product="benzoyl-CoA reductase, subunit B"
FT                   /EC_number="1.3.7.8"
FT                   /note="TIGRFAM: benzoyl-CoA reductase, subunit B; KEGG:
FT                   mag:amb2140 B-subunit of benzoyl-CoA reductase; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69328"
FT                   /db_xref="GOA:E3I4X4"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR011955"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X4"
FT                   /inference="protein motif:TFAM:TIGR02260"
FT                   /protein_id="ADP69328.1"
FT                   /translation="MSDIVKEPSMLLQKEMIARNYEAITSKHETGRKVSSTFVPGNLNE
FT                   LLLCFDIVNNLPEINAIQNGMRKLSGNYIMDAEKSGHSEDVCTYVKADIGMMGAGNIAP
FT                   NGKPFPKPDVLLLSYTGCYTFMKWFELLREEYKCPTLMLHVPYEGDGHSTKNMRDYIVK
FT                   QLKEVIIPGLEQVSGIKFDIDRLREALRNSAKAEDNLVWVLESGKNKPSPIDAYFGGVY
FT                   YIGPIFTAFRGTPDAIAYYDALRTEVQARIDTRQGPITPDGSNFNDQRYRLVVEGPPNW
FT                   THFREFWKMFSDEGAVVVASSYTKVGGMYDLGFRHNADNPLETLADYCLGCYTNRNLPT
FT                   RVDILAKYIEEYEADGLLINSIKSCNSFSAGQLMMMNEVERRTGKPGAFIETDLVDPRY
FT                   FSAANVKNRLESYFQMIEQKRLGSAKAA"
FT   gene            44998..46290
FT                   /locus_tag="Rvan_0039"
FT   CDS_pept        44998..46290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0039"
FT                   /product="benzoyl-CoA reductase, subunit A"
FT                   /EC_number="1.3.7.8"
FT                   /note="TIGRFAM: benzoyl-CoA reductase, subunit A;
FT                   CoA-substrate-specific enzyme activase; KEGG: mag:amb2139
FT                   2-hydroxyglutaryl-CoA dehydratase activator protein; PFAM:
FT                   ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69329"
FT                   /db_xref="GOA:E3I4X5"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR011954"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X5"
FT                   /inference="protein motif:TFAM:TIGR02259"
FT                   /protein_id="ADP69329.1"
FT                   /translation="MRCFIGIDLGSTTTKAVVMDENQNVLGRGITNSRSNYDTAAAVSK
FT                   QEALVDTRLTLFRRALEAVPGTADTAEAVLAGLERNFRHIQFVEQLEDLERTCIGNVKG
FT                   PRFAGREKPVIEALAETFRRLREHSATQFAPGFRRKSDFFRDLAGGDFMHNGEAVCREA
FT                   GLAFDLILNIYDKSIIEVENRPPAGDIEGKFVRALEMGSLDQSLIAAPVKAALSIPLEE
FT                   TYVVGTGYGRVRLPFPKEHIRSEILCHGLGAHIMYPRTRTVLDIGGQDTKGIQVDPAGI
FT                   VENFQMNDRCAAGCGRYLGYIADEMNMGLQELGPLAMQSTKQVRINSTCTVFAGAELRD
FT                   RLALGEKREDILAGLHRAIILRAMSILSRAGGVKDQFTFTGGVAKNEAAVRELRKLIKE
FT                   NYGDVQININPDSIYTGALGGAAFAVRAVLN"
FT   gene            46312..47154
FT                   /locus_tag="Rvan_0040"
FT   CDS_pept        46312..47154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0040"
FT                   /product="benzoyl-CoA reductase, subunit D"
FT                   /EC_number="1.3.7.8"
FT                   /note="TIGRFAM: benzoyl-CoA reductase, subunit D;
FT                   CoA-substrate-specific enzyme activase; KEGG: mag:amb2138
FT                   D-subunit of benzoyl-CoA reductase; PFAM: ATPase
FT                   BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69330"
FT                   /db_xref="GOA:E3I4X6"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR011956"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X6"
FT                   /inference="protein motif:TFAM:TIGR02261"
FT                   /protein_id="ADP69330.1"
FT                   /translation="MSAIITAGVDIGSGCVKTVLFEVDGEKTRWLGKEYARIRSRDPFA
FT                   LAAETYDAMLAKAGVSAGDVAYVASTGDAENLRFATGHFYSMTTHGRGAVYLNPEARSV
FT                   LDIGALNGRAIRIDGGGKVLNYKMTSQCASGSGQFLENIARYLGIAHDEIGMLSQQADN
FT                   PERVSSICAVLAETDVINMVSRGISAANILKGIHVSMAVRLAKLLKSIGSTDGVVQMTG
FT                   GLALDTGLVAALNEALVKEKVALVAESHPDSIYAGAVGGALWGAFRHQKLSRLEAVAA"
FT   gene            47161..47877
FT                   /locus_tag="Rvan_0041"
FT   CDS_pept        47161..47877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0041"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mag:amb2150 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69331"
FT                   /db_xref="GOA:E3I4X7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP69331.1"
FT                   /translation="MAQKKNEAFVGRTAIVTGGSRGIGRAIAEGLKAGGARVVVFDRTE
FT                   GELTGMDFRAVDIANSAAVAAAVGSLDRPADLLVNNAGITRDRSLMKMSDEEWQGVLDV
FT                   NLTGAFMMLRAVAPAMCAQGFGRIVNVVSINGLRGKFGQANYAASKAGLVGLTKTAARE
FT                   LGPKGVTVNAVAPGMVLTEMTLALAEDVRRKALDESALKKLPGVDDIADAVLFLLSDRA
FT                   SFITGQVLKVDAGQYI"
FT   gene            complement(47947..48396)
FT                   /locus_tag="Rvan_0042"
FT   CDS_pept        complement(47947..48396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0042"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: mag:amb3391 transcriptional regulator;
FT                   TIGRFAM: transcriptional regulator, Rrf2 family; PFAM:
FT                   protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69332"
FT                   /db_xref="GOA:E3I4X8"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X8"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADP69332.1"
FT                   /translation="MRLQVATRHAIFSVLELAAQPHRQMSAVDIAEKYAISPNHLAKVL
FT                   RTLGREGIVDASRGVGGGYRFVGNPKRLTLFDIIAIFEPIGPTTGGFEAGDDTSEGQAL
FT                   RLVMNEIEDTARATLSSITIDTMLKIARRSKGASIETVIRQAAGQ"
FT   gene            complement(48393..48845)
FT                   /locus_tag="Rvan_0043"
FT   CDS_pept        complement(48393..48845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0043"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mag:amb3392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69333"
FT                   /db_xref="GOA:E3I4X9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4X9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP69333.1"
FT                   /translation="MAEEQHFIIRPACAADIEPIIRLDAAVTSTPKPAYWEALFKDCQS
FT                   RRKQHFLLVAVKDDILLGFIAGEIRAWEFGSPPCGWVFAIAVDPNTRLSGMGADLFQAI
FT                   CDAFRRAGITKVRTMVARDAQLVMSFFRAQGMMAGPFVELEKDLDE"
FT   gene            49071..50636
FT                   /locus_tag="Rvan_0044"
FT   CDS_pept        49071..50636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0044"
FT                   /product="benzoate-CoA ligase family"
FT                   /note="KEGG: hoh:Hoch_6534 benzoate-CoA ligase family;
FT                   TIGRFAM: benzoate-CoA ligase family; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69334"
FT                   /db_xref="GOA:E3I4Y0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y0"
FT                   /inference="protein motif:TFAM:TIGR02262"
FT                   /protein_id="ADP69334.1"
FT                   /translation="MGLLVVAGEEIAFPPVFNVASEFIDRHLREGKATKVAVRTRKGDT
FT                   TYRELFEGVNQTANFLDAAQVGRGERVLMIVKDSVEFFFIFWGAIKAGIVPVPVNTLLR
FT                   AKDYAFIIENSACAGLIYSPEYAGEVEAALASIPHRPGLVLKIADEGDTLANRIAPYST
FT                   EFAAVEASPTDECFWLYSSGSTGNPKGAVHLQRDMVVSSEFYGVRTLGAGEDDVFFSAA
FT                   KLFFAYGLGNGMTFPLWVGGTAVLLDEKPTPSNTFALIETFRPTLFFGVPTLYAAQLQA
FT                   LENVTPDLSSLRMCVSAGEALPADIFRRWREHTGTLILDGVGSTEALHIFISNRVGQFK
FT                   PGSSGLVVEGYDAKVVDEAGRTVPTGETGRLFIKGLSMAKYYWRNPEKTAETMLGEWIN
FT                   TGDTYYRDEHGYFFYCGRSDDMLKVGGIWCSPFEIESTLIEHPTVFEVAVVGRSDGEGL
FT                   VKPEAWIVLNDEARPTEALEDELRTFCKTKLAPYKFPRRFHFVDSLPKTATGKIQRYRL
FT                   RAEE"
FT   gene            50640..51839
FT                   /locus_tag="Rvan_0045"
FT   CDS_pept        50640..51839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0045"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.174"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   mag:amb2595 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69335"
FT                   /db_xref="GOA:E3I4Y1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP69335.1"
FT                   /translation="MRDAYIYGGLRTPIGRHAGALAAVRPDDMAAHVIRAALAASPFDA
FT                   ADVEDVILGCACQAGEDARNVGRHAALLAGLPQEVGGATVNRLCGSGMNAVIDAGRAVT
FT                   LGHAELIVAGGVESMTRAPFVIAKPQAAYGRDTAIYDTTIGARFVNARLVATYGNDSMP
FT                   ETADNIAHDLGISRAEADAFALASQEKTARAVKEGFYEGEIVAVEIPGRRGEAIRVSSD
FT                   EHPRPETTRETLARLKPLAEGGIVTAGNSSGINDGAAALLIGSRSAGEKAGAEPLAIVR
FT                   AAAVAGVPPRIMGVGPVPASAKALERAGLTLADMDVIEINEAFATQVIGCCRLMTLDPS
FT                   DSRLNPNGGAIALGHPLGASGARLMLTAARQLQRSGGRYALVTMCIGVGQGIAAVLERA
FT                   "
FT   gene            complement(51916..52581)
FT                   /locus_tag="Rvan_0046"
FT   CDS_pept        complement(51916..52581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0046"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mag:amb4338 ABC-type cobalt transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69336"
FT                   /db_xref="GOA:E3I4Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69336.1"
FT                   /translation="MSPELLRLSGVSFAYDRERPVLRGADFVLHAGERVAVTGPNGAGK
FT                   TTLLHVMVGLAKPSAGTIEAFGKIRTSEGDFPEVRRRAGLLFQDADDQLFCPTVAEDVA
FT                   FGPLNLGKSRAEAREITRRTLDRLGLQGFDERITYKLSGGQKRLVALAAVLAMEPEVLL
FT                   LDEPTTALDTETEERMVDILNSLPQAMVIVSHDRDFLAKVANRWVRLENGALREAASA"
FT   gene            complement(52746..53558)
FT                   /locus_tag="Rvan_0047"
FT   CDS_pept        complement(52746..53558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0047"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="KEGG: rpe:RPE_1968 cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69337"
FT                   /db_xref="GOA:E3I4Y3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y3"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADP69337.1"
FT                   /translation="MSLAGEQTGAVNEGCCDGAVALAGSRSGGDQRNFVQSVDPGLRLL
FT                   VCAVFCLVVVSLKSLTALSLALGIATLAVAAARQSPGTALRRMAALDGFMLMVLAMLPF
FT                   STPGEPLFSVAGLPASREGALLGAMILLKANAVVLMILALLSSMEPALLGRAMNRLRLP
FT                   SKFVLLFLFTLRYIDVLGREYRRLRVAMKARGFRMRCDLHTWRSIGYLVGMLLVRSIER
FT                   SERIVAAMRCRGFNGTFPALSENAPLSLRDGAFAGLSLGVCLGLALVQ"
FT   gene            complement(53555..54193)
FT                   /locus_tag="Rvan_0048"
FT   CDS_pept        complement(53555..54193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69338"
FT                   /db_xref="GOA:E3I4Y4"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y4"
FT                   /inference="similar to AA sequence:KEGG:RPC_1950"
FT                   /protein_id="ADP69338.1"
FT                   /translation="MTRVSIPALVAVMLLMFGGVAEAHKLKVFATATGAAIEGYAYFGT
FT                   GGRARQSSVTVASPDGTVLGKTTTDDEGNFRYEATRRVDHVITVDGGDGHVASYTVAAD
FT                   ELPQTLASGGDAAAAKPSAERTGVPVAAASAVSRTGEDTDLKAFIDQSIARQIRPLREQ
FT                   IDAYQEKIRLHDILGGLGYILGLGGLAFGLAQRRKWVRGGASDVTRDAQ"
FT   sig_peptide     complement(54122..54193)
FT                   /locus_tag="Rvan_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.981 at
FT                   residue 24"
FT   gene            complement(54206..54817)
FT                   /locus_tag="Rvan_0049"
FT   CDS_pept        complement(54206..54817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0049"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: rpc:RPC_1951 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69339"
FT                   /db_xref="GOA:E3I4Y5"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y5"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADP69339.1"
FT                   /translation="MAHIPDGVLSAPVLIAGAAVSLAGCGYALRHLDEERIPEVAILAA
FT                   VFFVASLVHFPVGPTSVHLILNGLTGILLGWAAFPAIAVALLLQAVLFGFGGLVVLGVN
FT                   IMNMAVPAVLCGYLFQAVAGNGANRQRVLWGAGLAGGLGVLITAILVAAVLALSGREFL
FT                   AAANLVVVAHVPVALIEAAFSVAVIGLLSRVKPSLLGFQA"
FT   gene            complement(54872..55639)
FT                   /locus_tag="Rvan_0050"
FT   CDS_pept        complement(54872..55639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0050"
FT                   /product="Nickel transport complex, NikM subunit,
FT                   transmembrane"
FT                   /note="PFAM: Nickel transport complex, NikM subunit,
FT                   transmembrane; KEGG: rpe:RPE_1971 ABC-type Co2+ transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69340"
FT                   /db_xref="GOA:E3I4Y6"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y6"
FT                   /inference="protein motif:PFAM:PF10670"
FT                   /protein_id="ADP69340.1"
FT                   /translation="MRFPAGLAATSVAALLLFSAAAHAHFQELLPSADIVPDEGDRKVK
FT                   LQAVFTHPMEGGPNMDMGQPQQFGVLADGEKVDLKSSLKPVEVSGKKAFEATYQIKKPG
FT                   DYVFFLEPAPYWDEGEKHFLIHYTKVVVDFGSGEGWDKLVGFPVEIEPLSRPYGVWTGN
FT                   LFRGVVRKDGKPVPGAVVEIEWANDGSVKAPSDPFVTQVVKADDNGVFAYAIPKAGWWG
FT                   FNALIDGETKGPDGKPAEAELGGTIWVKAVDMK"
FT   sig_peptide     complement(55565..55639)
FT                   /locus_tag="Rvan_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            55806..56231
FT                   /locus_tag="Rvan_0051"
FT   CDS_pept        55806..56231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0051"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; KEGG: rpc:RPC_1953 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69341"
FT                   /db_xref="GOA:E3I4Y7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y7"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ADP69341.1"
FT                   /translation="MERVTISLDEDLLGHFDRYLDKKGYASRSEAIRDLLRDKLEQEKL
FT                   SEDKAENAIACLSYVYNHEQRELSRRLARTQHAHHHLVLSTLHVHLDYENCLEVALLKG
FT                   NTHDVRKLAEATIAETGVRHGNLHIVPDDMPKRHHHD"
FT   gene            complement(56274..56347)
FT                   /locus_tag="Rvan_R0001"
FT                   /note="tRNA-Cys1"
FT   tRNA            complement(56274..56347)
FT                   /locus_tag="Rvan_R0001"
FT                   /product="tRNA-Cys"
FT   gene            56478..57146
FT                   /locus_tag="Rvan_0052"
FT   CDS_pept        56478..57146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0052"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: rce:RC1_1158
FT                   protein-L-isoaspartate O-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69342"
FT                   /db_xref="GOA:E3I4Y8"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y8"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ADP69342.1"
FT                   /translation="MNFATARLHMVESQIRPNGVRDPLILDAFASLPRELFVPEQRQHL
FT                   AYIDEGVLAVEAAADEPARYLLQPMVLARLLEAAEPRREDHVLDVGGATGYGAAILSRL
FT                   AAKVDALETSAALAEAMRKRLSFVGASNVDVHAGPLEKGVPSKKPFDLIVVNGAVADEP
FT                   KTLLEQLADGGRLVAVVRKGWLGRAWLYEKSGDSVSGRPLFDAPADYLPGFEPQPQFTF
FT                   "
FT   gene            57586..59196
FT                   /locus_tag="Rvan_0053"
FT   CDS_pept        57586..59196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0053"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="KEGG: msl:Msil_1453 type I secretion outer membrane
FT                   protein, TolC family; TIGRFAM: type I secretion outer
FT                   membrane protein, TolC family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69343"
FT                   /db_xref="GOA:E3I4Y9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Y9"
FT                   /inference="protein motif:TFAM:TIGR01844"
FT                   /protein_id="ADP69343.1"
FT                   /translation="MPLQRLSSRFVRASRTLCSALALSIAFGAPVSAESLKEALTAAYL
FT                   YNPTLKAARAQLRSTDNQVARAKSGYRPRVNATLQAGRADTRTRYDNSGVDAGTLAACL
FT                   NTDCSIDPTGQGLAPVSVGTLSNLEASNGVYSPRTARIAVQQNVFDGFRTYNNIKGAEA
FT                   AVEAGREDVRNSEQTMLLNAVTSYMDVVRDQAIVNLRQSNVRVLAEQLRATEDRFKVGE
FT                   VTRTDVAQAQSGLAQSQADLSIAQGTLYGDQARFAQYIGHPPGTLRDPGPATNLLPKTL
FT                   DDAIAVAQSENPLILSSLFRERAQQHQVKQVKGELLPNLAVEASYTKGAQTQSPLINQY
FT                   DDARVVGTLNIPIYEGGEVSARIRAEIETLSQRRQQIDESREIARQQVSSAWGLLIAAK
FT                   GNVAAGEAAVEATRIALQGVREEERVGQRTLLDVLNSEQQNLNAQVNLVSYRRDLVVAS
FT                   YSVLSGMGRLTASDISLQAELYDPTRYYSQVKDTWYGWGASVESQEDPRVAPVEDPGLL
FT                   PGQDSGDGPAYTQKLPQIP"
FT   sig_peptide     57586..57687
FT                   /locus_tag="Rvan_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.984 at
FT                   residue 34"
FT   gene            59307..61103
FT                   /locus_tag="Rvan_0054"
FT   CDS_pept        59307..61103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0054"
FT                   /product="Protein of unknown function DUF2497"
FT                   /note="PFAM: Protein of unknown function DUF2497; KEGG:
FT                   pcs:Pc22g03720 Pc22g03720"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69344"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z0"
FT                   /inference="protein motif:PFAM:PF10691"
FT                   /protein_id="ADP69344.1"
FT                   /translation="MNRADQAPEPSMEEILASIRSIIADDGKPSAAESARAAPAGSPAA
FT                   PVEEDVLDLTEELVFPVERAAASTPPVSSAPEQPALNRARFDAQPAASDLRHGAVEPNC
FT                   QAAERAEPEPAAHAVASPQEAHSGARAASAQAMPPMERVAAHLETSQPEAPRQETYRPE
FT                   TPRTEADPREAQPRPAQATPRSIWSRREMPGSPAPAPASPVTPRAAAEPPARPQKRWAE
FT                   DIHMPIPAGGPVPLIPQDIQPRVEEAAKLQTVTAPEHEATAAEPEDSAMAMLAERLARD
FT                   AVSAMDAEELTQASEVDFAALEDERKAEVTESFASAIERQSEGNSGQPLPSLLDEVLRH
FT                   DFRRDADEDEDDETEASDAAAVSEPEIAHDAPEEAEDASVYAPTEAVDTTPVEEPEAEQ
FT                   PVFETEHFREIEEARSEDLPSEEAQADEAATDEPSVEQDHFEQEFEPRFEAPVERGPRP
FT                   DFAPWLVASPVHDEPASAFLASEPEAEREPEPAREEVELPLAQARFIGAEPSSYTQQLV
FT                   TEPSPYAPQVVAAQAPAPAPAPSQATAVPPAATGPLEAAVREMLRPMLVQWLNENMPRI
FT                   LESAIREEIASRGVLPKPDDQV"
FT   gene            61259..64087
FT                   /locus_tag="Rvan_0055"
FT   CDS_pept        61259..64087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0055"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="KEGG: rpb:RPB_2892 valyl-tRNA synthetase; TIGRFAM:
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69345"
FT                   /db_xref="GOA:E3I4Z1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z1"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ADP69345.1"
FT                   /translation="MLEKTYDHAAIEPRMSKAWEDAEAFRAGKALEVNPKAEPYSIVIP
FT                   PPNVTGSLHMGHALNNTLQDVLARFYRMRGRDVLWQPGTDHAGIATQSLVERQLAEKQE
FT                   PSRRDLGREEFLRRVWAWKEHSGGTIVNQLKRLGASCDWSRERFTMDEGLSRAVVKVFV
FT                   DLYNDGLIYKDKRLVNWDPKLQTAISDLEVIPVETKGHLWYFKYPIKDAENLERKFVVV
FT                   ATTRPETMLGDTAVAVNPEDERWKPYIGKTVILPLVGREIPIVADEHADPEQGSGAVKI
FT                   TPAHDFNDFEVGRRHDLPLINIFTPTGTLNDEVPEAYRGLDRFEARKRIVADLEALELV
FT                   EKIEPHALKVPYGDRSNVVIEPYLTDQWYVDAKTLAQPALAAVREGKTRFVPENWRTVY
FT                   FQWLDNIQPWCISRQLWWGHQIPAWYHPVWDLSFPMPSWVGNEIAVASTEEEAIRLAYD
FT                   YYTKHAEPLGLQLDKLKIEVVPEMPNGSWIEIVREIREGVRPIPLWRDEDVLDTWFSSG
FT                   LWPFSTLGWPDETPELARYYPTSVLVTGFDIIFFWVARMMMLGLHFKKEVPFRDVYIHA
FT                   LVRDEKGAKMSKSKGNVVDPLSVMDNYGADALRFTMAAMAAQGRDVKLSMQRIEGYRNF
FT                   ATKLWNAARFCEMNGCVRKEGFDPAAVKLTLNRWIYAEAQATAAAVTEAIEAYRFNDAA
FT                   GAVYRFVWNRFCDWYLEFAKPVFMGEDEAAKAETQAMAAWALDEILKLLHPFMPFVTEE
FT                   LWTVTGEEGPARESLLALASWPVPAKDTDAKALAEIDWVIDLISEIRSLRSEMNVPPAT
FT                   LLPLTLTGATDDTKARAARYEAFLKRMARISDIGFADVPPQGSAQFVLGEATMALALAG
FT                   VIDIAAERERLKKEIGKHESEITKIDARFANEQFVAKAAEEVLEDNRERRAEAEAAAER
FT                   LKAALQRLANVA"
FT   gene            64639..65955
FT                   /locus_tag="Rvan_0056"
FT   CDS_pept        64639..65955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0056"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   azc:AZC_3014 C4-dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69346"
FT                   /db_xref="GOA:E3I4Z2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z2"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADP69346.1"
FT                   /translation="MQKKPFYKILYVQVLIAVAIGILLGYFYPNLGASMKPFGDAFIRL
FT                   VKMIIAPVIFCTVVVGIAQMGDVKRVGRVGGKALIYFEVVSTFALVLGLIVARTVQPGA
FT                   GFDVNVQSLDTKAVTSITSQSSHTSVVDFLIHIIPDTIFSALTSGEILQVLFISILTGF
FT                   ALSAMGKDGEPVLNGIRLVERLVFSIVGMIMRFAPVGAFGAMAFTIGAYGVQSLGNLVG
FT                   LILTFYFTAFLFVSIVLGIIAKIVGFNIFKLLRYLREELLIVLGTSSSESVLPALMRKM
FT                   EAAGASRPVVSMVVPTGYSFNLDGTNIYMTLATLFIAQATNTHITLQHELLILGVAMLT
FT                   SKGAAAVTGGGFITLAATLQAVPEIPVAGMALLLGVDRFMSECRALTNFIGNAVATLVI
FT                   ARWEGQLDVQKLHAALDNGGVPVEAGPVEVAVEPRRSQV"
FT   gene            66225..66926
FT                   /locus_tag="Rvan_0057"
FT   CDS_pept        66225..66926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0057"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: ara:Arad_9154 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69347"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z3"
FT                   /inference="similar to AA sequence:KEGG:Arad_9154"
FT                   /protein_id="ADP69347.1"
FT                   /translation="MHTVRYRSLYLAIIGAAVTVPLGANAADMYRAPAPTTYAPPPPIV
FT                   QPNTWAGFYVGINGGYGWGASDDSTRGDVNGGFGGGQIGYNFQSGNFVYGLETDLQAGR
FT                   ITGKSDDYASKETTDWFGTLRGRLGYAFGNTLLYGTGGFAYGGVNQKMNYADVLFSNDD
FT                   TRTGWTAGAGIEYKVSGNWSLKGEYQYVDFGKEDLSGAASTIEGPETSFHTAKIGLNYR
FT                   LGNSSSYEPLK"
FT   sig_peptide     66225..66305
FT                   /locus_tag="Rvan_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(67007..67591)
FT                   /locus_tag="Rvan_0058"
FT   CDS_pept        complement(67007..67591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_196839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69348"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z4"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_196839"
FT                   /protein_id="ADP69348.1"
FT                   /translation="MSEAQTKALLLKLRALFDTIAKEAATNPAFARQVEASLHSIIDRA
FT                   AAEANAETIARRFAPSRRASPPPPPPWASPAPSYPPASPPRAVPAPSAWNPPPSLARGT
FT                   PDSPSMLDGVTFDPLECHIEAAVMGGREQEARAFLGRLDRSQLEEVVKAQRLPGQRSLT
FT                   QAIRDAEQTSAVNAIVDSAAERVKRRFSATG"
FT   gene            complement(67588..68475)
FT                   /locus_tag="Rvan_0059"
FT   CDS_pept        complement(67588..68475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0059"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: hba:Hbal_1849 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69349"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z5"
FT                   /inference="similar to AA sequence:KEGG:Hbal_1849"
FT                   /protein_id="ADP69349.1"
FT                   /translation="MGILLTVANRKGGVGKSTITTMLAHGFAATGEQRVLVVDLDTQCN
FT                   SSIILTGGEKWDWARREQKTIADFVNERYDRPRLRPDEFILHDVGDIEAPVGQLSVLSG
FT                   SLDLEDVENELLHNRARAGQDLHAAEQGIISRFGTMLEDFADAFDVVIFDCPPGLSFSA
FT                   RAALRIAHKVIVPFRPDFVSSYAIDRISTVIEEGNDLHTVLSVPKEKRRYIGLVNFWRD
FT                   GNFQRLHYGNVAAAHPVMRTAIPQDDGIAEAFEYRGEPLSLDEKYGSAASVVRALCGET
FT                   VDSIITRYEREAAA"
FT   gene            complement(68571..69605)
FT                   /locus_tag="Rvan_0060"
FT   CDS_pept        complement(68571..69605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0060"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: mno:Mnod_0247 integrase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69350"
FT                   /db_xref="GOA:E3I4Z6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z6"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP69350.1"
FT                   /translation="MEERSALQPSPVEGEGIFAPDDHDAGRDDDFGPETYTAPDVRDAV
FT                   AGWLAYLRDAHRYADNTLEAYERDSRQFLAHLAGKDARPVTLARLNALTPHDFRSFLAD
FT                   RRDDGAQSRSLSRTLSALRSLFRTLERTGALQNRSILAVALPKLPPRLPKPVTEAKAKE
FT                   VVDEAALDGELSAHPWTGARNQAVLLLLYGSGLRISEALGLNRKDAPLGPRDVLRIRGK
FT                   GGRERLAPVLPVAQTAIADYIEQCPHKLEPQGPLFVGVKGGRLNPRIVQLLLARLRTNL
FT                   ALPATATPHALRHSFATHLLSRGADLRVIQELLGHASLSTTQGYTAVDRDRLFQAYSKA
FT                   HPRA"
FT   gene            complement(69613..70293)
FT                   /locus_tag="Rvan_0061"
FT   CDS_pept        complement(69613..70293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0061"
FT                   /product="transaldolase"
FT                   /note="KEGG: pla:Plav_1459 putative transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69351"
FT                   /db_xref="GOA:E3I4Z7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z7"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ADP69351.1"
FT                   /translation="MKFFVDTADVTEIRDLAEKGLLDGVTTNPSLIAKTGRNFLETIRE
FT                   ICALVPGPVSAEVSSTDAETMIAEGRKLARIAENVTVKVPLTWDGLKACRTLANEGTMV
FT                   NVTLCFSANQALLAAKAGASFVSPFVGRLDDIGEDGMGLIRDIRQIYDNYPDFGTEILA
FT                   ASLRSPHHVTEAALAGADVSTIPPSIMKMLVNHPLTEKGLATFVSDWAKTGQTILNDDD
FT                   LRTV"
FT   gene            70552..72228
FT                   /locus_tag="Rvan_0062"
FT   CDS_pept        70552..72228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0062"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; thiamine pyrophosphate central
FT                   domain-containing protein; KEGG: mno:Mnod_1264 thiamine
FT                   pyrophosphate protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69352"
FT                   /db_xref="GOA:E3I4Z8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z8"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ADP69352.1"
FT                   /translation="MSEISRSGGQILADQLRLHGARMIFGVPGESYLAVLDALYDHERD
FT                   MPYIVCRQEGGAAMMAEAYGKLTGEPGICMVTRGPGATNASAGLHVARQDSTPLILIVG
FT                   QVGRSMRDREAFQEIDFRRMFGEVSKWVAEIEEAARIPEYVARAFATATSGRPGPVVLA
FT                   VPEDVLRERATVADAVPYSRVEAAPARARMAEFRKRLAAAERPLMIVGGGGWDKDVALK
FT                   VKAFAEHSGLPVAASFRRQSYFDNTSPCYVGDLGISLNPALKRRIDESDLIIAFGPRLG
FT                   EMPSQGYTLFDIPKPKQPFIHIHAGAEELGRVYQADLAINAGPHAFADALEDMKPLDGS
FT                   AWGAWRESARGDYEAWIAPEKTPGALQLAEVVAYLRETLPGNAIIANGAGNFAAWVHRF
FT                   YTYRECGTGLAPISGSMGYGVPAGVAAKLVHPGRTVVTFAGDGDFLMTGQEFATAVQHG
FT                   APVIFIVVNNGMYGTIRMHQERHYPGRVSGTSLRNPDFAAYARAFGGHGALVERTEDFP
FT                   AAFEEARASGLPSILELRIDPEAINPKQSLSEIRAAALRES"
FT   gene            72290..72706
FT                   /locus_tag="Rvan_0063"
FT   CDS_pept        72290..72706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0063"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   dvm:DvMF_1930 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69353"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:E3I4Z9"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ADP69353.1"
FT                   /translation="MTELALARATDLIRLAIDKAAADYGKPICVAVCDASGALLAFARA
FT                   EGSPLRSIAIAQGKAYSAARMQANTDSVKAKLAVGGVEIAWFCDEKLTALPGGAVLKTA
FT                   GGTIAGAVGISGLASDQDQAIANALAATFANGAA"
FT   gene            complement(72856..74085)
FT                   /locus_tag="Rvan_0064"
FT   CDS_pept        complement(72856..74085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0064"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: protein of unknown function DUF882; KEGG:
FT                   protein of unknown function DUF882"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69354"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E3I500"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /protein_id="ADP69354.1"
FT                   /translation="MIVVAFGGVRGLMKAAIVSLCVAFSFLAAGVSSAEERTISMYNIH
FT                   TKDKISITFKKDGRYIPEALEKLNYFMRDWRRNMTIRIDPGLIDLMWELHNELGSKEPI
FT                   HLICGYRSGGTNELLRQTRGGQARNSRHITGQAADLMFPDVPLKQLRYSALVRERGGVG
FT                   YYPESGLPFVHVDTGNVRHWPRITRPELAVIFPNGRSKHVPADGRPLTPQDSRFYLAQW
FT                   KESGKELPWVVTHKRASNTMLASLVPNEAPLLRRASLSVPDAAPAKAEKPAPKDAERLP
FT                   ASIVRLPQPLAKPDSLARDPEELPQIAEEGEEQEDDIAFEPLPSDTLLSEKSLAYDIMK
FT                   DVPEQAAVFQNVKLLMLSPSAITGEDFDHGLQIEAMYEAHMFKGPAIQVALRRSVARLA
FT                   AADAGVTQAR"
FT   sig_peptide     complement(73981..74085)
FT                   /locus_tag="Rvan_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.608 at
FT                   residue 35"
FT   gene            74219..74347
FT                   /locus_tag="Rvan_0065"
FT   CDS_pept        74219..74347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69355"
FT                   /db_xref="UniProtKB/TrEMBL:E3I501"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69355.1"
FT                   /translation="MREKEGAAGCRYDISASLKLNDWSGGKFSTPVEKRLRKPIAA"
FT   gene            74493..76352
FT                   /locus_tag="Rvan_0066"
FT   CDS_pept        74493..76352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0066"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="KEGG: mlo:mlr3002 oligoendopeptidase F; TIGRFAM:
FT                   oligoendopeptidase, pepF/M3 family; PFAM: peptidase M3A and
FT                   M3B thimet/oligopeptidase F; Oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69356"
FT                   /db_xref="GOA:E3I502"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR034013"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:E3I502"
FT                   /inference="protein motif:TFAM:TIGR02290"
FT                   /protein_id="ADP69356.1"
FT                   /translation="MFSTLRAMVTQPVGALEADRGFLEVAPQKAEEIPGWNLGDLYPDE
FT                   AKLASDIETAKARAGEFKAAYAGKLADLAERDPAGLAGALAAYEGISDLMGRVGSYSYL
FT                   NYVTDTGDPARAKLFGDVRDKLTVIGTELLFFELELNRIDDAVMDKAIANDKLGHYRPW
FT                   LTDLRKERPYQLADDIERLFHEKAMTGPAAWSRLFNETLTSLRFDVDGEILTLEPALNL
FT                   LSDANPVRRAAAAQSIGKVLKENVRLFTLVMNTLAKDKEISDRWRGFPDVASSRHLANR
FT                   VEPEVVDALVEAVRASYPRLSHRYYALKAKWLGVDTLNYWDRNAPISRDPEPVIAWKDA
FT                   HSTVIAAYHRFSPKMAEVADGFFKKNWIDAPVRDGKSPGAFSHPTVPSAHPYIMMNYLG
FT                   KPRDVMTLAHELGHGVHQVLANAQGALMAYTPLTLAETASVFGEMLTFKALLNQTENPR
FT                   EKRALLAQKVEDKINTVVRQIAFYQFERLVHEARRQGELTSDQLGAFWLQVQTESLGPA
FT                   IIMNEGYDTYWTYVSHFVHSPFYVYAYAFGDCLVNSLYAAYERAPEGFEGRYLDMLRAG
FT                   GTKHHTELLAPFGLDATDPGFWSMGLSVIEDMISELETLESDA"
FT   gene            complement(76418..77062)
FT                   /locus_tag="Rvan_0067"
FT   CDS_pept        complement(76418..77062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69357"
FT                   /db_xref="UniProtKB/TrEMBL:E3I503"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000862"
FT                   /protein_id="ADP69357.1"
FT                   /translation="MQNNDISILFLDILKHFNRKERYWVLNELLDFQSTHISENFRSRL
FT                   RTELGIEVPANAWWAMDYHFDWLHAALACAENKCAVEDLSFQLNDPQVIKGNQEDIDLI
FT                   IAFDETVLLIEAKGASGWNPAQMLSKSNRIKNLPPFPDTLDVRLVLLSPHKPSNAFWEG
FT                   DWVDLIREKIRKAPSWVPLTFGDSSPFFAVTRCDEKGTSDAKGGHWRTIKS"
FT   gene            77262..78692
FT                   /locus_tag="Rvan_0068"
FT   CDS_pept        77262..78692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0068"
FT                   /product="ABC-1 domain-containing protein"
FT                   /note="PFAM: ABC-1 domain-containing protein; KEGG: ABC-1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69358"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:E3I504"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ADP69358.1"
FT                   /translation="MQDKPDTPKDATALPKLDAALPGDGDREGNRLSQRVQRYARVGTN
FT                   VGGVAARLGAAYLMGGADRQKNAQSLAAALGGLKGPLMKVAQLLSTVPDAIPPEYAAEL
FT                   AQLQNQAPAMGWPFVRRRMSAELGPDWQAKFADFGHEAAAAASLGQVHKARALDGRSLA
FT                   VKLQYPEMQSAVEADLNQLQIVMGLYKRMDAALDTSEMVGEIGARLREELDYTLEARHM
FT                   ALYAHIFQGDETIRVPELLPDLSTKRLLTMTWLDGRKLLDYKTRPLEERNTIARALFRA
FT                   WWYPFSHYAVIHGDPHLGNYTIFEDGDGRAAGINLLDYGCIRTFKPKFVGGVIDLYNGL
FT                   RTNDRALIVHAYETWGFKGLSNELIDILNIWAGFIYGPLLDDRVRSVAEGVAPNEYGRR
FT                   EVFRVHQGLREKGPVKIPREFVFMDRAAIGLGAVFLHLQTEMNFYRAFNEVIEDFRRDE
FT                   VGARQEAAFKATGVPLPV"
FT   gene            complement(79395..81524)
FT                   /locus_tag="Rvan_0069"
FT   CDS_pept        complement(79395..81524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0069"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="SMART: KH domain protein; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase; KEGG:
FT                   msl:Msil_0268 polyribonucleotide nucleotidyltransferase;
FT                   PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
FT                   domain 2; Polynucleotide phosphorylase, phosphorolytic
FT                   RNA-binding; K Homology, type 1, subgroup; RNA binding S1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69359"
FT                   /db_xref="GOA:E3I505"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E3I505"
FT                   /inference="protein motif:TFAM:TIGR03591"
FT                   /protein_id="ADP69359.1"
FT                   /translation="MFDIFREEVEWGGRKLTLETGRIARQADGAVLAHYGETSVLATVV
FT                   GERDADPSKDFFPLTVNYQEKAYAAGKIPGGYFKREGRPTERETLVSRLIDRPIRPLFA
FT                   HGFKNETQVIVTVLSHDMENDPDIVAMVAASAALTISGLPFLGPIAASRVGYSKGEYIL
FT                   NPTSDQIKASDLDLVVAGTVDAVLMVESEAKELSEDIMLGAVVFGQQGYKPVIDAIIGL
FT                   AEQAAKEPWTIPDAKNEFESKVKKLVEKDLKKAFQIAGKQERQTKVAEAKAKAIAEFVS
FT                   AESTAGEKNKVAEAFKEIEKHVVRTSILKTGKRIDGRDLKTVRPILSQVGVIPRTHGSS
FT                   LFTRGETQALVVATLGTGEDEQWIDSLEGTYKESFLLHYNFPPYSVGETGRMGSPGRRE
FT                   IGHGKLAWRAVHPMMPKSDTFPYTVRVVSEITESNGSSSMASVCGASLSLMDAGVPIKA
FT                   PVAGIAMGLIKEAEGVAVLSDIIGDEDHLGDMDFKVAGSANGVTALQMDIKITGITTEI
FT                   MKIALEQAHEGRLHILGEMSKALNAARGELGEFAPRIETITIPTDKIREVIGSGGSVIR
FT                   SIVEESGAKIDISDDGTVKIAAANLSSIQDAINRIKSIASEPEVGVIYKGKVVKIVEFG
FT                   AFVNFFGSRDGLVHISQMAERRLKHASEVVKDGQEVYVKCLGFDERGKVRLTMKGIDQT
FT                   DGKEVAAAPAEQPAG"
FT   gene            complement(81774..82043)
FT                   /locus_tag="Rvan_0070"
FT   CDS_pept        complement(81774..82043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0070"
FT                   /product="ribosomal protein S15"
FT                   /note="KEGG: oan:Oant_0744 30S ribosomal protein S15;
FT                   TIGRFAM: ribosomal protein S15; PFAM: ribosomal protein
FT                   S15"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69360"
FT                   /db_xref="GOA:E3I506"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:E3I506"
FT                   /inference="protein motif:TFAM:TIGR00952"
FT                   /protein_id="ADP69360.1"
FT                   /translation="MSITAERKAALIIEYATKPGDTGSPEVQIAVLSERISNLTEHFKT
FT                   HKKDNHSRRGLLKLVSQRRRLLDYVKGKDDARYREIIGRLGIRR"
FT   gene            complement(82080..83006)
FT                   /locus_tag="Rvan_0071"
FT   CDS_pept        complement(82080..83006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0071"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="KEGG: oca:OCAR_4505 tRNA pseudouridine synthase B;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69361"
FT                   /db_xref="GOA:E3I507"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E3I507"
FT                   /inference="protein motif:TFAM:TIGR00431"
FT                   /protein_id="ADP69361.1"
FT                   /translation="MARRNKGNEINGWLILDKPQGLTSNQALSRLKRLFHPRKVGHAGT
FT                   LDPLATGVLPIAFGEATKTVAHVVDCEKSYDFTIRWGIETDTDDAEGKPVRTSDARPTA
FT                   EQVQAALPQFIGDIMQTPPCYSAIKVDGERAYDLARDGEVVELQPRQISVYELEIEETI
FT                   SPDLTRLFCDCGKGTYVRSIARDLGRTLGCFGHIAALRRTSVGPFHEENAISLETLENL
FT                   SNSADGFGALMGTIAPVETALDGIPALAVNGDDAARLKRGQSILIRGATAPILKGPIFA
FT                   TSRGVLIAIGEVERGEMHPIRVFNIPA"
FT   gene            complement(83030..83416)
FT                   /locus_tag="Rvan_0072"
FT   CDS_pept        complement(83030..83416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0072"
FT                   /product="ribosome-binding factor A"
FT                   /note="KEGG: pzu:PHZ_c3435 ribosome-binding factor A;
FT                   TIGRFAM: ribosome-binding factor A; PFAM: ribosome-binding
FT                   factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69362"
FT                   /db_xref="GOA:E3I508"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E3I508"
FT                   /inference="protein motif:TFAM:TIGR00082"
FT                   /protein_id="ADP69362.1"
FT                   /translation="MKPTHDSKGPSQRQLRAGELLRHALAEIFRLEDIEDDELKGQLIT
FT                   VAEVRVSPDLKHATVFASALGGKPGDVIAKALNRHARFLRGELARRIELKYVPELVFRA
FT                   DHALDAAERIDELLRSPDVARDLK"
FT   gene            complement(83498..84628)
FT                   /locus_tag="Rvan_0073"
FT   CDS_pept        complement(83498..84628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0073"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   nwi:Nwi_1667 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69363"
FT                   /db_xref="GOA:E3I509"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:E3I509"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /protein_id="ADP69363.1"
FT                   /translation="MKAIGLMSGTSLDGVDVALIETDGETIEAFGPGNDFSYDTVEGQL
FT                   LREALASAVGIANRADRSGVLTVAETMVTQKHIACVKAFASIRGLNLSEIDVIGFHGQT
FT                   VVHKPEKGLTVQIGDGRGIAESLGVPVVYDFRAADMEEGGQGAPFAPIYHRALALRAGL
FT                   ALPAVFVNIGGISNISYIPEGGGENIVAFDAGPGNCLIDDWTLRHTGKPYDEDAKLALS
FT                   GKVNGDVLQKLLHDPFLTQPVPKSLDRLSFKLKEVEGLSPADGAATLTAFTVACIAASR
FT                   HFLPERAKTWIICGGGAHNPYIMAGLQRVLGAGDPAPLIQTADEAGFSTNFMEAQAFAF
FT                   LAVRRLKGLPASFPKTTGASGPVVGGIIAEPETAKS"
FT   gene            84758..86020
FT                   /locus_tag="Rvan_0074"
FT   CDS_pept        84758..86020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0074"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; KEGG:
FT                   xau:Xaut_4474 tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69364"
FT                   /db_xref="GOA:E3I510"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E3I510"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADP69364.1"
FT                   /translation="MAAPATHSDFVQILKERGYLHQVSDEEGLRKRAAEGRITAYIGFD
FT                   CTAPSLHVGHLISIMMLRILQKSGHRPIVLLGGGTTKVGDPSGKDEQRKILSQADIDFN
FT                   KASLKTVYERFLTFGDGPADAIMADNDEWLSSLRYIEFLRDYGRHFTINRMLTFDSVKL
FT                   RLDREQPLTFLEFNYMLLQAYDFLELSRRYGCVLQMGGSDQWGNIVNGMELGRRVDGRE
FT                   LFALTTPLLTTSSGAKMGKSAGGAVWLNADLLSPYEYWQYWRNTEDGDVGRFLKLFTEM
FT                   PLDEIARLEALQGAEINEAKKILATEVTALLHGREAAETAADTARRAFEEGAAAEGLPT
FT                   VEIPRGELAEGVGILNAAVKAGLVASTSDARRQIKGGALKVNDVAVTDDRASVSLANLD
FT                   AEGVIKLSLGKKRHVLLKPTQ"
FT   gene            complement(86043..89783)
FT                   /locus_tag="Rvan_0075"
FT   CDS_pept        complement(86043..89783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_3269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69365"
FT                   /db_xref="GOA:E3I511"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:E3I511"
FT                   /inference="similar to AA sequence:KEGG:Plav_3269"
FT                   /protein_id="ADP69365.1"
FT                   /translation="MDDRFSSKNPHRELVPERHGRNLAKPSKAQVQLSRLSKSGKVLAD
FT                   AIPGSVKTASRHSFRVGWRLSAVLALMFSLAVGALYARLLTGPISFAFLVPAVQDRLNA
FT                   QFDGYSLRVGGAILRLSSSWGLEFRLADVSVVDENNQEIAKAPLASVDLSETSLLKLSL
FT                   APSQIKLLGPKILIFNLPGKGLTLTPESTTPASHQGWGASQAGLADAWQTSEVSPPSPE
FT                   VAGVHQLARQGLRLTEPRAFTFDPAPILRRLFATIGKRGASSQALKSIGLQDAVVYFAN
FT                   ENAVSTWRVADFQLKLDERGGNSIVGGKLTLERNGSVWHASFTAENRPNEKRYRVTASV
FT                   QDVVPKTIWDSWPSIDALKLVQLPVSGDAHFDIGYDGRLAGGEAEIRLGAGRFFAPFDQ
FT                   KHPAVIDGGTLRVSYDKASEAIIVRPIEMRWDESLLTISGRIAREIDPTNGKPLWRADF
FT                   DGRGTRLSAPQYAVAPVALDVFRIEGAYDEETDSVALKRFELGSHASRLAFSGQASRIR
FT                   SGGGISLVGDISPMPFSFLKAIWPVFMANGAREWAGTNLPVAQVTGGTVAVNLTADQIA
FT                   ALDVGGDIPENAVSMRMGLSGAKIYHIKGLPPIETQDTQLRIKGRRFVYDIPGEARIEV
FT                   PSGKVVTFTDGQLLIDDLRPEFPDADIRFKGGGEVAAVLELLDQPPLGYVKAVGFKPSL
FT                   VNGQIQASFEVKFPLLANLKFEQMSITGKSRVSDIRSGAIPGGVSVNGGAVNFDISEKA
FT                   IGANGEIRVNGVPVTLVWQRIFDAPPDKQPTLRLASILNEKARDELGLNVNHMVKGDLP
FT                   VALAIALQRDGPPRIMMEANLTNADLFLTAIGWRKPPGQKATVACDVVRRNDNSMLFDN
FT                   FAMTGDGIAINGRAVMNDKHRLASFSFPEFSTNALTHLSIAGELTPQNILKVQAKGASF
FT                   DGRQFFKTLLSAGKIADKEPAPLKDEPGLDLNVEIETVFGYYDTSVKSVIVDAKRRGGK
FT                   FTSIEAAGKINGESPVAVHVDQRTRDARILSSDATDAGSAFRLVGFYGAMRGGTMSLRM
FT                   NLDGSGGTDKSGTLEVRRFAVVGDQVVGRVVSQAEKEGARYKPDTKQQHVYAGDVFQFD
FT                   RMLVPFSITQSQFQLHDAAINGPVIGATIRGRIDFARETLALSGTYVPLYGFNAVLGVV
FT                   PVLGDLLKGRENEGVFGITFAVQGRTSNPDVIVNPVSMLAPGFLRQIFEFENAPAPAQA
FT                   PEQPQQVPQAQTQQRPAAKVR"
FT   gene            89989..90462
FT                   /locus_tag="Rvan_0076"
FT   CDS_pept        89989..90462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0076"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: mno:Mnod_6052 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69366"
FT                   /db_xref="GOA:E3I512"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3I512"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADP69366.1"
FT                   /translation="MLQNGDLAPDFALPDAEGKTVTLNGLKAPYKVVYFYPKDNTSGCT
FT                   TEARSFSDLKDAFDAAGAEVIGISPDSVKSHANFRDKHGLRVTLVSDQEKAAIEAFGVW
FT                   VEKKMYGRAYMGVERATFLIGPDGKILKSWGKVKVPGHAAAVLDAVREAAGAS"
FT   gene            90606..91169
FT                   /locus_tag="Rvan_0077"
FT   CDS_pept        90606..91169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0077"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   pla:Plav_3273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69367"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:E3I513"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ADP69367.1"
FT                   /translation="MFSKKPETDMSNFDSQKPITKTTSKAIGGQPAQGLAPLGSPAPQV
FT                   SAGQPVYAPKPPIFRGPDRMAPSIIGEDLTVTGNVLSRGEVQVDGQIQGDVHCSSLIVG
FT                   EKAQITGGIVAEDVIVRGRVMGSVRGNRVTLQASSHVEGDVFHKSLAIEQGAFFEGKSR
FT                   RSEDPIATAPRLEGMNSPSSQAAE"
FT   gene            complement(91509..91880)
FT                   /locus_tag="Rvan_0078"
FT   CDS_pept        complement(91509..91880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0078"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69368"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:E3I514"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ADP69368.1"
FT                   /translation="MQVYTVETLSGRRIKEGELLHASIVLAANLLRDAREAVTNAVGGK
FT                   MLRYERLLDRANSDALELLKEKAAAAGYDGVLAVRISNPFMVQGSAAVTVYGTGFTFLS
FT                   EDAVAVPVPHDEASTTPRD"
FT   gene            complement(91938..93743)
FT                   /locus_tag="Rvan_0079"
FT   CDS_pept        complement(91938..93743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69369"
FT                   /db_xref="GOA:E3I515"
FT                   /db_xref="UniProtKB/TrEMBL:E3I515"
FT                   /inference="similar to AA sequence:KEGG:Trad_2245"
FT                   /protein_id="ADP69369.1"
FT                   /translation="MICALALGLPIPASRGAFAQTPRVVTIDECRNLTDTEVRDRIREL
FT                   AATSLKTELTAIDYMALVNQYWAKADVNARIDREIDAAVDAVRADSSWADRAYSTISQS
FT                   RATLYATAVAERAYTSQTFRDAINELATGVAKEAGARIEKATSRISNPIIACVQTALQS
FT                   RYGGAVAQVFAQESQRNLDAAAADQAPAKIDTGDLVATNAGSISGLVLIVTRRVIGKVV
FT                   QSVGTRIAGMVASRIVSSVAGLAGLALIAKDIYDAGDGVFPIIAERMKSDETKLLIKEE
FT                   IGKSIQTDIGQQVEVIADETAERIYTVWLDFRQKYNRLLALSEKSPAFAEFLKNRRLDQ
FT                   IGRLGQIVDIVSGTEGGEAAVLARVANGSLNRALLDLSDAALVIAEEQKSIDKALRWTQ
FT                   VAGRELPRVVELGVYRWLPVEGLTTETLQKILAINDRIAVGRIANLSPEARDFILSLPG
FT                   DQVREFARRLNDRQLAAFADYERNLEPGAAKRLLRAVTDDPSVMRDLTAEGIREGILGS
FT                   RDQLAALEMMLQEAPSLFGYGRIFKDADLVGSGNVAFRVFWERYWLAVLVGFFVILVVM
FT                   SWLRRLLFGRPQQIVIREQGKSRTR"
FT   sig_peptide     complement(93684..93743)
FT                   /locus_tag="Rvan_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.663 at
FT                   residue 20"
FT   gene            complement(93979..94698)
FT                   /locus_tag="Rvan_0080"
FT   CDS_pept        complement(93979..94698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0080"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: pla:Plav_0703 ribonuclease H; PFAM:
FT                   ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69370"
FT                   /db_xref="GOA:E3I516"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E3I516"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ADP69370.1"
FT                   /translation="MGKSATGKSVGIAVWTLDCTSVAVHEQPMPPRTSQKLTRRPDLAL
FT                   QRKYGGLIAGVDEAGRGPWAGPVVAAAVIFHGKPPAGVNDSKKLAPAERENLFSKIFAA
FT                   AHVGIGIAPVELIDEINIYHATHRAMCDAISALAFAPNAALIDGNRCPKLDIPSEALVS
FT                   GDALSISIAAASIIAKVTRDRMMTELASTFPPYRWERNKGYGTADHASALREYGVTLHH
FT                   RRSFRPVWERLMMEAAA"
FT   gene            complement(94716..95813)
FT                   /locus_tag="Rvan_0081"
FT   CDS_pept        complement(94716..95813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0081"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: radical SAM domain protein; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69371"
FT                   /db_xref="GOA:E3I517"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:E3I517"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADP69371.1"
FT                   /translation="MVRKEARCATGEEHVTAERRRGRGAVSNATGRFEPERREAVDDGW
FT                   DCLDDLPPFKTEVREERVKTIIARNSSPDIGFDRSINPYRGCEHGCIYCYARPSHAYWG
FT                   WSAGLDFETKLVAKVNAAEALEAELARSGYEPATIMIGANTDAYQPVERERKITRAVLE
FT                   VLERTSHPVALVTKSALILRDIDILARMAERELVRVAVSVTTLDHRLARRMEPRASTPL
FT                   RRIEAIRKLAAASIPVSVMAAPLIPALTDNELESILKAAAEAGASDAGYVLLRLPLEVS
FT                   PLFQEWLRTEFPHRADRVMSLVRQTREGKDYVSRFGERHCGSGHYAEQIAARFRIALRR
FT                   LNLGKRDLSLRRDLFRRPGAQLSLF"
FT   gene            95896..96567
FT                   /locus_tag="Rvan_0082"
FT   CDS_pept        95896..96567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0082"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pla:Plav_0708 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69372"
FT                   /db_xref="GOA:E3I518"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I518"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69372.1"
FT                   /translation="MISVVIPTLNAGRTLPATFLSIFDAAVEGIVSEVIVSDGGSTDAT
FT                   RQIAEEAGARFMEVERGRGQQLRAGAEAARKPWLLFLHADTALDAGWTNEALAFMKRGS
FT                   GAAAFRFRLADEGFNPRLLERLVALRCALFRLPYGDQGLLISRELYDEVGGFAPMPLME
FT                   DVEIIRKLGRGRLAMLKTNAVTSAERFREQGYFRRSARNLWCLSLYLRGVPPEKLVERY
FT                   G"
FT   gene            complement(96819..97229)
FT                   /locus_tag="Rvan_0083"
FT   CDS_pept        complement(96819..97229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ter:Tery_0082 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69373"
FT                   /db_xref="GOA:E3I519"
FT                   /db_xref="UniProtKB/TrEMBL:E3I519"
FT                   /inference="similar to AA sequence:KEGG:Tery_0082"
FT                   /protein_id="ADP69373.1"
FT                   /translation="MNLRPLSLLLLPIAVWDVYTTYLGFSYFFDLPTNPAINPGQFIFG
FT                   IVVTLIVFIFVLATTAIYSMPAHNSPILILKGAWATAVAIDLYTAWEGTRRIVFYGEED
FT                   AVKGVGVAIVAALIVTSTIFLSQLLLGKGSKS"
FT   gene            complement(97785..98495)
FT                   /locus_tag="Rvan_0084"
FT   CDS_pept        complement(97785..98495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0084"
FT                   /product="Protein of unknown function DUF2064"
FT                   /note="PFAM: Protein of unknown function DUF2064; KEGG:
FT                   pla:Plav_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69374"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I520"
FT                   /inference="protein motif:PFAM:PF09837"
FT                   /protein_id="ADP69374.1"
FT                   /translation="MIAAAPVVVIMAKAPVCGAVKTRLARDVGLVSAVALTRALTAKLL
FT                   RELASDPRFRCVLAVSPATAKMARFAAWGARGARVPRTAQARGDLGARMQAIFDRCRTG
FT                   PLIIIGTDIPGITREIVAAAFRQLRRADAVFGPAEDGGYWLVGLRRRPKIPTPFANVRW
FT                   SSPHALADTLANFQRIRVSSNRDKTRVPYPDALSSGQAITTSLENARGGRRVAVSKTLF
FT                   DIDTGADYRRYRRL"
FT   gene            complement(98609..98740)
FT                   /locus_tag="Rvan_0085"
FT   CDS_pept        complement(98609..98740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69375"
FT                   /db_xref="GOA:E3I521"
FT                   /db_xref="UniProtKB/TrEMBL:E3I521"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69375.1"
FT                   /translation="MPQALKWSFIAAVAVLVAGAGWLMITRGPALLLDLGGAIVGCF"
FT   sig_peptide     complement(98642..98740)
FT                   /locus_tag="Rvan_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.386 at
FT                   residue 33"
FT   gene            complement(98750..99958)
FT                   /locus_tag="Rvan_0086"
FT   CDS_pept        complement(98750..99958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0086"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ank:AnaeK_3004 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69376"
FT                   /db_xref="GOA:E3I522"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3I522"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP69376.1"
FT                   /translation="MRRVPTVSLLIACAAIMLAINMGIRQTFGLYMKPISQDLDLDRQV
FT                   FSFAMAIMNLVWGVAGPFAGAVADKFGSLRVVLGGTAFYAGGLALMATASSGNQLVLAG
FT                   SLVGIGIAGTGFSAVFGAVARAAAPERRASALGLVTMGSAIGQFMALPYAHVILEATDW
FT                   TSTLWVMAITAALIAPLGFALTSGDSNAHPGAHSDQRVGAALSEALRYPSFLLLTAGFF
FT                   VCGFHLAGIGVHLPAFLADKGFGPGLGALALTIIGAANILGTWAFGRIGDIAPKHLTLA
FT                   ALYFARALIFLALIYLPLTETAVLIYAFLIGLLWLGTVPLTSGLIVTFFGPRWLSMLYG
FT                   VVFFSHQVGSFMGAWLGGWFYDTTNSYDLLWWASVAVGMIAALLHLPIREGPAPRLAAA
FT                   PAE"
FT   gene            100139..100633
FT                   /locus_tag="Rvan_0087"
FT   CDS_pept        100139..100633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0087"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bbt:BBta_2258 putative
FT                   NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69377"
FT                   /db_xref="GOA:E3I523"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E3I523"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP69377.1"
FT                   /translation="MVRPSSTIGRPPMLRKLPMRVIATYWRYTRGATLGAQGVVIDEAG
FT                   RVLLVRHGYRPGWHFPGGGIEWRETAETALTRELFEEAGVILKGPARLHGFFANFAAMP
FT                   NDHVALFVASEWERPRVPKPNHEIAESRFFARDELPEGTVAPVKRRLAEILDGAPVDAT
FT                   W"
FT   gene            100904..101386
FT                   /locus_tag="Rvan_0088"
FT   CDS_pept        100904..101386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0088"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   rpt:Rpal_3094 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69378"
FT                   /db_xref="GOA:E3I524"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I524"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADP69378.1"
FT                   /translation="MKRAPQINIGIPEEQREKIANGLSHLLADSYSLYLMTHNFHWNVT
FT                   GPMFNTLHVMFMQQYTEQWNALDLIAERIRALGFPAPGTYAEFGKLTSIKEVTGVPKAL
FT                   EMVRHLVDAQEATARTARDLFPLLEEANDQPTADLLTQRLDVHEKTAWMLRSLLEE"
FT   gene            101522..102388
FT                   /locus_tag="Rvan_0089"
FT   CDS_pept        101522..102388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0089"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   sun:SUN_0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69379"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I525"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADP69379.1"
FT                   /translation="MLFLYSISRVLIAGALAGALAVLTLTLWPDLIGRGEQGLARIRLA
FT                   AHDAQRVLYAKLGWPLPGTPDLGRLNERLAEKGLERGAPVFIRIFKRERELELWMRGGD
FT                   SFVLFASYPVCRHSGGLGPKLREGDRQAPEGFYTVGRSQLNPNSAYRRSFNLGYPNLYD
FT                   AANGRTGSFLMVHGACLSVGCYAMTDPVIDEIWELVTAALDRGQKRFSAHVFPFRMSEA
FT                   HLAIHDRAPWGEFWRDLKRGYDLFEASRTPPRIGVCAKRYVARSGAAGSYGESELAELC
FT                   DQEALRQ"
FT   sig_peptide     101522..101596
FT                   /locus_tag="Rvan_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.667) with cleavage site probability 0.425 at
FT                   residue 25"
FT   gene            complement(102417..105584)
FT                   /locus_tag="Rvan_0090"
FT   CDS_pept        complement(102417..105584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0090"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rpa:RPA3483 RND efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69380"
FT                   /db_xref="GOA:E3I526"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3I526"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADP69380.1"
FT                   /translation="MSISTPFILRPVATTLMMAAIVLSGVAAFFYLPVAPLPQVDFPTI
FT                   QVSAQLPGASAQTMASSVATPLEQQFGQIAGVTQLTSTSTLGNTQINIQFELDRSIDAA
FT                   AQDVQAAITAAGRKLPTSLSSPPSYRKFNPADPPIIILSVTADTLPITEVSDQAENILA
FT                   QQISQIRGVANVNIGGQQKPSVRVQVDPERLASRGLTLEDVRAMLGTITADAAKGTVQG
FT                   VEQSFTIAANDQIVKPEDYDKVILAYRNGAPIRVADVGRAVAGPENTLSGAWANGKRSV
FT                   LLVIFKQPGANVIETVDAIKAALPKFASVIPAGVKIDIMNDRTETIRASVHEVEFTLLL
FT                   TIGLVVLVVLLFLRNLRATLIASAIVPISLIGTFAVMYVAGFSLDNLSLMALVIAVGFV
FT                   VDDAIVVVENIVRHIENGEPPFRAALKGASEIGFTVMSISLSLVAVFIPLLLMGGIIGR
FT                   LMHEFAMTVTVTIAVSVVVALTLTPMLCSRFLTPHDEERPGLLSRMIGRFFEALQAAYA
FT                   HTLDVALHFRRFTLMVFFATLALTIYLFVIIPKGFFPVQDTGSIVAITDAPQDISFDEM
FT                   VRRQKVLADIIAEDPDIATVASFLGSSPGATLNSGRIFIRLKPWGERKATALEIVNRLR
FT                   PKLAEVQGAAAFLSPAQDITVGARTSRALYQYTLQDASLEELNEWTPQIVAKLRTLPAL
FT                   ADVSTDLLINAPQLSVKIDRDRASLYGITPQHIDATLNSALGQRQVVQYYTQLSTYNVV
FT                   LEILPELQTQPDVLNRIYVRSPNTGQMLPLSTLVSFDTDKTGYLSITHQSQFPSATVFF
FT                   NLKPGVALGEGVTAINAAMAEIGAPKTLVGSFQGNAQAFQDSLRTTPILIVAALVTVYI
FT                   ILGMLYESFIHPLTILSTLPSAGVGALLMLMAFGFDLSVIGIIGIILLIGIVKKNGIMM
FT                   VDFAITAERQRGLSAEESIREAALLRFRPILMTTAAALLGGVPLMLGTGSGSELRQPLG
FT                   YAMVGGLALSQILTLYTTPVIYLYLDKLQTRVTRGAKAHETAPDEPTALEPELADALTE
FT                   PPRKAAE"
FT   gene            complement(105581..106729)
FT                   /locus_tag="Rvan_0091"
FT   CDS_pept        complement(105581..106729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0091"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: xau:Xaut_0736 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69381"
FT                   /db_xref="GOA:E3I527"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E3I527"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADP69381.1"
FT                   /translation="MFRKVLAGLVLLSAATAVALMAEPSPKSAPQAAPAPAAIAVSTVP
FT                   ARVRDVPVLLSGIGAVEAFQTVQIRSRVDGTLDKVNFAEGQLVKKGDVLAIIDPRLYRA
FT                   ALDSAKAKLAQDKAQLASDEKDLGRSVQLSTQRFASQQTVDQLTAKVGIGRALVQADEA
FT                   AIRTAETNLSYTTITATFDGRIGISAVHVGNIVRASDQTFIAELRQVDPISVVFTLPEA
FT                   KLPLIREAQKAGPVSVIALDNDAKRPVAKGKLTVIDNKVDQTTGTIRLKATFDNRNEVL
FT                   WPGQYASVLVEAGIIKNAVTVPTAAVQRGPNGLYVWVATPQGRAQMAAVEIGPSHEDET
FT                   VIAKGVTEGDVVIVSNHYRLRPDIQIEPKAKPMAANDAAGRT"
FT   sig_peptide     complement(106661..106729)
FT                   /locus_tag="Rvan_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            106900..107628
FT                   /locus_tag="Rvan_0092"
FT   CDS_pept        106900..107628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: 4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69382"
FT                   /db_xref="GOA:E3I528"
FT                   /db_xref="UniProtKB/TrEMBL:E3I528"
FT                   /inference="similar to AA sequence:KEGG:Plim_3757"
FT                   /protein_id="ADP69382.1"
FT                   /translation="MAHRSIQKKRGGVEFDSIKIPFQTVPEYAGEIPGLKGKGRDVGQV
FT                   LPSFNHCRSKGETIDMLRAIAADAVFCAAFLVESLALLSILEGAFGLAFGELSIPILKT
FT                   WRAVTEPFVGFGAAVFSSRPQVWVVDAAAISGVLFFLFFIRQARNAIAPFEDGTYPPGA
FT                   VVTRYDALIDDAIPTVLCALGAVLFAPTLLPLLTLPVALWLLGRKLAGRPAWFAVSNTY
FT                   YVNVAALVCLAAAGFWFGRA"
FT   gene            complement(107837..109669)
FT                   /locus_tag="Rvan_0093"
FT   CDS_pept        complement(107837..109669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0093"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase, flavoprotein
FT                   subunit; succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; KEGG: mno:Mnod_7244 succinate
FT                   dehydrogenase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69383"
FT                   /db_xref="GOA:E3I529"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E3I529"
FT                   /inference="protein motif:TFAM:TIGR01816"
FT                   /protein_id="ADP69383.1"
FT                   /translation="MADATLNGVAAPTVNGRAYKIHDHTFDVVVVGAGGAGLRATLGCA
FT                   QAGLKTACVTKVFPTRSHTVAAQGGIAAALGNMGPDDWRWHMYDTVKGSDWLGDQDAIE
FT                   YLCRNAPAAVYELEHYGMPFSRTEAGKIYQRPFGGMTTEFGEGPPAQRTCAAADRTGHA
FT                   MLHTLYGQSLRYSADFFVEHFALDLIMEDGICRGVMSLSLEDGSIHRIRAKKTIIATGG
FT                   YGRTYFSATSAHTCTGDGNAMVLRAGLPLQDMEFVQFHPTGIYGAGVLITEGARGEGGY
FT                   LTNSQGERFMERYAPHAKDLASRDVVSRSMTIEIREGRGVGPNKDHIYLHLDHLDPKIL
FT                   AERLPGITESAQIFAGVDLRRQPIPVIPTVHYNMGGIPTNHLGEALNPRAGDPDATIPG
FT                   LMAIGEASCASVHGANRLGSNSLIDLVVFGRAAALRCAETIEKGEHSNLPANAGEEAIA
FT                   RLDRFRHANGSTPTSVLRGKMQRIMQNNCAVFRQADVLEEGVRLIKEVWDGIEDVRVTD
FT                   RSLVWNTDLTETLEFNNMIGLALATVSGAHARQESRGAHAREDFPNRDDENWMKHTLAY
FT                   GDDEKRSVALEYRPVHTHTLTNDVQYIQPKARVY"
FT   gene            complement(109674..110066)
FT                   /locus_tag="Rvan_0094"
FT   CDS_pept        complement(109674..110066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0094"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="KEGG: rhi:NGR_c31360 putative succinate
FT                   dehydrogenase hydrophobic membrane anchor protein; TIGRFAM:
FT                   succinate dehydrogenase, hydrophobic membrane anchor
FT                   protein; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69384"
FT                   /db_xref="GOA:E3I530"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E3I530"
FT                   /inference="protein motif:TFAM:TIGR02968"
FT                   /protein_id="ADP69384.1"
FT                   /translation="MPSTTYRTELKKVRGLGSAIGGPGTDHFWAQRLTAVSNLFVVAFL
FT                   VYTGLTLAGAPLGDVKAFFGHPFNAIASILVVISTAIHMRLGMQVPVEEYMPHGLKVPF
FT                   LFLNTFFVIVIAVVGVLSILKLFLGN"
FT   gene            complement(110066..110512)
FT                   /locus_tag="Rvan_0095"
FT   CDS_pept        complement(110066..110512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0095"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="KEGG: mlo:mll4266 succinate dehydrogenase membrane
FT                   anchor subunit; TIGRFAM: succinate dehydrogenase,
FT                   cytochrome b556 subunit; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69385"
FT                   /db_xref="GOA:E3I531"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E3I531"
FT                   /inference="protein motif:TFAM:TIGR02970"
FT                   /protein_id="ADP69385.1"
FT                   /translation="MAEAKPIAGTRPLAPKPMSPHLSIYRFKINMILSIMHRVTGITNY
FT                   FGSLILAIWIASAATSEQAFNTVSSYLATPLGLVILIGFTWSVMHHMLGGIRHFVWDVG
FT                   WGFSKEAVKFLSWASLIGSITLTAIIWGYALSHWGHALSLWGAR"
FT   gene            complement(110919..111968)
FT                   /locus_tag="Rvan_0096"
FT   CDS_pept        complement(110919..111968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0096"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mno:Mnod_3627 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69386"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E3I532"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADP69386.1"
FT                   /translation="MSKARQGNYFEDFRLGQVIAHATPRTVTAGDVALYTALYGPRFAV
FT                   QSSDAFAKASGYAAAPIDDLLVFHIVFGKTVPDISLNAVANLGYAECRFLKPVFPGDTL
FT                   SSTSEVIGLKENSNKQSGVVYVRTTGRDQTGAPVLDYVRWVMVKKRDEAAVAPAPHVPT
FT                   LKAALEPADLGGALPPLTLDGYDTALSGNPARWDDYEIGEKIDHLDAMTLEEAEHQLAT
FT                   RLYQNTAKVHFNLHEQAQGRFKRRLIYGGHIISLARALSFNGLENAFHVAAINAGRHVS
FT                   PAFAGDTVYAWSEVLDKQPLPGRDDAGALRLRLIAAKDKPCTSFPYKAGEQYDPAVLLD
FT                   LDYWAVLPR"
FT   gene            complement(112005..112262)
FT                   /locus_tag="Rvan_0097"
FT   CDS_pept        complement(112005..112262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0097"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="KEGG: rpd:RPD_1279 molybdopterin converting factor,
FT                   subunit 1; TIGRFAM: molybdopterin converting factor,
FT                   subunit 1; PFAM: thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69387"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E3I533"
FT                   /inference="protein motif:TFAM:TIGR01682"
FT                   /protein_id="ADP69387.1"
FT                   /translation="MDVTIKYFAWMRERVGVSEERVALPAHVATVADVVAWLTMRGENY
FT                   AAAFAKPHLTRAAVDQVHASHETCVLGAREIAFFPPVTGG"
FT   gene            complement(112253..112825)
FT                   /locus_tag="Rvan_0098"
FT   CDS_pept        complement(112253..112825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0098"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   rpe:RPE_0925 CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69388"
FT                   /db_xref="GOA:E3I534"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:E3I534"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADP69388.1"
FT                   /translation="MELSSTQRGAHTLANLITATRIATAVLLALAMLGGWPPALAATLV
FT                   AYAATSDALDGRIARARREVTAFGAMLDQLADKIFIATALVLLIAKGAIAGADMLAALV
FT                   ILARETAVLALRRMARLDGMAAPVSALAKVKTASQYLAVFLLFAAAIQPGGRVLLETGL
FT                   AVLWIAAGLSLVTATHYFMRMRENRWT"
FT   sig_peptide     complement(112700..112825)
FT                   /locus_tag="Rvan_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.813 at
FT                   residue 42"
FT   gene            113041..113979
FT                   /locus_tag="Rvan_0099"
FT   CDS_pept        113041..113979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0099"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   KEGG: msl:Msil_1111 glycyl-tRNA synthetase subunit alpha;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69389"
FT                   /db_xref="GOA:E3I535"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E3I535"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ADP69389.1"
FT                   /translation="MKHVKPTTTLDPAHSFQDLILTLQHYWAEQGCVILQPYDMEVGAG
FT                   TFHPATTLRALGPKPWSAAFVQPSRRPKDGRYGENPNRLQHYYQFQAILKPSPDNIQEL
FT                   YLESLVRLGIDPRVHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGFDC
FT                   DPVAGELTYGLERLAMYIQNVDSVYKLNYNGRDDDKRVLYGDVFKQAEQEYSRHNFEFA
FT                   DTAILLQRFRDAEKECKALLAAGEPKEEGARHLQVLPAYDQCIKASHIFNLLDARGVIS
FT                   VTERQSYILRVRDLAKACCAAWLKTEAGGAA"
FT   gene            114064..115182
FT                   /locus_tag="Rvan_0100"
FT   CDS_pept        114064..115182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0100"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; KEGG:
FT                   dat:HRM2_48770 ArgE; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69390"
FT                   /db_xref="GOA:E3I536"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E3I536"
FT                   /inference="protein motif:TFAM:TIGR01910"
FT                   /protein_id="ADP69390.1"
FT                   /translation="MISAIHLTQELIRFDTVNPPGNEAPCARYLGGILDAAGFSIKHPS
FT                   IGDNRENLIAVIGGTSEKRPICFSGHTDVVPLGAAPWTVEPFGGELAFGRVHGRGSSDM
FT                   KGGVAAFVAAAVKLAPRLEGTPGLVLVITAGEERGCEGSNHMKKHGLLPPAGAIVIGEP
FT                   TANRPLAGHKGVFWLEGVAKGVTAHGSMPEQGVNAVYKAARAALALEAFDFSGDSHPVL
FT                   GRPTVNVGWLKGGMNINSVPDEARLGLDVRIVPGLDRKELVERFTRAAGGCVSFHVMST
FT                   ADPVWTDPNDPWMADVIHVVGDVTGNEPTFGGAPYFTDAGALKPGMGNPPVVILGPGEP
FT                   EQAHQTDEWCSVQRIEEAEAIYTDLIVRWCGL"
FT   gene            complement(115250..116539)
FT                   /locus_tag="Rvan_0101"
FT   CDS_pept        complement(115250..116539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0101"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: xau:Xaut_0037
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69391"
FT                   /db_xref="GOA:E3I537"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E3I537"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADP69391.1"
FT                   /translation="MANVVVVGSQWGDEGKGKIVDWLSERADIVVRFQGGHNAGHTLVI
FT                   DDKTYKLSLLPSGVVRGKLSVIGNGVVVDPWALEREIAEVAKLGVKVTRDNLRIAENAT
FT                   LILPLHRELDALRENAAGEGAIGTTKRGIGPAYEDKVGRRAIHAVDLLDLKTLPAKIDR
FT                   ALVHHNALRRGLGQPEIDRDALLAELSAIAPMIAPYVEPVWQLLDRYKREGKRILFEGA
FT                   QGSLLDVDHGTYPYVTSSNTVAASAATGSGLGPSSINYVLGITKAYTTRVGQGPFPTEL
FT                   TCEAGQRLGERGHEFGTVTGRARRCGWFDATLVRQTIKVSGMNGIALTKLDVLDGFDEI
FT                   KVAVGYRLGHHEIDRLPASQEAQASVQPIYEVMPGWQESTQGARSWADLPAQAIKYVKR
FT                   LEELIEAPVALLSTSPERADTILVHDPFQD"
FT   gene            116825..117733
FT                   /locus_tag="Rvan_0102"
FT   CDS_pept        116825..117733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0102"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rpt:Rpal_4780 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69392"
FT                   /db_xref="GOA:E3I538"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3I538"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP69392.1"
FT                   /translation="MTPFFDRPRLLMTLTTIFWAGNFVLGRAIAGHVPPITLACLRWTL
FT                   ATLIFLPFAWTHLKRDGAAIREHWAILLFLGAIGAGAYNTLSYIGLTSTEALNGLVLNA
FT                   AGPMFIALSAWALFGDRIGRLQIAGLAAGFVGVLIVVAKGDLASLAAFHFNPGDVFIIS
FT                   SMLSWAIYTACVRLRPSISWQSFNFVTYAVAAVGNAPFMAWEWSAGSRPVWDEAAVAAI
FT                   IYVSIFPSILAYVFYNRSVELMGPANTGMFLFLVPVFGGLLATLALGEQLHLFHAAGFA
FT                   LIVAGVLLGTRKKSEAVAVKA"
FT   gene            complement(117765..117959)
FT                   /locus_tag="Rvan_0103"
FT   CDS_pept        complement(117765..117959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0103"
FT                   /product="protein of unknown function DUF466"
FT                   /note="PFAM: protein of unknown function DUF466; KEGG:
FT                   aav:Aave_4227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69393"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:E3I539"
FT                   /inference="protein motif:PFAM:PF04328"
FT                   /protein_id="ADP69393.1"
FT                   /translation="MHQKAGFWKMAAQTARLMVGIPDYETYLEHRRARHPGEPFMSWEE
FT                   FFKERQDARYKGKGRFRCC"
FT   gene            complement(117983..120067)
FT                   /locus_tag="Rvan_0104"
FT   CDS_pept        complement(117983..120067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0104"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   rpd:RPD_1551 carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69394"
FT                   /db_xref="GOA:E3I540"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E3I540"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ADP69394.1"
FT                   /translation="MSSHASASLSIRQILMWLVVALAGAGSLGVVALSRGEPISAAWLV
FT                   IAALCVYLIAYRFYALFISRRVLGVDPTRPTPAWRHNDGLDYVPTNRYVLFGHHFAAIA
FT                   GAGPLVGPVLAAQMGYLPGTLWILVGVVFAGAVQDMIILFFSTRRDGRSLGDMVRSEMG
FT                   PVAGGIALIGVLLIMIILLAVLALVVVKALVGSPWGTFTVFATIPIALFMGVYSRFLRV
FT                   GRIGEMSIIGIAMLLAALMYGKVVSEDPALAHYFTLSGEQLALAIIGYGFVASVLPVWL
FT                   LLAPRDYLSTFLKIGTMGLLAIGILIVRPNLEMPAVTQFIDGSGPVWAGSLFPFLFITI
FT                   ACGAVSGFHSLIASGTTPKMIENEGQIRFIGYGAMLAESFVAIMAMIAATVLHPGVYFA
FT                   MNSPAALIGTDAASAAQVISNWGFVVTPDHLTQLAKDVGENTLLSRTGGAPTLAVGMAQ
FT                   ILAGFLGGQTMMGIWYHFAILFEALFILTTVDAGTRVARFMIQDSVGSVVPRFKNTESW
FT                   VNNVIGSALAVSAWGYFLYQGVIDPMGGINTLWPLFGISNQMLAAIALILCTVVLFKMK
FT                   RERYAWVTLIPTTWLLVCTMTAGLEKLFHPDPKIGFLAQASRFETALAEGRLLAPAKSV
FT                   GQMNQIIFNNYVDAVMSGLFVLVVASMVVFGVVAMWRALGSPKPTAIEIGGGPLPKAAE
FT                   "
FT   gene            complement(120387..123173)
FT                   /locus_tag="Rvan_0105"
FT   CDS_pept        complement(120387..123173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0105"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS III domain protein; MutS IV domain protein;
FT                   KEGG: xau:Xaut_0035 DNA mismatch repair protein MutS;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69395"
FT                   /db_xref="GOA:E3I541"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:E3I541"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ADP69395.1"
FT                   /translation="MSSIRQKSMAKEAPGDSASPDARAMPDSVSPETRATPDSVSPETR
FT                   ATPMMAQYLDVKAKNPDFLLFYRMGDFFELFFDDAVKAASALGIQLTKRGKHSGEDIPM
FT                   CGVPVARADDYMQKLILKGFRVAVAEQLEDPELAKKRGPKAVVRRDVVRLVTPGTLTED
FT                   ALLVSGRNNFLAALAKVGKAVAVRYHIAALDISTGEFLLSEASAPDLGGELLRLRPAEI
FT                   LIAEDELGDGTSKAAAEASGAALSPLSRACFGRAKGERALKEAFEVAALDGLGDFTDGD
FT                   LIAIGALLHYVDLTQMGERPALRPPRRDEPARLMAIDAATRASLELVRPNNEGAPTVFS
FT                   AIDRTVTAAGARELMSRLVSPSADSGLVNERLDAVAALIEDWALRERIRHILKTAPDMS
FT                   RALSRLKLKRGGPRDLGAIRDGLRAGGDVAALLAASPAQPAHLKQAMTALAAFTGDDHG
FT                   GALARKLDRALVGVVPFLTKDSGYIATGFDATLDGLRELASSSKVVLAKLQADYAAQTG
FT                   VKTLKIQYNNVFGYFIEVSPGQASALMGEPHSALFRHKQTLASAVRFTTDELAALESRI
FT                   LTAQGDALAREQALFAELSDAVLEREDAIAEAAQALACLDCVGGLAEIAQVQNYVRPRV
FT                   DTSRAFLVEGGRHPAVEQALTREGGAFIGNDCRLDGAGERAPGFLVVTGPNMAGKSTYL
FT                   RQNALIAVLAQMGSYVPATSAHIGVADRLFARIGAADDLARGRSTFMVEMTETAAILNR
FT                   ATERSLVILDEIGRGTATFDGLSIAWAVLEHLHDETRCRGLVATHYHELTRLADDLPRA
FT                   GNVRMAVTEWKDTIVFLHAVEVGPANRSYGVQAAKLAGVPKQVVARAKQILAQLEAGAG
FT                   PHGPLTLPTDMPLFSAPVAHHATDAPHPVLERLATLDVDSLSPREALDLLYALKKEL"
FT   gene            complement(123294..124154)
FT                   /locus_tag="Rvan_0106"
FT   CDS_pept        complement(123294..124154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0106"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   app:CAP2UW1_0927 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69396"
FT                   /db_xref="GOA:E3I542"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3I542"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP69396.1"
FT                   /translation="MVSRFWAMSITSTTGAKAPVITSRAVSGGGVFHQKNQGFEVEGTY
FT                   SPPAYLQKYYWWTYVHPAAVRLFERQWLIDLILWGNYESLREAALDEFGDELPGATLQI
FT                   ACVYGDLSARIADRAKAGGGTLDVVDALPVQLKNLRAKLPEDAPVSLTASSSADLPFTD
FT                   ASFDRVLLFFLLHEMPRDVREATLAHALRVLKPGGKLVIVDYAKPRLWHPARWIWYPVI
FT                   GRLEPFAKELWSTDLRVFMPEAWRKAEMRRSSYFGGLYQKVVLEKDAASALASPATRDA
FT                   VAAAE"
FT   gene            complement(124215..125282)
FT                   /locus_tag="Rvan_0107"
FT   CDS_pept        complement(124215..125282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0107"
FT                   /product="signal transduction histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; PAS fold-4 domain protein;
FT                   KEGG: mlo:mlr9681 sensory transduction histidine kinase;
FT                   SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69397"
FT                   /db_xref="GOA:E3I543"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3I543"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADP69397.1"
FT                   /translation="MPDTDKTQVEELLDMPDLAEALNDDRFQQFLDKMPIAILVGAMDG
FT                   NERIIYANPAFEKIAGVPLTEVLGKTWDVLANASEKGERDLLTAIIDDNADHIGVFHIA
FT                   RPDAETAIADVYSSVIVGDDGQPAFRLVALIDVSAYVGDDDEIDFAKSRGDNDLALLEL
FT                   QHRVKNNLQLITALIRLESRHWPEGKEPLNRLAGRIEALAILYSFLNAKPDGDEVDLGS
FT                   YISQLATAVMRSHAAEGVRLELKADGFPVSVNVAMPVGLVVNELLTNALKHAFQGREGG
FT                   TITVECLGGEDGGRVVVADDGVGLPPETNWPEKGNLGALIVQTLKENAKAKLDLETSHG
FT                   TGTRVTLTLPPAVRL"
FT   gene            complement(125378..127777)
FT                   /locus_tag="Rvan_0108"
FT   CDS_pept        complement(125378..127777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0108"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   mmw:Mmwyl1_2781 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69398"
FT                   /db_xref="GOA:E3I544"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:E3I544"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ADP69398.1"
FT                   /translation="MRALTGGTLLSATGNRAEIELERGYRLTLSFHGARTARLLVTRPH
FT                   GLRCPRTWSLSPELSGDDAIDGRDRLDETGLPNEPIRTADETPRAIVIETVLMRAEIRR
FT                   APLGLTWSFREHEGEPFRLALTDRQTQSYLFDERGNRFAHYLCCDPATAYYGFGEKTGD
FT                   ANKRGRRLRMKTSDAMGYDAETSDPLYKHIPFFIALRPDASAPAVGLFYDNLSHAAFDM
FT                   GQEIDAYHGPFTSFEAEDGDLDLWLFFGGSARDITPAFTALTGRTAMPPRWSLSYSGST
FT                   MHYTEAPDAERQLTGFLAQIHEHALPCGSFHMSSGYTKRGEGRYVFTWDRTRFPEPLRV
FT                   AAAFNASGVRLVANVKPAMLTDHPRFAEVERFGGFVREAEGERPHLAQFWSGKAAYLDF
FT                   TNPETSAWWTAQVKAQLLDHGIAATWNDNNEFEVWDGDARADVNWRGGTMSCLRPVQTN
FT                   LMLRASERAQREHAPRKRPFLVSRSGGPGLQRYAQTWTGDNATSWKTLRYNLRMGHGLS
FT                   LSGVYNFGHDVGGFAGPKPDPELFMRWIEQGVFWPRFSIHSWNDDGSVNEPWMYAELLP
FT                   LVREAFQLRERLVPLLYTLLWRAHAHHEPILRPLFYDFPGEAEAYGEHDAFMLGADMLV
FT                   APVVEDGARERRVWLPDTPGGWYALHGGAHFAPGWHRVDAPLGRAPAFVRAGTMLPLGP
FT                   SPSGETGPLTLRIFPGGHSRLSLSIFDDDGESVFDLSSPPCILAVASEWRANRLALRIE
FT                   REGSRAARWPHICFEDETGQSIPIAVNGLQDVRRLQTSELPFKAPL"
FT   gene            complement(127821..128843)
FT                   /locus_tag="Rvan_0109"
FT   CDS_pept        complement(127821..128843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0109"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="KEGG: S-adenosyl-methyltransferase MraW; TIGRFAM:
FT                   S-adenosyl-methyltransferase MraW; PFAM: methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69399"
FT                   /db_xref="GOA:E3I5P6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5P6"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ADP69399.1"
FT                   /translation="MKRRRRGGTRDVADRGRPVEGPSPDSGPIRHIPVLLREVLEALHP
FT                   GVGERFIDGTFGAGGYARAILEAAHCDVLGLDRDPTAIAGACALETAFAGRLKLAETPF
FT                   SEMEDAAHGIGWDALDGVVLDLGVSSMQLDEAERGFSFMRDGPLDMRMSSSGLSAADVV
FT                   NTYEKDAIADILYTFGEERRSRAIAAAIVKDRETAPFERTGQLAALIARVLGHKPGDPK
FT                   HPATRSFQALRLYVNDELGELTRALEAAERLLKPGGRLVVVSFHSLEDRIVKRFLAERS
FT                   GKRAKASRYIPDAGDSTAPTFELRDRHGVEPGEDEVAANPRARSARLRWAVRTDAPPLA
FT                   "
FT   gene            complement(128843..129295)
FT                   /locus_tag="Rvan_0110"
FT   CDS_pept        complement(128843..129295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0110"
FT                   /product="MraZ domain protein"
FT                   /note="PFAM: MraZ domain; KEGG: azc:AZC_4547 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69400"
FT                   /db_xref="GOA:E3I5P7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5P7"
FT                   /inference="protein motif:PFAM:PF02381"
FT                   /protein_id="ADP69400.1"
FT                   /translation="MDEFASRIDSKVDQRGRVAIPAPFRAVLAQEGTSEIHCYPHLDYA
FT                   TIEAGGSRLVEEIKEIVGRQPTGSALREALELVYFGECEKLKVDPDGRTVLPKRLRDHA
FT                   GITETAVFVGLGNKFQIWEPEAYNKFRERAREQALALRKELGAGSR"
FT   gene            complement(130140..132098)
FT                   /locus_tag="Rvan_0111"
FT   CDS_pept        complement(130140..132098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0111"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="KEGG: bmr:BMI_I21 acetyl-coenzyme A synthetase;
FT                   TIGRFAM: acetoacetyl-CoA synthase; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69401"
FT                   /db_xref="GOA:E3I5P8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5P8"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ADP69401.1"
FT                   /translation="MKLPPLWSPAEKSVENSRLARLMAEVNAADGLDLRTYADIHSYSV
FT                   RETEAFWAKAWDFMGLIGERGDGPIFVQGDKFETSRFFEGARLNFAENLLRKKDDTPAL
FT                   IFRGEDKVARTLSWAELHAAVSSAQQAMRAAGIGEGDRVAALIPNMPEAIIALLAAASL
FT                   GAIWSSASPDFGVQGVLDRFGQIEPKLFIACDGYYYAGKTLYTGDKVAEIVAKIPSIEQ
FT                   AWIVPYLGRAGDVAAACPKARAWDEVLAAHPATDVEFTRLPFSHPLYILYSSGTTGTPK
FT                   CIVHSGGGALMQQMKEHQLHCDLRDGDKLFYFTTCGWMMWNWLVAGLATGATLVLYDGS
FT                   PFHPDGNVLFDLADEVGIDIFGTSAKYIDSLKKAGLRPRDTHRLSSVRMITSTGSPLAP
FT                   ESFDYVYDAIKPDVHLASISGGTDICGCFVLGNPLSPVWRGEIQGAGLGMAVDVFDDEG
FT                   RHLDHGKGELVCLKPFPSIPVYFWNDADGTKYHNAYFDRFPGLWHHGDFAEWTENGGIV
FT                   IHGRSDATLNPGGVRIGTAEIYRQVEQLEEIKEAIVIGQDWDNDVRVVLFVVLKAGAVF
FT                   DEGLKQTIKAKIRHGASPRHVPAVIVQVPDIPRTKSGKITEIAVRDIVHGRAVKNTEAL
FT                   ANPDALDHYRDIGDLQK"
FT   gene            132185..133990
FT                   /locus_tag="Rvan_0112"
FT   CDS_pept        132185..133990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlg:Rleg_0411 AsmA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69402"
FT                   /db_xref="GOA:E3I5P9"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5P9"
FT                   /inference="similar to AA sequence:KEGG:Rleg_0411"
FT                   /protein_id="ADP69402.1"
FT                   /translation="MCYGASSFSVVVFLTCFKMYQITQKVRYVLKSLAAAGLCAGLALV
FT                   FFAVAVPRFFDGDVARKSFVKALSAWSGGKVTLAGQLRIASFATLSVEASDVRFHDAPG
FT                   LDPVQRGSAETVTAVVNLSSLLLGDLEYRKFVVSSPRFVLKRDAGGRAADELAAARLAL
FT                   TLVDRSSLPDIQLRDPVFYIADGALRPYRRVAFERITLKRPDSAAAAPFALSMRKPGFE
FT                   LAFKGERNGQKVSGQLKLVAAGDHPLAAHLIAALAPWETATGFSLEGDLTWSRERFSLD
FT                   NASLSFGDRTATGVLALDVSDDPARLEGTLAYDTLDVTPMWAAARAAAAPSNGGEADGS
FT                   PGVVSPPARVERRAVDLDIRLSADRLRAGAFEAGPVALAVSARSGHLSIDVAELALFGG
FT                   NAIARVEIDPARPGALWVTGTAKRLDAGALASALQLPLSVRGPATVRLGLNVPLGAEAA
FT                   LPETGTASGSFALLFPLGGSLDGVAGRALGAAVAGPAPLATGRERFPFAAARIDGRLTS
FT                   GGVDLDVQGQHEGQKIEGKLRIALPDAAVSGTLSTRREEAPVATSGASKGGAASGSVAA
FT                   RSSKLVLSGTAAAPVLSSHESSLSN"
FT   gene            complement(134151..134951)
FT                   /locus_tag="Rvan_0113"
FT   CDS_pept        complement(134151..134951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gdj:Gdia_1405 nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69403"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q0"
FT                   /inference="similar to AA sequence:KEGG:Gdia_1405"
FT                   /protein_id="ADP69403.1"
FT                   /translation="MLRLVQCLAPLLAAAVAMLAIPCHAADVPRGPRFESYVTVDYAGR
FT                   SMAVANSTVWSLFGPVDREGFRLKLDGLVGVSGETNAGVFSNDFFAQRLGSGGSFSAGY
FT                   QANRGPLWVKAYVGAAYATKVERRSDYGHVAWDADQLEQNMLFGVTASIDAWWRVADRI
FT                   WTSANASYSQVGNTASLYGRAAYEFHRDDAIRLSLGAEGSISSYAESYVLGNAAGEKET
FT                   YAKAGALLNLRYGANDISLSGGGVSASEEKDYRAYVTLSFGRKF"
FT   sig_peptide     complement(134874..134951)
FT                   /locus_tag="Rvan_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            135226..136158
FT                   /locus_tag="Rvan_0114"
FT   CDS_pept        135226..136158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0114"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gem:GM21_3237
FT                   alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69404"
FT                   /db_xref="GOA:E3I5Q1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP69404.1"
FT                   /translation="MRRRFLLGFVLCAALAACAPVMVAQQGTAAAAVSYKTVRTPAGLL
FT                   RLAVTESGRGKPILLLHGFATSSYTWQGVMPDLARKHRVIAVDLRGFGASDKPLDDKYS
FT                   VFDQADVIQAFIEQENLKDLTIVGHSFGGGVTLALALRSKGTLRSRIRNIVLVDSVAYK
FT                   QPLPIFFRMLQVPGLAEVGMALVPPEVQSEQGLKLAYYDHEKITERSITEYASPLRSSA
FT                   AKHALVKTVEQIMPPNIDEIALSYSTIRVPTLVVWCDEDKVVPSVFGQRLKADIPTAEL
FT                   VMFSKCGHMPQEEKPAETARAIESFLARH"
FT   sig_peptide     135226..135297
FT                   /locus_tag="Rvan_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.774 at
FT                   residue 24"
FT   gene            complement(136237..137373)
FT                   /locus_tag="Rvan_0115"
FT   CDS_pept        complement(136237..137373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0115"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; TOBE domain-containing
FT                   protein; KEGG: mlo:mll1463 molybdenum transport protein
FT                   ModC; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69405"
FT                   /db_xref="GOA:E3I5Q2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q2"
FT                   /inference="protein motif:TFAM:TIGR02142"
FT                   /protein_id="ADP69405.1"
FT                   /translation="MIEVVVAQNLGAFALDVDFKTDGRFVALFGHSGSGKTTLINLIAG
FT                   LTRPARGRIVIDGETLVDTTRGILVPACKRRLGMVFQEGRLFPHLSVKQNLLYGAWFAG
FT                   AVDKSGAELARVANLLGIDHLLTRYPNRLSGGEKQRVAIGRALLASPKLLLMDEPLASL
FT                   DDARKLEIMPYLERLRDEAGIPVIYVSHSVGEVARLSDTLVVLSAGKMRACGPTLDLMR
FT                   RVDLFPAAEGGDDAGAVILARVEKHDPDYDLTTLVSRAGEWRMPRLDVAEGKDVRMQIK
FT                   ARDVMISREKPDNMSALNVFRGVVEEVGAMDGASVELRVDCKGETLIARLTRFSVERLQ
FT                   LAVGEPVFAIVKSVSFDRRTLGSGWQDLRASDASAGAE"
FT   gene            complement(137370..138077)
FT                   /locus_tag="Rvan_0116"
FT   CDS_pept        complement(137370..138077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0116"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="manually curated; TIGRFAM: molybdate ABC
FT                   transporter, inner membrane subunit; KEGG: mlo:mll1464
FT                   molybdate ABC transporter permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69406"
FT                   /db_xref="GOA:E3I5Q3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q3"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ADP69406.1"
FT                   /translation="MNDFWTLSPDEWTAIRLSLLVATVAVVASLPFGLAIAWVLARREF
FT                   WGKSLVNGIVHLPLVLPPVVTGYLLLISFGRKGPAGQFFEQCCGLVFSFRWTGAALACA
FT                   VMGFPLMVRAIRLSLESVDRRLEDAAGTLGASPPWVFLTVTLPLIASGVIAGMILCFAR
FT                   AMGEFGATITFVSNIPGETQTLPSAIYTFTQVPGGDEGALRLTLVSLVISMAALIASEW
FT                   LARHAGGAGSITS"
FT   gene            complement(138074..138868)
FT                   /locus_tag="Rvan_0117"
FT   CDS_pept        complement(138074..138868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0117"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="KEGG: atc:AGR_C_4642 molybdate-binding periplasmic
FT                   protein; TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69407"
FT                   /db_xref="GOA:E3I5Q4"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q4"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADP69407.1"
FT                   /translation="MSFRSRFVATVSAALLSAALLVPQAIAQETKPVIVFAAASLKNAL
FT                   DAISADWQKETGKSVKTSYAASSALAKQLEQDAPADIFISADLDWMNYVEKKALIDTAS
FT                   RENLLGNAIVLIAPKDSTATIELKEGADLGKLVGDGRLAVGTVTSVPAGKYGKAALEKL
FT                   GLWSQVENKLAQAESVRAALLLVSRGEAPLGIVYASDAVSDANVKVIASFPASSHPPII
FT                   YPIALTTKAGEDAKSFYAYVKSPKAAPHFEKQGFTVLADKKS"
FT   sig_peptide     complement(138785..138868)
FT                   /locus_tag="Rvan_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            139287..142046
FT                   /locus_tag="Rvan_0118"
FT   CDS_pept        139287..142046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0118"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="KEGG: msl:Msil_1819 phosphoenolpyruvate carboxylase;
FT                   PFAM: Phosphoenolpyruvate carboxylase, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69408"
FT                   /db_xref="GOA:E3I5Q5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q5"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ADP69408.1"
FT                   /translation="MIDTLSPTLGGLPDLESRLQDDIRLLGALLGDTIREQEGDEAFRI
FT                   IETIRRLSVAFEREADTDAARAMDEIMARVTPEQAVIIARAFSYFSHLANIAEDRHRIR
FT                   AARVALERRPDEQEGSLDLTFDRLAKAGIATETVFDMLGTSLVSPVLTAHPTEVQRRSI
FT                   LDATSSIERLLEERDRLTGLELKRNEALLRGRVLQLWQTRLLRSSHLTVADEIENALRF
FT                   YKSSLLTEIPRLYETLEQRIGKPHAGSFFQMGSWIGGDRDGNPNVNTDTLRLALRRQSE
FT                   IALRNYLTEVNELGIEMPLSTRLTQCTPELQALAERSNDNDPHRADEPYRRALTGIYAR
FT                   LAMTLRKLADKSALRPPLTSAEPYTKAEDFLADLVVIEESLLANKGGALIETRLGPLRR
FT                   AVEVFGFHLATVDLRQNSDKHEEVVAELLATARVSADYKSLSEEEKQAVLLSVLGDPRQ
FT                   LRIPTAAYSDLASSELGILDTARAMRGTYGERAIRQYIISHTETVSDLLEVIVLQKEAG
FT                   LMKGALGDPEARVALIVVPLFETIPDLRRAEHIMRDFFALPGIHRLAAAGDGIQEVMLG
FT                   YSDSNKDGGFFTSNWEVCRASVALEGLCSEEGLRLRLFHGRGGTVGRGGGPTYQAVLAQ
FT                   PAGTVNGQIRITEQGEVIASKYAHAEIARRNLESLAAASIEATLLSPRQPVPPEFLEAA
FT                   EQLSALSMKSYRALVYDMEGFDAFFFAATPIAEIAELNIGSRPASRKANQRIEDLRAIP
FT                   WSFSWGQARAALPGWYGFGTAVRSYAKEAPFERTALLRRMRREWPFFRTLLSNMDMVLA
FT                   KADMRIARRYADLVPDRQLARRVTGALLVEWNATVEALNIITGSPHRLADNPPLARVIS
FT                   RRIPYIAPLNHLQIELLRRWRRGDHAEKIRLAIQISINGVAAGIRNTG"
FT   gene            142239..142445
FT                   /locus_tag="Rvan_0119"
FT   CDS_pept        142239..142445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0119"
FT                   /product="TOBE domain-containing protein"
FT                   /note="PFAM: TOBE domain-containing protein; KEGG:
FT                   rsk:RSKD131_4477 molybdenum-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69409"
FT                   /db_xref="GOA:E3I5Q6"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q6"
FT                   /inference="protein motif:PFAM:PF03459"
FT                   /protein_id="ADP69409.1"
FT                   /translation="MKVSARNVFTGKITKVIKGTTTAHVLLDVGGTTITASITNESVED
FT                   LGLKDGMEASAIIKSSDVIIAVK"
FT   gene            complement(142563..143144)
FT                   /locus_tag="Rvan_0120"
FT   CDS_pept        complement(142563..143144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0120"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="KEGG: mpo:Mpop_2461 protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69410"
FT                   /db_xref="GOA:E3I5Q7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q7"
FT                   /inference="similar to AA sequence:KEGG:Mpop_2461"
FT                   /protein_id="ADP69410.1"
FT                   /translation="MPLIETPFLTTVCGLEELAGHASREVSHVLSILDPDEPEPPAFGT
FT                   YGEHARLEMRFHDIIEETAGHIVPTPDDVAKMLAFGRESEAQAGSLRHLLVHCHMGISR
FT                   STATMALLLGQSQPRLSADAIMQHILAMREKAWPNLRILEYGEAMLGRGDEFTRAAGAI
FT                   YRIQLERRPEIREFFVNVGRGREIEAADRA"
FT   gene            143400..145340
FT                   /locus_tag="Rvan_0121"
FT   CDS_pept        143400..145340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0121"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bbt:BBta_0943 putative propionate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69411"
FT                   /db_xref="GOA:E3I5Q8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADP69411.1"
FT                   /translation="MTSPNPAQSRYFDVYESWKRDPEGFWAEAAREIDWFEQPKKIFDA
FT                   NEGVYGRWFTGGVTNTAYNCIDRHVKNGRADQPAIIYDSPVTGQVRILTYADLLTEVAT
FT                   FAGVLKEKGIGKGDRVIVYMPMIAEALIAMLACARIGAIHSVVFGGFAANELAIRIEDT
FT                   QAKAVITASCGIEVTRVIHYKPLLDHAIELSSVKPEVCIIVQRPQEIATLIEGRDYDYA
FT                   ALLDDAKARGVSAACEPMAATDPAYILYTSGTTGRPKGVVRDIGGHMVALKWTMKNHYD
FT                   IDPGEVFWASSDVGWVVGHSYIVYGPLLHGATTIVYEGKPVGTPDAGAFWRVIEQHKVK
FT                   ALFTAPTAFRAIKKEDPQGTFLAHYDVSSLKYLFLAGERADPNTVQWAEDLLKVPVIDH
FT                   WWQTETGWAIAGNCAGLGAMPIKLGSPTFALPGYELHVLNESNEEVARGQTGALSIRLP
FT                   MPPGCLPTLWNNDQGFIEGYLIEYPGYYKTADAGFIDEDGYVFVMARTDDIINVAGHRL
FT                   STGAIEEVVANHPDVAECAVIGIADGLKGQVAAGFVLLKAGVVREINVIEKEIVAMVRD
FT                   QIGPVAAFKTVLTVNRLPKTRSGKILRGTMRKIADGEAYKMPATIDDPATLEEITAALK
FT                   AKGFGTSVEAA"
FT   gene            complement(145496..147700)
FT                   /locus_tag="Rvan_0122"
FT   CDS_pept        complement(145496..147700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0122"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: azo:azo3768 putative catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69412"
FT                   /db_xref="GOA:E3I5Q9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5Q9"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADP69412.1"
FT                   /translation="MAKTKSNGDYTSVAYGQEKILRGEGGETHQVAGGDVPVLTTQQGV
FT                   PVADDQNSLKVGARGPTILEDFHFREKIFHFDHERIPERVVHARGYGAHGYFETTASLA
FT                   DVTKADIFQRVGEKTPVFVRFSTVAGAKGSVDLARDVRGFAVKLYTKEGNWDIVGNNIP
FT                   VFFIQDAIKFPDFVHSVKEAPDRAFPQAASAHDNFWDFISLSPESMHMVMWVMSDRAIP
FT                   RSFRFMEGFGVHTFRFVNAEGKSTFVKFHWKPKLGLQSVVWNEAVKINGADADFHRRDL
FT                   WDAIESGNFPEWELGVQLFDDAFADKFAFDVLDATKIIPEEEVPIRVVGRLVLDRMPDN
FT                   FFAETEQVAFCTQNIVPGVDFTNDPLLQGRNFSYLDTQLKRLGSPNFTFLPINAPKCPF
FT                   ATFQQDGHMTMRNPRGRANYEPNSWGGEKGGPRESPEKGFKTFPEEVAGEMRRLRAESF
FT                   ADHYSQARQFYISQTEIEKQHIADAITFELSKVETPAIRSRVVSHLLNIDGELAKKVAT
FT                   AIRLKEMPKPADAARPTRTDLKESLALSIVKNGPKRFEGRKLGILITDGVDANALADLK
FT                   KSFAAEKALVEIIAPEVGGVSASDGTWIEAKQRLDGAPSVLYDAVAILASPDGGAQLVH
FT                   HPSARDFVADAFAHQKFIGWHGNITPLFSKAGIADELDGGVVQLKGPDDARVFAERCAG
FT                   LRFWPRAEKFKAGSSKPLAAGTASKKNGNGGKKNGGGGIK"
FT   gene            148003..148854
FT                   /locus_tag="Rvan_0123"
FT   CDS_pept        148003..148854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0123"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bmr:BMI_I1965 peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69413"
FT                   /db_xref="GOA:E3I5R0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R0"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADP69413.1"
FT                   /translation="MNARILLSAAVLAFGAQMAQAAPVARVNGTDITEAEIAFAEAEVG
FT                   AEIAGLPAESRRRVLVEYLVEAHLFASEAAKDKLDAAKDFEERAAYYKLRALRDTFYEK
FT                   KVRDAITDAQAKAAYDEQIAKLKPEPEVRARHILVKTKEEAADLVKQLKGGADFNELAK
FT                   KSADGPSANTGGDLGYFSKGQMVKVFEDTAFALQPGQISDPVQSEFGWHVIKVEDKRNR
FT                   PVPSFDEVKDQIVASLVQNQLRETVQKLRSSAKVEIVDPELKKAIEEDAKAAAIETTTQ
FT                   QK"
FT   sig_peptide     148003..148068
FT                   /locus_tag="Rvan_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            148879..150129
FT                   /locus_tag="Rvan_0124"
FT   CDS_pept        148879..150129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0124"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; KEGG: rlt:Rleg2_3538 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein; PFAM:
FT                   arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69414"
FT                   /db_xref="GOA:E3I5R1"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R1"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADP69414.1"
FT                   /translation="MASITKVSPFAPGELVPLPPIAGVKIAVAEAGIKYANRTDVLLML
FT                   FPEGTQAGGVLTRSKTSSAAVDWCREQLQHASARALVVNSGNANAFTGQRGREAVEATA
FT                   AFAGEAGGFEAERVFIASTGVIGEPLDATKFSHVLSKMAGEANEDLWHDAARAIMTTDT
FT                   YPKVATRRAFVGNVPVTLNGIAKGSGMIQPDMATMLSFIVTDAAVEGHVLTELLRRHVK
FT                   TTFNAVTVDGDTSTSDTLLIFATGEAAAKGAPKIAGPDDPEAAAFSAALLSLLHDLAIQ
FT                   VVKDGEGISKLMTIHVEGAESDEAAHRIGMTIGNSPLVKTAVAGEDANWGRIVAAVGRS
FT                   GEAADRDRLSIWFGDIQVAKEGLRDPDYKEEQGSAYMKRGEIEIRVDCGAGGPGRATVW
FT                   ASDLTYDYIRINADYRS"
FT   gene            150092..150550
FT                   /locus_tag="Rvan_0125"
FT   CDS_pept        150092..150550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0125"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpb:RPB_0029 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69415"
FT                   /db_xref="GOA:E3I5R2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP69415.1"
FT                   /translation="MTTSASMPTTGADASPASPGLKLVTCVAVALIDADNRVLLAQRPA
FT                   HKPMGGLWEFPGGKIEAGELPEAALIRELKEELGIEVPQRCLAPLTFASHSYETFHLLM
FT                   PLYICRNWNGMVRPLEGQTLAWVRRDKLRDYPMPAADVPLVPILQDWL"
FT   gene            150763..151386
FT                   /locus_tag="Rvan_0126"
FT   CDS_pept        150763..151386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0126"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vap:Vapar_5067 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69416"
FT                   /db_xref="GOA:E3I5R3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R3"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADP69416.1"
FT                   /translation="MSTSFAVFLPACFALNMAFGPNNLLSLTIGARHGVMPAIAAAPGR
FT                   LVAFAVMIAITAAGMGALLMASEAAFTAVKLLGAAYLVWIGVRLIIAKGFDTLAAPKDS
FT                   TQAPGSFLRQEFLVAASNPKAMLIFTAFLPQFVDQSDYWRSFLLVGVVFLILEVPAIAI
FT                   YALIGSRIGRLAQGGSASRWINRVSGSMMVAFGVALAFARRPAS"
FT   gene            151634..154489
FT                   /locus_tag="Rvan_0127"
FT   CDS_pept        151634..154489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0127"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: pla:Plav_1730 preprotein translocase, SecA
FT                   subunit; TIGRFAM: preprotein translocase, SecA subunit;
FT                   PFAM: SecA DEAD domain protein; SecA preprotein
FT                   cross-linking region; SecA Wing and Scaffold; SEC-C motif
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69417"
FT                   /db_xref="GOA:E3I5R4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R4"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADP69417.1"
FT                   /translation="MVSLGALATKIFGSSNDRLLKSFQSRVAPINALEPKFQALSDDEL
FT                   RAKTVEFRERLANGEHLDKLLPEAFATVREGAKRTLGQRHFDVQLIGGMVLHSGKIAEM
FT                   KTGEGKTLVSTLAAYLNALSGRGVHVVTVNDYLAKRDSEWMGQIFRFLGLTVGCITHEL
FT                   DDVERKAAYACDITYGTNNEYGFDYLRDNMKYTVDEMVQFGGRPPELQGHAFAIVDEVD
FT                   SILIDEARTPLIISGAIEDKSDLYISIDKLIPKLGKEHYDLDEKQRAVTFSEEGNQRIE
FT                   EILQEAGFIEPDSTFYDAENVTIVHHVNQALRAHKLFLKDRDYIVRKGQVVIVDEFTGR
FT                   MMEGRRYSEGLHQALEAKEGVDVQPENQTLASITFQNYFRLYEKLAGMTGTAITEAQEF
FT                   LDIYGLETVEIPTNRPMCRIDSDDEVYRTAAEKYRAIIRLIQDCAKRGQPILVGTTSIE
FT                   KSETLSEMLKPLNVPHQVLNARYHEQEAFIIAQAGMPGAVTIATNMAGRGTDIQLGGNA
FT                   DMQIAAWVAEKRAAGVEPTLDEIKAERDKIATDIEAKKDQALAAGGLYVLGTERHESRR
FT                   IDNQLRGRSGRQGDPGASRFYLSLEDDLMRIFGTDRMDFMLRKLGIKDGEAIAHPWINR
FT                   ALEKAQQKVEARNFDMRKNVLKYDDVMNDQRKVVFEQRIDLMQEETVEETVADMRREVV
FT                   QDLVTTHIPAKAFVEQWDVKGLREEFKAVFDMDLPVEEWAAEEGIAEQEIEERLLAKAD
FT                   AAAARKASDVGSENMRQIEKAILLQTLDHLWREHIVSLEHLRQAVGLRGYAQRDPLHEY
FT                   KSEAFQIFESMLSRLRREVTGQLMHVQLAEPEDYTQTELPELQMFRADPITGADLSEAE
FT                   AEAGPQSRQDRRASAKQGGAKPSAPAAAKASAPRGGGKTPAIDPNNPATWGKVARNALC
FT                   PCGSGKKYKHCHGAIAATAAE"
FT   gene            complement(154699..155955)
FT                   /locus_tag="Rvan_0128"
FT   CDS_pept        complement(154699..155955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0128"
FT                   /product="lytic murein transglycosylase"
FT                   /note="KEGG: lytic murein transglycosylase; TIGRFAM: lytic
FT                   murein transglycosylase; PFAM: Peptidoglycan-binding domain
FT                   1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69418"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R5"
FT                   /inference="protein motif:TFAM:TIGR02283"
FT                   /protein_id="ADP69418.1"
FT                   /translation="MRRFDLDFPMMLDWRLAMRRSVSRMMIASLLVAASASGASAAPCS
FT                   TSSAGFDRWLSQFKAEARSQGLSSRALSALDGVTFDQSVINKDRGQSVFSQSFLEFSDR
FT                   MAAKYRIEKARQLIGGKYKREFDRAEREFGVPGAIISAFWALETDFGANNGNMETVRSL
FT                   ATLAYDCRRPEKFREELLDVLKIIDRGDLSASEMRGPWAGELGQTQFVPSVYLKYGIDY
FT                   DGDGHADLIRSAPDVIGSSANYLKALGWRRGEPWLKEVRVPESMDWSQADLTIQHPLSE
FT                   WQRMGVQLSGAERVNGDLPASLLLPMGRNGPAFLAFDNFKVFLEWNQSLIYATTVAYLA
FT                   TRIDGAPPVSRGRGVSAFGYEQTKELQSLLRAKGYDVGEVDGKLGLLTRASVKKVQQKL
FT                   GLPVDSYPSPELVSRLRGR"
FT   sig_peptide     complement(155830..155955)
FT                   /locus_tag="Rvan_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.887 at
FT                   residue 42"
FT   gene            complement(156073..156900)
FT                   /locus_tag="Rvan_0129"
FT   CDS_pept        complement(156073..156900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0129"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: pla:Plav_3646 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69419"
FT                   /db_xref="GOA:E3I5R6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R6"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADP69419.1"
FT                   /translation="MTTLSPEEIERYKRHLLVKDIGGQGQQRLKAARVLIVGAGGLGSP
FT                   LLMYLAAAGVGALGIIDDDRVSLGNLQRQVAYRTDDIGALKTDRAAALVHALNPHVEVE
FT                   AMPFRLTAENALAVVSRYDIVADGSDNFATRYLVNDACYFAMKPLVFAALGQMEGYVST
FT                   FRAYEMDESGTPRPSYRDLFPEPPAPGEIPTCEEAGVLGPVAGVIGTLQAVEVVKSILG
FT                   LEGTLVGRLLIYDALVGRFQTIALKWDANNPLTGLAPSIRDLSIHAADSEQRA"
FT   gene            complement(156981..157493)
FT                   /locus_tag="Rvan_0130"
FT   CDS_pept        complement(156981..157493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0130"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   oan:Oant_1615 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69420"
FT                   /db_xref="GOA:E3I5R7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP69420.1"
FT                   /translation="MTTPTIRDEATGDEGTIRSITTAAFVTVPYSQGTEAAIIDALRRD
FT                   EALTVSLVALDEGEIVGHIAFSPATIDGEQRGWFGVGPLSVRPDRQNRGIGGSLVRAGL
FT                   ERLRALGAKGCVLVGKPNYYERFGFKADARLTLDGVPPQYFQALSFGGELPRGSVSFHP
FT                   GFGAKDE"
FT   gene            complement(157607..158134)
FT                   /locus_tag="Rvan_0131"
FT   CDS_pept        complement(157607..158134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0131"
FT                   /product="protein of unknown function DUF1457"
FT                   /note="PFAM: protein of unknown function DUF1457; KEGG:
FT                   pla:Plav_0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69421"
FT                   /db_xref="InterPro:IPR009922"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R8"
FT                   /inference="protein motif:PFAM:PF07310"
FT                   /protein_id="ADP69421.1"
FT                   /translation="MASEISFRAQVIMREQQELYGYWRACAQSRPLPSRFDIDPIAIPH
FT                   LLSGLSLLDCGDDLESLRYRLAGTRVGEIYGAEITGRAVFDIGFQHKRDYWRTVYRSVI
FT                   EDQLPMQGTVRGPAAGREHLLLIWLRLPLSGLSGKVERILGYDAAVPATFAHGAPQAHI
FT                   VGERVEKRRARL"
FT   gene            complement(158332..158745)
FT                   /locus_tag="Rvan_0132"
FT   CDS_pept        complement(158332..158745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0132"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   msl:Msil_1673 transcriptional regulator, MucR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69422"
FT                   /db_xref="GOA:E3I5R9"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5R9"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ADP69422.1"
FT                   /translation="MLDEKFENNELVDFTTQIVSAYVSNNAVVAGDLPSLIGEVHSALT
FT                   RASSNVVIVPKEELKPAVAVKKSLTPDYIICLEDGKKFKSLKRHLRTHYNMSPEEYREK
FT                   WGLEPNYPMVAPKYAEARSNLAKKMGLGQRKGR"
FT   gene            159393..160145
FT                   /locus_tag="Rvan_0133"
FT   CDS_pept        159393..160145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0133"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: tmz:Tmz1t_0521 allophanate hydrolase subunit
FT                   1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69423"
FT                   /db_xref="GOA:E3I5S0"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S0"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADP69423.1"
FT                   /translation="MPIEDEVVAPSSLQPRVYDSGESAVLVEFGVGYSKTVSLAILQIS
FT                   ERLHGSHLEGYRESIPALSSLTICYDPLVLTKERLVAAIESACAIPLGAGAAARLWTIP
FT                   CVYGGVSGPDLRDVAREAALSEGDAAALHASETYVVSMLGFLPGFAYLAELPERLRLPR
FT                   RASPRARVPAGSIAIAADMTAVYPLDSPGGWHLIGWTPVPMWDMARRAEPLLRPGDSVR
FT                   FRAIDAVEAEALRRRVAAGWLPTPEAPA"
FT   gene            160142..161179
FT                   /locus_tag="Rvan_0134"
FT   CDS_pept        160142..161179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0134"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: met:M446_2133 UreA
FT                   amidolyase related protein; SMART: Allophanate hydrolase
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69424"
FT                   /db_xref="GOA:E3I5S1"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S1"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ADP69424.1"
FT                   /translation="MRPALTIVDPGFAATIQDRGRVGWQRFGVPVSGALDPEALAAANI
FT                   LAGNTPESAAIEVMGAGLRLRVHAEGVTLAVAGCAARLRIERAGAAVSVAPLRSFTAHR
FT                   GEVLRFPPPKNGAVYYIAAAGGFDIPAVLGSRSTYMRARLGGIEGRALRAGDMIPLMRE
FT                   AAPGTPSLHLDASFDAPKSLRIMRGPNADYFAASAFEALLGGAYTVTPASDRMGLRLDG
FT                   KPLDRAKPGEVPSQGTTAGALQVPPDGQPILLLADRQTTGGYPRIATVIGADIAAAGRL
FT                   VAGMAVRFAEVGREEAVAALKARTEWLAALPSRLKPVPDSALTAERLLGENLIGGVTAG
FT                   EGGEI"
FT   gene            complement(161214..162080)
FT                   /locus_tag="Rvan_0135"
FT   CDS_pept        complement(161214..162080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0135"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="KEGG: met:M446_5500 acyl-CoA thioesterase II;
FT                   TIGRFAM: acyl-CoA thioesterase II; PFAM: acyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69425"
FT                   /db_xref="GOA:E3I5S2"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S2"
FT                   /inference="protein motif:TFAM:TIGR00189"
FT                   /protein_id="ADP69425.1"
FT                   /translation="MPAVDQLLSILDLEQLEHNLFRGRSPQNGWQRVFGGQVVGQALTA
FT                   AYRTVEDQDRVAHSLHAYFLLGGDPKVPIIYHVDRMRDGGSFTTRRVTAIQHGRPIYTM
FT                   AVSFHALESGFDHQIEMPKVAQPEELPSEEELKARLLPILPEVMRLYWERDRPIELRPV
FT                   DLSRFFCKEKLEPKQYIWFRANGSLPDNFRLHQCVLAYASDFSLLDTALVAHGRSLFEP
FT                   ELMLASLDHSVWFHRPFKADEWLLYAMDSPSAQAARGFCRGSIFSRDGTLVASVAQEGM
FT                   IREKAAK"
FT   gene            162168..163424
FT                   /locus_tag="Rvan_0136"
FT   CDS_pept        162168..163424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0136"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="KEGG: nha:Nham_0088 2-octaprenyl-6-methoxyphenyl
FT                   hydroxylase; TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69426"
FT                   /db_xref="GOA:E3I5S3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S3"
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /protein_id="ADP69426.1"
FT                   /translation="MNDIQKNRFDIVICGGSFVGLALARALEASAPGAFAIAVIEQRTL
FT                   AAATADPRTVALTASARAMLEATGIWQRIADKAEPVRRIVLTDSALESPVRPGLIGLDA
FT                   EDTPTGEPTAYVIENATLLPALLASLDGLPNVSFFAPDAIDHFETRDEDVSIALRSGAE
FT                   LSAKLLVAADGRNSAAREMIGIRTQSWPSDKVGIVATVGIEQPHNGTAWQHFLPAGPFA
FT                   ILPMTPGSDGGNRASVVWTEDAAVARRILAEDREAVLAELSQRFGPELGALTLLSSPQA
FT                   FPLSMVLAREFVRPRFALVGDAAHGLNWIAGQGLNHGLKDVAALAETLVDAGRLGLDIG
FT                   DVTILRRYERWRRFDVVTSAFSGAALNAFFSNDWTGLRMLRNAGLRTVDGIGRLKTLFM
FT                   NEAAGRTGDVPKLLRGEAL"
FT   gene            complement(163443..164453)
FT                   /locus_tag="Rvan_0137"
FT   CDS_pept        complement(163443..164453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0137"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   pag:PLES_21141 putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69427"
FT                   /db_xref="GOA:E3I5S4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP69427.1"
FT                   /translation="MDNFTSDAPDAGQSALFERAAAEYLNKAASVDPALLRDWRQPDGL
FT                   YRRVRRAIGLLPGIRARTATVDGHELRYWDAGPANKPAAVLLHGFSASKENWLNVVLFL
FT                   ARSHRLLVPDIPGFGESSFVPDASYGLAAQADRLKAWFAQTGAEKAHWVGSSMGGALAG
FT                   LVAAKSPDLVRSLILMDSAGVAGEGLSPFEAGLLDGRNGLIAEKPEDMEAIFTLLSGKN
FT                   GGGFQNAILAALVARDQIARAPVYRHLFREMILSPELPATHWAPNIAAPTLVVWGEADK
FT                   ILDPAEASVLASLIRGCEILMMKEVGHLPMLEAPARTAALLKLFWSRFESSDAAA"
FT   gene            complement(164580..166136)
FT                   /locus_tag="Rvan_0138"
FT   CDS_pept        complement(164580..166136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0138"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: pla:Plav_3604 integral membrane protein MviN;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69428"
FT                   /db_xref="GOA:E3I5S5"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S5"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADP69428.1"
FT                   /translation="MSLYRGFLTVGGLTAISRVFGFVRDVLLAAVMGTGWVADAFFVAF
FT                   RFPNLFRALFAEGAFNSAFVPLFTKRLRGEGDVRAREFAEEALSILLVGVTATVILAEI
FT                   FMPYLVRAIAPGFSEDKQKFELAVLLTRITFPYLVCMSLVALAAGVLNAHQKFRAPAAT
FT                   PILLNLVLIAVTLFAAASGFRDQPEAGIVQAWGVAIAGFAQLLFVAWAARGLGMDLRFR
FT                   LPRLTPDMRRLVKLAVPGLITGGINQVNIFIGTMIASLQASAVSYLYYADRVMQLPLGM
FT                   VGIAIGVVLLPTLTRHLADADEPAALASQNRSLEFALLLTLPASVALIVIPDPIIQVLF
FT                   QRGSFTPEATRQVSLALAAYAAGLTAFVMTKVFLPGFFAREDTATPMRFVAASVAVNVG
FT                   GSLLMFPYIGHVGIAIATSLSGWTNALLLMITLMRRGHFRFDDALKRRAPRIVAASVAM
FT                   GGALYWLEPVLDPYFAADRSTMKQAGAMLLLVTSGAAVYAAVILASGVVRLSALRRAMR
FT                   A"
FT   gene            complement(166236..166658)
FT                   /locus_tag="Rvan_0139"
FT   CDS_pept        complement(166236..166658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_1683 OpcA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69429"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S6"
FT                   /inference="similar to AA sequence:KEGG:Ava_1683"
FT                   /protein_id="ADP69429.1"
FT                   /translation="MNPRLSLVFAIAILAAPTPAAVQAFGQVADSIGYIATAPISGLPK
FT                   GLYKDWTDDEKGTAFKRIGGFCQFLCVDSFGNTTFPNVAAADRARAEAKLCLQACVVGH
FT                   LPRDYPNRDAMKEDLRVAYDAARKQGSAVAWPLPKE"
FT   sig_peptide     complement(166584..166658)
FT                   /locus_tag="Rvan_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.589 at
FT                   residue 25"
FT   gene            166894..172236
FT                   /locus_tag="Rvan_0140"
FT   CDS_pept        166894..172236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0140"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein;
FT                   alpha-2-macroglobulin domain protein 2; KEGG: bja:blr4438
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69430"
FT                   /db_xref="GOA:E3I5S7"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S7"
FT                   /inference="protein motif:PFAM:PF01835"
FT                   /protein_id="ADP69430.1"
FT                   /translation="MYLMRVLLACFITFSTVVAASAEPRSPIEDSVVRESETFENTLTA
FT                   TWPTKGKDARSWKAEGAKAIAANDPRAATGYFASSALLDRKNADTWLQLARAYLAIETE
FT                   KYGEKIAFARNAGSSAYIAYARATMPAAKAASLAVLAESLGAREQWRPALRVYKLSLGL
FT                   DANPDVQTAYDEAFNEHGFRMLDYTADNESNAPRICVQFSDTLAKGRVDYTNYVTVNNA
FT                   KPGSVRVDGQQLCVEELQHGKRYEVKIRSGIPSTEDDLLPKPVELTVYIRDRSPSVRLS
FT                   GRNYVLPRTGQQGIPVVSINTKLVKASIYRIGDRRLADEVLDGNFQSSLEGYQLNQIAS
FT                   QKGEKLWSGEMPVEMKPNEEVTTAFPVDTLLPNLKPGLYVIAASSAEESAKVEADSADA
FT                   SEDYSTKTTQWFVVSDLGLTAFSGADGVHVYVRSLGSAAPAQGVEIRLIARNNEVLGTQ
FT                   KTDERGEAVFDAGLARGTGGLAPALVIARDNLHDYGFLDITKQAFDLSDRGVGGRTPPG
FT                   PLDAFVFTERGVYRSGETVYVTALLRDQAANAAPSTPLIVKLFRPDGVEDRRETLADQG
FT                   NGGRSWQIALPETAMTGSWRIAAYVDPKAPSLYEKTFLVEDYVPERLEMKLKAEQPLIS
FT                   AAKPGVIALDGRYLYGAPASNLGLEGEIAVSAASEVAGFSGFRVGLESEKFTTVRTALD
FT                   GLPTTDAQGAAKLSIALPELPQTTKPLSADITVRLREPSGRALTDRIGLKIDTGKSFVG
FT                   VKPLFQGSVPEGDEAAFEVVGISADGKQAEIKGLKWDLLRVENQFQWYNRDNRWSYELV
FT                   TYESRVAGGTLDTPASGTAKISAPVKPGNYRLDIASTDAKGPATSATFSAGWYVSETSE
FT                   TPEILNLALDKASYGPGDDIKVSILPRMAGKALVAIVSDKVLATDFIDVAASGGSTTFK
FT                   VDPAWGPGAYATAILYRPTDSAAKRMPSRAVGVKWIALDNKPRTLAVALNTPPAVRPAG
FT                   PVTVTASVAGLDAGENATLVVSGVDLGILNITRYKTPQPAGYFYGQRRLGLEMRDLYGK
FT                   LIDGMQGVRGQVRSGGDEGGLDMNGRPLAETPLAVYSGPVKVGADGKAQVTFELPAFNG
FT                   TMRLSAQAWSPTKLGTGEKDVIVRDTVVAQATAPKYLLLGDRSNLHLSIENVEAPAGAY
FT                   QLALKGEGGVEVEGAAERTLQLDLEKRVSAVIPLRAASVGEGSVSFSLTGPGNVAIERT
FT                   YAIPVEPPAPNVRRRSTVTLAANTGSLRVGPELVADLVPATSRISLTASRTASFDVPGL
FT                   LLGLDRYPYGCAEQTTSRALPLLYYDEVASRARVSKEPQAKAAIEKAIARLYEMQGSNG
FT                   TFGLWGPGGEDIWLTAYVAEFLTRAKEKGYAVRDGNYVLALDRLRNAVNNTGDFKKGGE
FT                   DLAYALYVLARSGRGVLGDLRYYADTKIDAFSTPIARAQLAAALAMMGDRERATLTFAS
FT                   ALNLLAKPDAKTPLVSRTDYGTELRDAAAVLALLGESNAATPQLQKAFDIVTKLRAQQK
FT                   ETTTQESLWLLLAARTLDAQNKDLALEVNGQPVKGSFQTVLAGSDFKGDRIAVTNVSAI
FT                   LPNATAAQFETALTRAQFAADGLVVRNAGSDTVPASVLVTGEGLEAEPSAESGFKIERK
FT                   TYAPDGKEIAFDRLKQNDRVVVVLKVTEVEPKTGQIIVEDRLPAGFDIENPALLKGSDL
FT                   KAFSWLPTTWTPAFSSFRDDRFVAAYSLTDASRKLPAQLTMAYVMRAVTPGAYTHAGAR
FT                   VEDMYRPDRFARTSGAKVEIGAAQ"
FT   gene            172405..174501
FT                   /locus_tag="Rvan_0141"
FT   CDS_pept        172405..174501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0141"
FT                   /product="penicillin-binding protein 1C"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; KEGG:
FT                   mex:Mext_1396 penicillin-binding protein 1C; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69431"
FT                   /db_xref="GOA:E3I5S8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S8"
FT                   /inference="protein motif:TFAM:TIGR02073"
FT                   /protein_id="ADP69431.1"
FT                   /translation="MVLRGMMRKRRVWLVVALFAGLAAVSAYALKLFAPLPLDAAESSS
FT                   RLVLDRDGRLLRAFTTPEGRWRLDARREDVSPTYLSLLFTFEDKRFNTHYGVDPMAFGR
FT                   AALQAARHGKAISGGSTLTMQVARLLRGSPTRSIPAKFQQIADAIRLEWALSKDEILAL
FT                   YLKLAPYGGNLEGVRAASLAYFGKEPHRLSIAEAALLVAIPQSPETRRPDRGYASLVAG
FT                   RNRVIRRAAAAGVIADADARAAIASVAPRGRLDFRALAPHLSERLVAQHPGMSVIATTI
FT                   DRTLQEQAEAVARRNAEAFGEKISVAALIVRNRTGEVLAHVGSAGYFDGDRLGAIDMTA
FT                   AIRSPGSALKPFIYGLAFEEGIAHPETLIDDRPVRFDTYAPVNFDNIFHGTVTVRTALQ
FT                   LSLNIPAVKVLNEVGPVRLAARFREVGMPFAMPRNLTVALGGAGLTLENLTTLYAALGR
FT                   GGTLVPIRYEKEGGPVWGASEPPALLQPAAVWYVTDILRGAPVPPNVTPGQVAFKTGTS
FT                   YGFRDAWAAGYDGEYTVAVWAGRADASAAPGLVGLRVAAPVMFELFAAIGPRRVAFGSP
FT                   PPNLIGSRRNADLPPPLRVFREQRHEGSGATVEQALHIAFPPPNAEVELAKTEGADGEA
FT                   EALPVALKAEGGALPLTWLVDGNPLASSPHRRDAFLKPRGPGFVQITVVDAEGRSDRTQ
FT                   IRLR"
FT   sig_peptide     172405..172494
FT                   /locus_tag="Rvan_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.720 at
FT                   residue 30"
FT   gene            174739..176358
FT                   /locus_tag="Rvan_0142"
FT   CDS_pept        174739..176358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0142"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: mca:MCA1110 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69432"
FT                   /db_xref="GOA:E3I5S9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5S9"
FT                   /inference="protein motif:PFAM:PF04349"
FT                   /protein_id="ADP69432.1"
FT                   /translation="MLDRRSFMKLALAAQAAAALPAFAGTPTPGLRFGDPQPFSFDWLK
FT                   AHAEALSKAPYAPPPRPDPATVAAIDYDAHGKLKYKHEYALYGDGHDAAFPITFQHVGY
FT                   YFPKTVRMHALEQNAGGAVSREILYDPAYFTIAPDSPAARLAPEPSSLAGFWVMEPRDG
FT                   KEDWKKAEPWVTFLGASYFRAKGELGQVGMSARGIALSPGGSGHEEFPDFVSFWFMPAP
FT                   PASRTVTVYALLNSPSVSGAYKFDLHRTSGVVMDIELTLFFREAVERLGLAPLTSMFWY
FT                   GEKAKPAGIDWRPEVHDSDGLSLATGQGERIWRPLNNPEHITISSFADEHPRGFGLLQR
FT                   DRAFDHYQDGVGYEKRPSTWVEPKGTGWGKGTVQLVEIPTDDEINDNIVVYWNPEKRPE
FT                   PGDRIDLAYRVHWLADEPYPTPLARCVATRFGRGGEPGTIRPYGVRKFTVEFLGGPLKE
FT                   LPSGVKPEVVVWASRGNVRSMVAEAVPDDVPGHWRAHFDLSVDGREPVELRLYLRANDK
FT                   VLSETWLYQYHPFVTDARPLGY"
FT   sig_peptide     174739..174813
FT                   /locus_tag="Rvan_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            176487..179345
FT                   /locus_tag="Rvan_0143"
FT   CDS_pept        176487..179345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0143"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; histidine kinase A domain
FT                   protein; response regulator receiver; KEGG: met:M446_1809
FT                   PAS/PAC sensor hybrid histidine kinase; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAC repeat-containing protein; PAS domain
FT                   containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69433"
FT                   /db_xref="GOA:E3I5T0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADP69433.1"
FT                   /translation="MRPAGRNREHARSLRFLARLGIGPELRSAPSVHVNWNGHELCLSF
FT                   AAPYPRSETFELCPVLIAGNPFVGHEMTRQPSDRLTDLAGCQPPTAGAAAFATLDAGGH
FT                   FLSANERFCVFTGRRETDLLRLRLSDVATGELAEPGKLDGLGEQGLETRTHLVSADGRA
FT                   VPLIATLTPVLRGKELVCIHVLARAEALGTEAEDRRCRAVVDAVRGVLWTNNAAGEMWG
FT                   EQPGWAALTGQSFDEYQGFGWKAVLHPDDVQPTLDAWKAAVSTKSMFVFEHRVRRPDGQ
FT                   LRRYSVRALPVFDDAGEVSEWVGIHTDITEQRAAERAWLDLSANLKQRAQAADEARERT
FT                   WNNARDMLLITDSEGVFRAANPAWTAVLGWLPEEVTGKSYCDFLHPDDKSAATGAAFFA
FT                   RGGSKGIEVRFRHKNGTYRWTSWLIAPDGDLIYANGRDVTAEKEGAEALERSEARMRAI
FT                   FHTSYHSKCISALDGTLLDANPTSLAAIGADTADVVVGQPFWDTPWFSDTPGMPDFIRS
FT                   SFAEVVTGETVRREILLNLPGGPRWFDFTMRPICGARGQVVSVVSEAADITTRRKAHEA
FT                   LLQSQRLEAVGQITGGIAHDFNNLLTPIMGAFELLQRRIAPDERLHALISNAMQSAESA
FT                   RVLVQRLLAFARRQHLDTRAVDLKGLILGLHDLIARALGSRIDVRVEIPDGLPRARVDP
FT                   SQFEVALLNLAVNGGDAMPDGGTITISASAETIEEGTASDLAPGRYIALAFEDTGIGMT
FT                   REMLARAVEPFYSTKGIGKGTGLGLSMIHGLAAQSGGKLDLESEPGRGTRATLWLPVAE
FT                   AETVADGAPAPEPSGVEPLVVLLTDDNNFVRDGAAAMLEALGHTVIQAESGPCALHHLA
FT                   EGCRCDVLITDQRMPGMLGSELVRRARDLRPDLPAVLITGFAEEGDADVDALPRLSKPF
FT                   RSLELERVLAMALGAKKTAPET"
FT   gene            complement(179380..179754)
FT                   /locus_tag="Rvan_0144"
FT   CDS_pept        complement(179380..179754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0144"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: cak:Caul_0470 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69434"
FT                   /db_xref="GOA:E3I5T1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP69434.1"
FT                   /translation="MVEQRALAGARVLIVEDDALSAHVAQEMLAELGCSVTGVAASVDQ
FT                   ALHEINNEKQLDCVMLDVRLGRELSSDIATYLLQQNLPFIICSGYDIKLPGMNIPVVDK
FT                   PYTVAALAQALSLAMTQKAL"
FT   gene            complement(179998..180888)
FT                   /locus_tag="Rvan_0145"
FT   CDS_pept        complement(179998..180888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0145"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: xau:Xaut_0205
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69435"
FT                   /db_xref="GOA:E3I5T2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T2"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADP69435.1"
FT                   /translation="MTFTERLEDHASRVERHLDEWLSTDKLGAVPDRLLDAMRYGTLGG
FT                   GKRFRPFLVIESAALFGVPVEKALNAGSALECIHCYSLVHDDLPAMDNDDLRRGRPTVH
FT                   KAFDDATAILAGDTLLTVAFEIIAHESTHPNPAVRAALGLELARASGGAGMAGGQMLDL
FT                   MAPGKMLGEADIRTLQAMKTGALITYGCVAGGILGEASKAELAALKTYGDALGAAFQLA
FT                   DDLLDAEGDAAVVGKATGKDQEAGKGTLVSLLGLEAAHAKLQNLKAEALGALAPFKGRD
FT                   AMLAGAAEFVVARKF"
FT   gene            180986..181762
FT                   /locus_tag="Rvan_0146"
FT   CDS_pept        180986..181762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0146"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="KEGG: rle:RL4627 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; TIGRFAM: monofunctional
FT                   biosynthetic peptidoglycan transglycosylase; PFAM: glycosyl
FT                   transferase family 51"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69436"
FT                   /db_xref="GOA:E3I5T3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T3"
FT                   /inference="protein motif:TFAM:TIGR02070"
FT                   /protein_id="ADP69436.1"
FT                   /translation="MTDLAPKTFERLAEVTRPHNRGWRGRALRIVLIALGVFLLAPYVL
FT                   TLVYAVVNPPLSALMARQALLGRPVAHDWRDLDEISPNLIAQVIVSEDGRFCQHHGVDW
FT                   QALDKAVDAVKAGKPKGGGSTITMQTAKNLFLWSDPAWLRKPLEIPLASFMDAVLGKRR
FT                   VMEIYLNIVEWAPGVYGAQAAARHHFKTSAEDLTMQQAAQLAAALPNPKRRNAGKPGPR
FT                   VAALANRLRVRAARESDNSFCVLEEEAPAEDEASQE"
FT   gene            complement(181886..182230)
FT                   /locus_tag="Rvan_0147"
FT   CDS_pept        complement(181886..182230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0147"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: nwi:Nwi_0411 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69437"
FT                   /db_xref="GOA:E3I5T4"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T4"
FT                   /inference="similar to AA sequence:KEGG:Nwi_0411"
FT                   /protein_id="ADP69437.1"
FT                   /translation="MTYVVLDACIKCKFTDCVEVCPVDCFYEGANMLVISPDECIDCGV
FT                   CEPECPVDAIKPDTEPGLEKFLEVNREYAALWPNITVKKPPLPDYEKFQQEAEKFEKYF
FT                   SPDPGEGDSE"
FT   gene            complement(182386..183003)
FT                   /locus_tag="Rvan_0148"
FT   CDS_pept        complement(182386..183003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0148"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: RNA-binding S4
FT                   domain protein; ribosomal protein S4; KEGG: mch:Mchl_5204
FT                   30S ribosomal protein S4; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69438"
FT                   /db_xref="GOA:E3I5T5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T5"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADP69438.1"
FT                   /translation="MTKRASAKHKIDRRLGENLWGRPKSPLNKREYGPGQHGQRRRGKT
FT                   SDFGTQLKAKQKLKGYYGNITERQFRLIYAEATRLRGDTSENLIGLLERRLDAVVYRAK
FT                   FVATPFAARQFISHGHISVNGRRVNIPSYRCRAGDVIEVREKAKPLAFVLEATQSAERD
FT                   VPDYLEVDHGKLTARLSRIPQLSDVPYPVVMEPNLVVEFYSR"
FT   gene            183358..184548
FT                   /locus_tag="Rvan_0149"
FT   CDS_pept        183358..184548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0149"
FT                   /product="lycopene cyclase"
FT                   /note="KEGG: psa:PST_3874 lycopene cyclase; TIGRFAM:
FT                   lycopene cyclase; lycopene cyclase family protein; PFAM:
FT                   Lycopene beta and epsilon cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69439"
FT                   /db_xref="GOA:E3I5T6"
FT                   /db_xref="InterPro:IPR008461"
FT                   /db_xref="InterPro:IPR010108"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T6"
FT                   /inference="protein motif:TFAM:TIGR01789"
FT                   /protein_id="ADP69439.1"
FT                   /translation="MSDRDFDVIFAGGGLAATLAAYRLRQVKPELSVLVLEADDKFGGN
FT                   HTWSFHTTDISEDAWAWIAPFVAHSWSEQQVRFPKHTRTLKSGYNSIFSETLHDAALPV
FT                   LKDSVRFSTRVLSVSPHQVVLSGGEVLRAPCVIDARGIGRVDNLTIGYQKFLGLVVRFE
FT                   RPHGQPYPIIMDATVRQRDGYRFVYTLPFTDDTMLIEDTYYSDNPAIDAHTHRELCLDY
FT                   ARERGWQIAEIEREERGVLPIVLGGDVSDILEKNADGVPALGLRGGFFHHTTSYSFPFA
FT                   VRCADAIAAMDHLTSESLHRITHKWAHQHWREQRFFRLLNRMLFWAAKPETRYRVLQRF
FT                   YDLHEPLIERFYSSSLTLADQARILIGWPPVPIHKAVRVMGETRVNPIPQPVSSPS"
FT   gene            184563..185537
FT                   /locus_tag="Rvan_0150"
FT   CDS_pept        184563..185537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0150"
FT                   /product="Phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="KEGG: xau:Xaut_3578 squalene/phytoene synthase;
FT                   PFAM: Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69440"
FT                   /db_xref="GOA:E3I5T7"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T7"
FT                   /inference="protein motif:PRIAM:2.5.1.32"
FT                   /protein_id="ADP69440.1"
FT                   /translation="MDPIIALSHELIEKGSKSFAMAAKLLPRDARYDSMMLYAWCRHCD
FT                   DVIDDQILGFNRETGSEKSPQERLEGLRRDTAAALAGTATEPVFVALGRVAHKHHIPER
FT                   HPMELLRGFEMDVNERVYETLEDTLDYCYHVAGVVGVMMAMIMGVRERPTLNRASDLGI
FT                   AFQLTNICRDVVEDAKAGRLYLPRQWLREAGVPEDKVADPQYRRQVYEVTKRLLCEADQ
FT                   YYRSAMFGMQRLPLGAAVGIGAARRVYRDIGRLVANRGESAWDGRAIVGPMRKLAAALS
FT                   GATAAVRAHTTLRIGYAPPRDGLWTVPELGKPTRRNRPFAFLR"
FT   gene            185759..186430
FT                   /locus_tag="Rvan_0151"
FT   CDS_pept        185759..186430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gau:GAU_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69441"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T8"
FT                   /inference="similar to AA sequence:KEGG:GAU_0057"
FT                   /protein_id="ADP69441.1"
FT                   /translation="MEFAVLARGDEDRLEQLIAIYRASIARAEQKPEWMVREMLGDTSR
FT                   RLLVALDEGRVIAFAICYFAPDDAFWLLEYLAVDANIRSGGVGGRTYDAARALAAEVAP
FT                   GAPCLLEVDAPRLGAPDTDDAWRRLRFYQRFGCRRVEGHTYVLPFGLPGEVPPMWLLVD
FT                   GLKGQESVSADTVAAWLRGIYTGVYAQAADHQLITAMMQPLEGKGTVRLRALDASPSSG
FT                   A"
FT   gene            complement(186427..186969)
FT                   /locus_tag="Rvan_0152"
FT   CDS_pept        complement(186427..186969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0152"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: psa:PST_3871
FT                   beta-carotene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69442"
FT                   /db_xref="GOA:E3I5T9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5T9"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ADP69442.1"
FT                   /translation="MSDWLLYIALFFAVFFFMEGTAWFLHKYVMHGFLWVLHKSHHEPR
FT                   TGAWELNDAFGIFFAGIAIALIAWGVQFGGPTWAWVVGAGVTAYGFVYFLAHDVLVHHR
FT                   LGVNIHPKSGYLRRLYQAHRLHHAVDGKAGCVSFGFVFPPSPDRLKKKLQELAPLRAAQ
FT                   RNKLDAKRFTPNGETLH"
FT   gene            complement(186993..187919)
FT                   /locus_tag="Rvan_0153"
FT   CDS_pept        complement(186993..187919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0153"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: cak:Caul_1707
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69443"
FT                   /db_xref="GOA:E3I5U0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U0"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADP69443.1"
FT                   /translation="MGGQLDVYMMLRAKIESRLAELVRLDGPLDPLQGSLRHSLLAPAK
FT                   RVRAVLTLVAARELGGRESDALDLACAVEMIHTSSLILDDLPCMDNAATRRGIPSNHRV
FT                   FGEATAILASIGLMNRAYGVAAASAKLSADQRAEAVGVLEWSVGLEGLVRGQHDDLADY
FT                   RATMNEAQLETMYAQKTGALFAAAAECGAIVANNQAARPAMRKFGLDLGVGFQILDDVL
FT                   DAHATSDRAGKDTSKDSGRTTFPSLLGVTEAAEIGRTKIEGGVGAAVAAAQAAGSDGRL
FT                   FTAFASRLAEAFSELMPEFRGKLVVSA"
FT   gene            188105..188398
FT                   /locus_tag="Rvan_0154"
FT   CDS_pept        188105..188398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0154"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   bcs:BCAN_A2174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69444"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U1"
FT                   /inference="protein motif:PFAM:PF07045"
FT                   /protein_id="ADP69444.1"
FT                   /translation="MPKAYWIARVDVKDADAYKAYVTGAADAFKAHGARFLARGGRFTA
FT                   AEGTGRARNVVIEFPSFEAAVDCYNSLEYQAARAHRAGFSEGEIVIVEGVEP"
FT   gene            188418..189950
FT                   /locus_tag="Rvan_0155"
FT   CDS_pept        188418..189950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0155"
FT                   /product="phytoene desaturase"
FT                   /note="KEGG: msl:Msil_2029 phytoene desaturase; TIGRFAM:
FT                   phytoene desaturase; PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69445"
FT                   /db_xref="GOA:E3I5U2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR008150"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U2"
FT                   /inference="protein motif:TFAM:TIGR02734"
FT                   /protein_id="ADP69445.1"
FT                   /translation="MDQIVANTEAPARSRAGSAETALVVGAGFGGIAAALRLAAKGYRV
FT                   TLIDRGRMLGGRAQVFEKDGFKHDAGPTVITAPFLIEELFDLFGKKSEDYLTLKPLTPW
FT                   YRFFFDEDGSTFDYGGTLEETLAAMNRIDPRDGDGYLRMLEHSKQLFDAGFTNLADQPF
FT                   HNPFTMVGQIPRLVQLGSYRTIWDFVTKYFHSPKLQQALSIQPLLVGGSPFNTTSIYGL
FT                   IHYLERKWGVFYAEGGTGAIVSALGKLMEEEGVDIRLGETVSSVVIENGTAKGVRLKDG
FT                   ETVSADIVVSDVDPMHLFGDMIPDSEIGLSAKLKRKTARLSMGLFVLYFGTDRQYPDVQ
FT                   RHTIWLGKRYRGLLDDIFNKKVLADDFSLYVHRPTATDPTFAPEGCDAFYALCPVPNLK
FT                   GNIDWSVEGPKLRDRIVAGLERTILPGLSETIRAEMVMTPPDFKHGYLSHEGAGFSLAP
FT                   HFTQSAYFRFHNKAEGIKNLFLTGAGTHPGAGIPGVICSAKVIDKLIPHARS"
FT   gene            complement(190295..190963)
FT                   /locus_tag="Rvan_0156"
FT   CDS_pept        complement(190295..190963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_3747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69446"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U3"
FT                   /inference="similar to AA sequence:KEGG:AZC_3747"
FT                   /protein_id="ADP69446.1"
FT                   /translation="MIASVSYSADPSKPKPDEVSAAQNGDASQTQPAKLAQAEKTAPAK
FT                   AVTTPAAAVKPAVSEKAEPAKAAPAATKAEDKKAAATANTVAKPVETKTATSAKQPDAK
FT                   SAVKPADKQHEVKAAAKAEDKKPVATVNTVAKPAAAEAKDARPAPTSAAAAKPAVAKKA
FT                   TVKKKSAKRYGKHHAKRLHRKHRHLHRSHKRHHRKHNHRKYKTHHASNAAQPATAAGSV
FT                   "
FT   gene            191223..191438
FT                   /locus_tag="Rvan_0157"
FT   CDS_pept        191223..191438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69447"
FT                   /db_xref="GOA:E3I5U4"
FT                   /db_xref="InterPro:IPR021265"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U4"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_1227"
FT                   /protein_id="ADP69447.1"
FT                   /translation="MNPRLRKLIGVIVFVFGSVFYFLFTISIALARLPGTELWRHLLFY
FT                   LVITVIWVVWAGILIRWMLKPRPGEV"
FT   sig_peptide     191223..191318
FT                   /locus_tag="Rvan_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.920 at
FT                   residue 32"
FT   gene            complement(191480..192121)
FT                   /locus_tag="Rvan_0158"
FT   CDS_pept        complement(191480..192121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvi:Dvir_GJ21135 GJ21135 gene product from
FT                   transcript GJ21135-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69448"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U5"
FT                   /inference="similar to AA sequence:KEGG:Dvir_GJ21135"
FT                   /protein_id="ADP69448.1"
FT                   /translation="MTLKGTMIAVIAAIGLCAGTASAAMIDAGAQKAISKNGVSTFTLI
FT                   AGHGRGGGGGGNFGGGGGGFRGHFGGGGGFRGGHFGGGFRSHGGSAPMFRAAPSGRAFG
FT                   GHPGGFKPHGQRNFSGVPHARPYGFGGQPGFGKPYYGGKRPFAGGKHPYRAGGWGNHRR
FT                   RYWRNGRWYWYGAPLIGYGIYSTYDSCYWSCINDGYGPAYCTNYATNFCY"
FT   sig_peptide     complement(192050..192121)
FT                   /locus_tag="Rvan_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            complement(192380..193093)
FT                   /locus_tag="Rvan_0159"
FT   CDS_pept        complement(192380..193093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK21628 GK21628 gene product from
FT                   transcript GK21628-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69449"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U6"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK21628"
FT                   /protein_id="ADP69449.1"
FT                   /translation="MRIRGSIFTGVLLGLAAVAAPAFAATPGSGVSATTASVADVATLV
FT                   RGEGGRGGGGGMGGGGFRGGGGGFGGGPGMGGGGFRGGGGGFGGGPGIRPGGGPGFGGG
FT                   SAFRGGGMGGGPRFSGPGVGGPRYGGPGRGPAMRGPGFAGPRYGGPGRGPAMRGPGFAG
FT                   PRYGGGPRWAGPGPRYSRNYGRRGGYWRGGRWIWYGAPLVGLGVYGYGSSCYNNCLAAG
FT                   YGPAYCSTYASDFCY"
FT   sig_peptide     complement(193019..193093)
FT                   /locus_tag="Rvan_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            193469..193738
FT                   /locus_tag="Rvan_0160"
FT   CDS_pept        193469..193738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbr:CBG03153 Hypothetical protein CBG03153"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69450"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U7"
FT                   /inference="similar to AA sequence:KEGG:CBG03153"
FT                   /protein_id="ADP69450.1"
FT                   /translation="MKKLVVAIAALTAATLASGSASALPLATTGVDASASSAIVKVGCY
FT                   KRRVVTTTSCCTTTTTYVKVVNPCGCGCGCGGNSGLFGVGFLFF"
FT   sig_peptide     193469..193540
FT                   /locus_tag="Rvan_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            193897..194250
FT                   /locus_tag="Rvan_0161"
FT   CDS_pept        193897..194250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK21532 GK21532 gene product from
FT                   transcript GK21532-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69451"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U8"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK21532"
FT                   /protein_id="ADP69451.1"
FT                   /translation="MRASFLFCVAASMFLAVEAQSLPRFDAPAASPVQTIRVSDTGRYS
FT                   GRGDLFSNWCAYNCYRVSPCAQGGCYGRYHYSQYPYDEDLPFRYRWDSDASIQDNILAR
FT                   ANPGYLRLFERQY"
FT   sig_peptide     193897..193956
FT                   /locus_tag="Rvan_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.978 at
FT                   residue 20"
FT   gene            complement(194350..195633)
FT                   /locus_tag="Rvan_0162"
FT   CDS_pept        complement(194350..195633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0162"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; KEGG: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69452"
FT                   /db_xref="GOA:E3I5U9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5U9"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ADP69452.1"
FT                   /translation="MTETTPGFATLSIHAGAQPDPATGARITPIYQTASYVFDNAEHAA
FT                   ALFGLQAFGNIYTRINNPTQSVLEARVAALEGGTAALAVASGHAAQFLIFHVLLEPGDE
FT                   FIASRQLYGGSINQFNHSFKKFGWNVVWADGNDPASFEAAVTPKTKAIFIESIANPGGI
FT                   VLDVPAIAAVAKKAGVPLIVDNTLATPYLFRPKEHGADIVVHSLTKFLGGQGNSIGGAI
FT                   IDSGTFDWLKSGRYPAISQPNPSYHGLNIGETFGNFAFAIAARVLSLRDLGPAISPFNA
FT                   FLILNGLETLPLRIERHVQNAVKVAEWLEKHPKVAWVNYAGLPGNRYHELAQRLTPKGA
FT                   GAVFTFGLKGGYEAGVNLISNVKLFSLLANIGDVRSLIIHPASTTHAQLTPEQRESAGA
FT                   GDDTVRLSVGIEDAADIIADLEQALASQ"
FT   gene            complement(195925..196527)
FT                   /locus_tag="Rvan_0163"
FT   CDS_pept        complement(195925..196527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69453"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V0"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_2075"
FT                   /protein_id="ADP69453.1"
FT                   /translation="MMDRIDETDPFKGVAMIPTFETPRLILRPTRLEDADATQALFPHW
FT                   EIVRFLSDRVPWPYPDDGALSYYRDFVLPAMEAGKLWGWTIWLKGGPDHHIGSIELRDL
FT                   NGDNRGFWLGLPWHGRGIMTEACEPVTDYWFNTLGRETLRVAKAPDNTASRRVTEKQGA
FT                   RLIAIEQRSYVGGVCASEIWELTREDWNAFRAATRSV"
FT   gene            complement(196641..197807)
FT                   /locus_tag="Rvan_0164"
FT   CDS_pept        complement(196641..197807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0164"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   scl:sce2184 putative electron transfer oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69454"
FT                   /db_xref="GOA:E3I5V1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADP69454.1"
FT                   /translation="MDAVQALRDAGQGRGGMNYDAAVIGGGPAGAALATHLARAGRSVV
FT                   VFEKEAVAHDKVCGEFLSHEGVGYLESLGLPVDELGALTLSHVRLAGTGEPVTAPLPFE
FT                   ARSLSRRVLDEALLRLASSAGAEIRRGVRVKSVTGTMNGFAFLPERGSEVFANAAFLAS
FT                   GKHDIKDFKRERGAHPECLAFKTYWRLQPEEAAALSAHIELILFRGGYAGLQPVEGGRA
FT                   NLCLIVRKDVYADRYGSWEAVLDALRHEAPHAGRRLSGAECLTERPLAIAGLPYGFLAR
FT                   SNGWLWRIGDQAAVIPSFSGDGMSIALHTAHRAAGIYLSGEGADVFQAALARDLSAQIR
FT                   RATALSRLLVSPMGQKLAMNAAYMLPRMLSFGADWTRIPPRALDRAAL"
FT   gene            complement(197756..198484)
FT                   /locus_tag="Rvan_0165"
FT   CDS_pept        complement(197756..198484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0165"
FT                   /product="3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /note="KEGG: scl:sce2183 3-demethylubiquinone-9
FT                   3-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69455"
FT                   /db_xref="GOA:E3I5V2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V2"
FT                   /inference="similar to AA sequence:KEGG:sce2183"
FT                   /protein_id="ADP69455.1"
FT                   /translation="MPDFSKRDTTPEMMDHEEVPYEEHRAVLRQLTRANELSLAYRPTL
FT                   AFFRRLKRDGRWPKDRPLVVVDAASGYGDMSRKVDRWAQENGVEARFIGVDMNPRAARS
FT                   AAEATPPGRPITWLTANLFDFRADFDVDIVMSSLFTHHLPGPELVRFIRWMEDTARIGW
FT                   IINDLERHPLPYYFLKAAFFATRQHRFMRHDGPVSVASAFKREDWQRLLAEAGLAPGAA
FT                   SIEAWTPFRLCVTRVKGAAA"
FT   gene            complement(198490..199557)
FT                   /locus_tag="Rvan_0166"
FT   CDS_pept        complement(198490..199557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0166"
FT                   /product="Naringenin-chalcone synthase"
FT                   /EC_number="2.3.1.74"
FT                   /note="KEGG: scl:sce2182 naringenin-chalcone synthase;
FT                   PFAM: chalcone and stilbene synthase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69456"
FT                   /db_xref="GOA:E3I5V3"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V3"
FT                   /inference="protein motif:PRIAM:2.3.1.74"
FT                   /protein_id="ADP69456.1"
FT                   /translation="MSVAHINKIATAVPPHQVHKAFIEFQRQILTDPRKRSIFDRLVQM
FT                   GQIEKRFSCVVPSEDHLGASINGEVFYAPGNFPSTGQRMRQYEIEAPILAERAVAQLEL
FT                   GAAKDEITHLIVTSCTGFSAPGVDLELVSRLGLNPGVERTIVGFMGCYAAINALKLAHH
FT                   IVRSEPSAKVLVVSIELCTLHFQETQELEEMMPFLLFADGAAAALISGEQKGLSMERFY
FT                   ATVMPEAADQMAWHIRDFGFDMVLSTRIPASVGEAINRAAEAILNGWTTKDIELWAVHP
FT                   GGRAILDAVEGAFRLPIDALAASRQTLKDFGNMSSATVLFVLKSVLENARSGAKGCAMS
FT                   FGPGLTAETMLFKAV"
FT   gene            199770..201059
FT                   /locus_tag="Rvan_0167"
FT   CDS_pept        199770..201059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0167"
FT                   /product="lytic murein transglycosylase"
FT                   /note="KEGG: rpc:RPC_2140 lytic murein transglycosylase;
FT                   TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69457"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V4"
FT                   /inference="protein motif:TFAM:TIGR02283"
FT                   /protein_id="ADP69457.1"
FT                   /translation="MIHRRPHKISSLFAFCGGLLCVLLAVSVALPVRAAEATQDGFRAW
FT                   IASFRQSAIDAGVKPEVYDRTTRPLTADFSLPDLDIGNRKSQGEQPEFVRTPEQYVSEK
FT                   QMANLLVKGRDLAARHEKTLADLKSRYAVDPYIMLGLWGRETAFGTQHDGYSGLRVLAT
FT                   QAYIGRRAELFQKQFIDALKMVQIGAVTPENFKTSWAGAFGLVQFMPTDYLKYAVEPDG
FT                   RKLDIWTKVPDALTALARNLHAIGWNAKEPWGFEVRAPDGVDCSLGYLDVRKPVAEWER
FT                   LGVRPLKGERFPDALRGVEVSLLQPAGIYGPAFLTTQNFQVIREYNKSDLYALYVAHLA
FT                   DRIRGQGPFAKAWERIRQVHTSDVEFLQKRLTGLGLYADTVDGKAGGRTRAAVGAYQKR
FT                   AGMPLTCWPTEAIVAHVKANAGKATLNERQ"
FT   sig_peptide     199770..199874
FT                   /locus_tag="Rvan_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            complement(201094..201870)
FT                   /locus_tag="Rvan_0168"
FT   CDS_pept        complement(201094..201870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0168"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rle:pRL90175 3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69458"
FT                   /db_xref="GOA:E3I5V5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP69458.1"
FT                   /translation="MELDGKIAIVTGAAGGIGLAIAKRYVDAGARVAIADVRLDAAEQA
FT                   ARSLGGPDKAIALEMDVTSEDAVNAGVAKTVETFGTVDILVSNAGVQIVHPVEDFPYAD
FT                   WKKMLAIHLDGAFLTSKACLPHMYKQNSGTIIFMGSVHSKAPSALKSAYVTAKHGLQGL
FT                   ARVIAMEGAGHGVRTNVICPGFVKTPLVEKQIPEQAARLNISEKEVVERIMLGQTVDKE
FT                   FTTMEDVAEVALFFAAFPTNALTGQSLVVSHGWFMN"
FT   gene            complement(202038..202919)
FT                   /locus_tag="Rvan_0169"
FT   CDS_pept        complement(202038..202919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0169"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: rpt:Rpal_5167 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69459"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V6"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADP69459.1"
FT                   /translation="MITSRLLPSRRAFGLLAVFFCVVFAVTVLAAEGNPEATDKADNAQ
FT                   KLRDIQVGPKPDWSWLPQLRVLTEADYPPFNYYDEEGRLIGFNIDLARAICRELSIDCD
FT                   ISAAEWSTLVPSLKANEADAVIASMAINGKTIADVDFTNRYYMTPARFVGRTGALFREV
FT                   SVEALKGEKVAVVRGSAHEAFLRDFFDGAKIMSFDTAADARGALKAGDVDLLFGDGISL
FT                   MFWIQGTDANRCCEFKGGGYTEARYFGDGIGIAVKKGNTRLREVLDYALARVKASGRYE
FT                   ELMLRYFPLPLY"
FT   sig_peptide     complement(202827..202919)
FT                   /locus_tag="Rvan_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            203006..204937
FT                   /locus_tag="Rvan_0170"
FT   CDS_pept        203006..204937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0170"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pla:Plav_0424 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69460"
FT                   /db_xref="GOA:E3I5V7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69460.1"
FT                   /translation="MDLAPHAFVPYEWKHTPSEIGHASGSSGTRTNSDAAVIDIERDFL
FT                   VDLGASPDQIRRLENDAARARVSLVQAAVAQGAIRASDLTARLSRSLDLSEPAAGEATR
FT                   LPEAPDEAWRLFDTPVRLSARAGRMIAVNGETYSPTALAALAQRLGAKRERVMLMTRQG
FT                   LIDAVTRSHGSAMVETAVRGLLMARPDWSAKAGLAAWQLYFATVAVGLVLGAVAFAPAE
FT                   TLTLASAMLSIFFLLTIALRAAAAVNIALPRPKAKEARLLGDAELPRYTVLVPLYRETA
FT                   ILPHLAHALASIDYPAAKLDIKIVLEASDRDTIEAAQKLAFPGNVDLVVVPDREPRTKP
FT                   KALNYALHFASGEFVVIYDAEDRPEPDQLRKAATVFAQAPADLVCLQARLDYYNARENW
FT                   LSRQFTIEYATLFRGLLPLLARFRLPLPLGGTSNHFRAAALREIGAWDPYNVTEDADLG
FT                   MRLARAGYRTGTLESTTWEEACCRPMPWLKQRTRWLKGWMQTFGVHMRRPREAMSELGV
FT                   AGFLSFHAYFAGIIVSALAHPVFYILMLYEVLQGRLFAGEGAMENLLLWIAAVNFVGGY
FT                   AANIALSAFAVAGTRHRHLMLHVMFIPVYWLFVSAAAYRALWQLFHAPFHWEKTEHGVS
FT                   RLARPFPA"
FT   gene            205065..206036
FT                   /locus_tag="Rvan_0171"
FT   CDS_pept        205065..206036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69461"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V8"
FT                   /inference="similar to AA sequence:KEGG:Xaut_4854"
FT                   /protein_id="ADP69461.1"
FT                   /translation="MTIKGNDARLPPQANPRCLRPILPVEVVAGYVASRRDGCPQAEAL
FT                   DALAEFSLAEPALIDAIEARLVAEDSGVLRAAQPTSATWPETRRALALKALGAAEAAKG
FT                   LRARADLGAVALRTLYGLEMRTVSPSRGEVRCELLRQILLALGDRFTIHLLRPQRSFSF
FT                   DPMSRRIYLAFAGLDSGTVLEADAALLSCAFKGPAGTLAELSATLIRGALKAGDNGAAE
FT                   TKGAFRLDGFADSVRKLALHLETRPYTGRVAIAQVYDAGLAAGLALGTLDEFKQHLAEA
FT                   AREGLLDLERYDIAGPLDPSLKERSRLRLGRDERHFIVNQWM"
FT   gene            206047..209100
FT                   /locus_tag="Rvan_0172"
FT   CDS_pept        206047..209100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69462"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5V9"
FT                   /inference="similar to AA sequence:KEGG:Xaut_4853"
FT                   /protein_id="ADP69462.1"
FT                   /translation="MDLRLKAFESPEFDRVFSAVASLAGAADEERLDVAEIETDADTGL
FT                   SSIVAQARAQNPDPASRVMLIKGATGTGKTHTLLTAIRRMHQKGGVYAALFPMVDLVSE
FT                   KDLDAWLLRAIVSRLSERYLVDAGAPSPLTRLAASLLQRGDPALVTQFCREVLDEHGDI
FT                   RDFDLRPLIVSIRAALQRESHLPVPSEAFVTALLGAAAGDDESFAYLRGQPLNVSVGGV
FT                   RLMQGVEDYVPRGHIDALVNVIGATGGTLFLAFDQLEQSRVAGWEQRLRHLFSRGALLA
FT                   ETLPPLAVAYAVLPALYDTIADGIDGSIRDRLERFGAMPVRLKPLGRRQAESMLRRRLS
FT                   ELFARTGAKIDPAEPLYPFPAWMIDELGAQTPRYVFELIQQFRRVYLQIGRVPDIDDMP
FT                   PPPSPILETPVVLAPAAPAINFDDKWHGELTSRVVQPSVGNGLQQAEILEWAVQACAPE
FT                   IEGVNAIKTRRSVRGRTGTVVIEADFQKDGQSVERREIALCNEGRGAPLAEEIRNFLRS
FT                   VNGARPVIVRPRGGRLPKTGRFIAPLLREADDMQGIVVPQFEMLCWERLDSARHFFRMC
FT                   KDLPGFEDWQRESRPLTKAISLWDIVQFPYVGAPAEDEDESAAEKEKAAPKEAAPPPPP
FT                   PVPRRRQPSAPAVMLGAHEDGGPIHWAPFETEAKLLNFGILVTGDPGSGKTQTLNVLID
FT                   GVASLGYPICIFDFKNDYSERSFVQAIGLKVHDVRRFGIPFNPLMPSPSDDGLAQPIEH
FT                   IFTITGVLKRVFGLGDRQTAVLRDAMKEAFERRGINPQRWVEAESIRPPSFDDVVAILE
FT                   EQKEAKNPQAISLLDRIAPLFELGLFPKSDELPVPFEAMLDERLVLSLFALPTDEIKAA
FT                   LAELIIIRLHGVLLRRVQPRKLTRLLVVDEAWRVANSSHLESLAREGRAFGAGIAIGTQ
FT                   YPGDLPPDLSGALDTKIYLKNQQPDHKKAVVRALCGANSGPEAAHLHGVLERLTQFEGL
FT                   IQNQHYLPYARFRLLPYFMRTAQSTKAA"
FT   gene            209335..210066
FT                   /locus_tag="Rvan_0173"
FT   CDS_pept        209335..210066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69463"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W0"
FT                   /inference="similar to AA sequence:KEGG:blr1149"
FT                   /protein_id="ADP69463.1"
FT                   /translation="MLAATLARDATALLHDSGASRILLGGKSFVADPSGALYWPAENTL
FT                   IVADLKLSQCSYLEGEDVVLPPYDQTSAFEKLEDAIDRYDPLRVVALGNSFAVHSSCAL
FT                   AHHQRDWLQDMMEGRDWYWVTNDLTETPDVGGTLVPQLVLGGVKFRGEPVRAPIANEIA
FT                   GGLHPVAQVSQYGHLVRGRCFVSNGMRMVLPSLGDYSAGNNVLNTAFDPLLGQGGLYVW
FT                   FIAHERVNPVASPQLMEDRAA"
FT   gene            complement(210124..210930)
FT                   /locus_tag="Rvan_0174"
FT   CDS_pept        complement(210124..210930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0174"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: hypothetical protein; KEGG: pde:Pden_2733
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69464"
FT                   /db_xref="GOA:E3I5W1"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W1"
FT                   /inference="protein motif:PFAM:PF09608"
FT                   /protein_id="ADP69464.1"
FT                   /translation="MFSGVAAIARKQTPAIVAAALALIAFSGSASASANIIEAGAAQNQ
FT                   FYIEPSYDGTSIVLFGAVDRDRLKGEPFDIAVTLRGPVQPVVVWKKDRRAGLWVNSQRL
FT                   IFDGVPNYFAVLSTRPLDDIAPLAERDKYELGIDVLSLPIRDEQKNAPSKLDRSEFEAA
FT                   LVRQKKAARLFLEEARAIDFFGVSLFRTKTFLPAAAGPGLYVAHFYVLQGGKVIGDATA
FT                   RIRLRKIGIEARLSSTASEHPWLYGVIAVALAAVVGGATSFLTRRT"
FT   sig_peptide     complement(210832..210930)
FT                   /locus_tag="Rvan_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 33"
FT   gene            complement(210932..211846)
FT                   /locus_tag="Rvan_0175"
FT   CDS_pept        complement(210932..211846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0175"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   oan:Oant_4039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69465"
FT                   /db_xref="GOA:E3I5W2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W2"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADP69465.1"
FT                   /translation="MQVYLPIAEMPVNVLLMLGLGGAVGFLSGMFGVGGGFLMTPLLIF
FT                   AGIPSAVAVATGANPLIASSITGTIAQARRKNLDTKLGLYLLGGGAVGAFWGVLIIRYL
FT                   RQIGQVDLFVSLLYVVFMGAVGSIMLVESLRALRKVRRGQPAAKRTGRHGWMHGLPFKT
FT                   RFPASKLYISAIPPVVAGVLVGVMSGVMGVGGGFILVPILIYLLHVPTNVAVGTSLFQI
FT                   IFVSAITTVFQAAMNQTVDIALALLLMLGGAFGAQIGAAAGQKLRAEELRLLLALLVLA
FT                   VGLRLGVDLVLPGEIFSVRSAGF"
FT   gene            complement(211968..214145)
FT                   /locus_tag="Rvan_0176"
FT   CDS_pept        complement(211968..214145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0176"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: met:M446_3098 Sel1 domain-containing protein;
FT                   PFAM: Sel1 domain protein repeat-containing protein; SMART:
FT                   Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69466"
FT                   /db_xref="GOA:E3I5W3"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W3"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADP69466.1"
FT                   /translation="MAGQDNVKKGRLENGDLDVENTRDKRAAWDIALDGDSSATFRGDN
FT                   ATSPAERSPNQEQTAPSALDDGGDAETQLYAYLERMRAPRPKGFPPMDELTSRLGEFSM
FT                   LPPAAAAHSEPHARAGAASAPRQTAELAWFEQKFTELKSAFARQEADKSEIVSINEKLA
FT                   EIIARVDRLADAMPGEQTMVAVETKLQDLSRSLDATRKQTASDAERIARAAKEILAATG
FT                   RAEVARQGFEAAARHTVKELGQTVAVAASRAAVVTAEHIAAALHETGDVGGIGRVENEL
FT                   RALNAQSRETGDRTAAALERVHDTLRMFLERDQLGERIHAGITAPAQPASAPTQKRRAG
FT                   VHMPIASGAPAYTRPDAEFGTEPTQKPQLGSITSRSAPRADANLLRALEEADRRMLAGG
FT                   YQAGADENPKQPQPASKAPLFSEEDKTLPLIGLSIVAIVLLIASAVLYYLHSQAKRPAA
FT                   QMPVTEQTDIALAATPPETQPLLAPKTSNANAQHRAAASKSAGTTHFLPSLLSASDQDG
FT                   EPLKNEDLQELTNAASRGDREAQFRIASRFLREENGQSDPATASRWLARAAEQGHAESQ
FT                   FVLASLYERGAGVPKNEDQAVGLYRRAAAAGHVRAMHNLAVLLTAHETPDDYKQAAALF
FT                   TAAAQAGVTDSQFNLALLYERGLGLAKDYQKAFFWYEVASREGDKDAIRAAERVKHLLT
FT                   AVEMQAAQEKAGTWQPLVQQSPRVANGAGRG"
FT   gene            214871..215230
FT                   /locus_tag="Rvan_0177"
FT   CDS_pept        214871..215230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0177"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rhi:NGR_c28760 putative two-component response
FT                   regulator transcriptional regulatory protein; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69467"
FT                   /db_xref="GOA:E3I5W4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP69467.1"
FT                   /translation="MFTILLAEDDDSMRRFLSKALERAGYEVVSYDNGADALKGLKEKR
FT                   VTLLLTDIVMPEMDGIELAKRGAELDPEMKIMFITGFAAVALQHYNEAPEKARILSKPI
FT                   HLKDLVREVDRMLAA"
FT   gene            complement(215251..216414)
FT                   /locus_tag="Rvan_0178"
FT   CDS_pept        complement(215251..216414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0178"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   KEGG: sat:SYN_00323 M50 family membrane endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69468"
FT                   /db_xref="GOA:E3I5W5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W5"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ADP69468.1"
FT                   /translation="MFAARFNLFTLLGFRVVIDVTWFFLAFYLVVTLASRYFPGVVPHQ
FT                   NSYMYVVMGIAGAAGLFLSIVLHEMAHAYTARRFDLPVGDITLFIFGGVAEIRQEPQTP
FT                   RAEFWVALMGPVASVGLAALFYALMVESGPAHPAASGVFSFLALANTMLALFNLAPAFP
FT                   LDGGRILRSLIWWRTGNLRRATRISAAGGSVFGAFLVVTGLLQLVNGNMMGGTWLLLIG
FT                   LFVAAAASQARGITNAAENLRGVRVDDLMERNPVTVAPDLTVERLVRDTIYPQNRKFVV
FT                   VTEASRAFGFIGPEQIRRVPESQWSETYVRAITEPFTFGTVVSPTATAFEALRKLQANS
FT                   CRHLAVLEGTTLLGTVSETDFLNYVTLREELALPKKVAAREPATSER"
FT   gene            216682..217293
FT                   /locus_tag="Rvan_0179"
FT   CDS_pept        216682..217293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0179"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: met:M446_0481
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69469"
FT                   /db_xref="GOA:E3I5W6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W6"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADP69469.1"
FT                   /translation="MSSRATNAPFTLFELSGLKPRPPRLSEAVVILIDAQNVYRAGPLR
FT                   LDGIDEAVERAVVLLAEARRAGAKIVHIAHRGPAGSPFDRATESGAFMPDLAPLPGEAV
FT                   VEKTLANGFHGTNLAEHVGDAGAKIVVAGFMTHNCVSSTARAAFDHGYEITVAADASAT
FT                   RDLPLGGEVVPAKVLHEAELAGLGDRQACIATVAEIIAAQ"
FT   gene            complement(217287..218300)
FT                   /locus_tag="Rvan_0180"
FT   CDS_pept        complement(217287..218300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0180"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="KEGG: cytochrome d ubiquinol oxidase, subunit II;
FT                   TIGRFAM: cytochrome d ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome bd ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69470"
FT                   /db_xref="GOA:E3I5W7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:E3I5W7"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ADP69470.1"
FT                   /translation="MGEIAYWLPLVWAALIGIAIVMYVLLDGFDLGIGMLFLSGTSEEE
FT                   RDHMMNAIAPYWDGNETWLVLGGAGLLVAFPLAYGTILPALYIPIFVMLLALVFRGVAF
FT                   EFRFVSKPHHAWWDRAFSLGSTVATFAQGVVLGGFMQGINIQNREFAGGTFDWLTPFSL
FT                   LCGVGLMAGYILLGSAWVMMKTDGDLARRAQRHAEWALYATLFFVAAVSLWTPLMSDHI
FT                   AERWFRGEHIVWLWPVPFLTAVTALVTYRGARKGSGLQTFLGGMTLFLLCFLGLGISVF
FT                   PYLVFPSITLWEAAAVPESQIFSLIGALLFLPLVLGYTAFVYWTFRGKVTEGAGYH"
FT   gene            complement(218370..219764)
FT                   /locus_tag="Rvan_0181"
FT   CDS_pept        complement(218370..219764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0181"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: cytochrome bd ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69471"
FT                   /db_xref="GOA:E3I6B0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B0"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADP69471.1"
FT                   /translation="MDFGLDATLLARIQFAFTVTFHIIFPAFTIGLASYIATLEAIWYF
FT                   RGDDRYHRLARFWTKIFAVSFAMGVVSGLPMSYQFGTNWSRFSVTTGNVIGPLLGYEVM
FT                   TAFFLEATFLGIMLFGWNRVPRGLHFFSSCMVAFGTLLSAFWILSANSWMQYPTGHEVR
FT                   DGIVVPVDWIAVIFNPTFPHRFAHMVTAAYITTAIVVLSVGARYWLANRYADESRVMVR
FT                   MALAMILILAPLQAFIGDQHGLKTAQYQPAKLAAMEAHWDGTKPAALVLFALPNAKTES
FT                   NDYEIAVPNLGSFIITHDWNGLFPGLKQFKPDDRPPLYMPFFGFRLMVAIGLWFIVLAC
FT                   VGGFLWWRGRLFQNRAFMRAAAWSWPLGFVAVVAGWITTEVGRQPWIATGLVRTSEGVS
FT                   PVASGAVGTSLILFFFVYLIVFSAGIVYINRLIHKGPVLQAPEGLDEGTPARPISAATE
FT                   TRRGSA"
FT   gene            complement(219878..220021)
FT                   /locus_tag="Rvan_0182"
FT   CDS_pept        complement(219878..220021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69472"
FT                   /db_xref="GOA:E3I6B1"
FT                   /db_xref="InterPro:IPR021446"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B1"
FT                   /inference="similar to AA sequence:KEGG:Snov_4005"
FT                   /protein_id="ADP69472.1"
FT                   /translation="MNGIPLQPIIAILAGILILLRPSLLNYVVAIYLILVGVLGLVGSR
FT                   RF"
FT   gene            220208..220282
FT                   /locus_tag="Rvan_R0002"
FT                   /note="tRNA-Val1"
FT   tRNA            220208..220282
FT                   /locus_tag="Rvan_R0002"
FT                   /product="tRNA-Val"
FT   gene            220916..222124
FT                   /locus_tag="Rvan_0183"
FT   CDS_pept        220916..222124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0183"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: rce:RC1_0101 molybdopterin biosynthesis
FT                   protein MoeA; TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69473"
FT                   /db_xref="GOA:E3I6B2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B2"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADP69473.1"
FT                   /translation="MPEESGSRVYVPVDEALAKILADVEPVTAENVSLLDAGGRVLAAD
FT                   LAAKLTQPPFDASAMDGYAVRVADIAAAPARLAVIGEAAAGHGFAGTVGQGQAARIFTG
FT                   APVPAGGDAVIMQEAAREAGGVVTVLEGVPPGAHIRRRGYDFREGEIMIGAGETLNARK
FT                   VMLAAAMNHGSLPVRRRPVVAVLATGDELAEPGAELLAGQIVSSVPAGLSAAIAAWGGE
FT                   PSCLAIARDTRESLDAAISAARDADILVTIGGASVGAHDLVQGALEAAGARFEVMRVAM
FT                   RPGKPLMSGRLGRQRVLSLPGNPVAALVCARLFLKPLLDRMLGRASDDTVDEAPLAVAL
FT                   AANGPRQHYMRARREHGAVTPLGDQDSSLVSVFAAADCLIVHAPHAAALDAGSVVPIIP
FT                   LDF"
FT   gene            complement(222140..222451)
FT                   /locus_tag="Rvan_0184"
FT   CDS_pept        complement(222140..222451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0184"
FT                   /product="ETC complex I subunit conserved region"
FT                   /note="PFAM: ETC complex I subunit conserved region; KEGG:
FT                   pla:Plav_2976 ETC complex I subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69474"
FT                   /db_xref="GOA:E3I6B3"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B3"
FT                   /inference="protein motif:PFAM:PF04800"
FT                   /protein_id="ADP69474.1"
FT                   /translation="MHMIARIYKPAKTAMQSGLAKAKDWVLDYEPATAREIEPLMGWTS
FT                   SNDMLSQVRLFFETKEEAVDYAKKNAIPYRVFEPNPRAAIKKSYADNFKYGRIGSWTH"
FT   gene            222531..223505
FT                   /locus_tag="Rvan_0185"
FT   CDS_pept        222531..223505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0185"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   tmz:Tmz1t_3455 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69475"
FT                   /db_xref="GOA:E3I6B4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP69475.1"
FT                   /translation="MTILVTGAAGFIGFHVAKALLARGEAVVGFDNINSYYDPSLKHAR
FT                   LEHLAGERAFTFVKADLADADAVRDTFARFEPRRVVHLAAQAGVRYSLQNPQAYLDSNV
FT                   IGLLNILEGCRAHRPEHLVFASSSSVYGLNTKLPFAEADKTDAPASLYGATKKSGELMA
FT                   HAYAHLFNLPMTGLRFFTVYGPWGRPDMSPIIFTKAIIEGRPIDLFNNGDHARDFTYID
FT                   DIVDGVLRVVDMTPVAGASGPAFEIYNIGHNEPVPLNDFVACIEDAIGKKAIRNLLPMQ
FT                   PGDVPETHADIERLAAATGFRPTTPIEVGIPRFVRWYRDYYQV"
FT   gene            223630..224409
FT                   /locus_tag="Rvan_0186"
FT   CDS_pept        223630..224409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0186"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rru:Rru_A3441 PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69476"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B5"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP69476.1"
FT                   /translation="MSFSNWPEGRPNSGERSRGKCDEGRGCDRQEGRGWFARARGRFAA
FT                   HAGSEQAGEREFGGAWRSHGGRFDDIAARRYIEGGDGLFGHHDRRGGSRHGGDHPFGGR
FT                   RGRHGRPLEQGDLRWLVLDLIGEQPRHGYEIIKAIEDAFNGAYTPSPGVIYPTLTLLEE
FT                   TGLIVGETQGAKKLYSLTDQGRAELAARVQEVTAVRGRLEEARARFGANPAPEMIRAMD
FT                   NLRAAVQVRLSKGPLSPEAVQVITGALDRAASEIERS"
FT   gene            complement(224419..224979)
FT                   /locus_tag="Rvan_0187"
FT   CDS_pept        complement(224419..224979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0187"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: rpt:Rpal_2510 flavin reductase domain protein
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69477"
FT                   /db_xref="GOA:E3I6B6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B6"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADP69477.1"
FT                   /translation="MTRHPKKLDFPVSQVRRYLEPGPIVLVSSTWQGKTDVMTLGWQTV
FT                   MEFSPSLVGLMISAGNHSFELIRESRECVINLPTTALTDIVVGVGNTSGADIDKFAHFG
FT                   LTAEPASEVGAPLIAECHACFECRLHDDALLDSYNFFIFEVVKAHVAPSPKHPETLHYL
FT                   GGGEFMVSGKIISRRSQFRPEML"
FT   gene            complement(224976..226070)
FT                   /locus_tag="Rvan_0188"
FT   CDS_pept        complement(224976..226070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0188"
FT                   /product="Protein of unknown function DUF2252"
FT                   /note="PFAM: Protein of unknown function DUF2252; KEGG:
FT                   msl:Msil_2675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69478"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B7"
FT                   /inference="protein motif:PFAM:PF10009"
FT                   /protein_id="ADP69478.1"
FT                   /translation="MAFLRRNADYETWLRTQCDVVDADLDKKHKRMAESPFAMLRATYF
FT                   RYAAKVEKLLPDLADAPHVLAVGDIHVENFGTWRDAEGRLIWGVNDFDEAAVMPYPFDL
FT                   VRLCASAGLSPDLGHHEHAADAILAGYERGLAEPAPMVLDADASWLRPFVSPTEKTRAD
FT                   FAKDTKTLLDFDPPGDVKAGFAESFPEGAVIEGYAPRAKGGGSLGRPRFIAVATWRGGR
FT                   IVREAKALVPSAWDYAHKKEGWPPRFRELADGPFRAPDPFLDIRGRYLFRRIAPDSRKL
FT                   DFGGEIPKRLQGLFLEAMGHDIGAIHAASVQAEDIAAHLKARTEGWLRDGAMSLSARVL
FT                   KDFKAWQAACKPEPAPPKVGKTKK"
FT   gene            complement(226169..226756)
FT                   /locus_tag="Rvan_0189"
FT   CDS_pept        complement(226169..226756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_4237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69479"
FT                   /db_xref="GOA:E3I6B8"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B8"
FT                   /inference="similar to AA sequence:KEGG:Nham_4237"
FT                   /protein_id="ADP69479.1"
FT                   /translation="MAESDVETRAHAEAAEQRSSHVLYKAIPQVVVLVLTLIGVAYTSM
FT                   TRQALVGYWEFLALITGLVCIISGWPHARTRPERVRLVWTQALHWTAFLVAMNLLLISD
FT                   VQRMLSTDATGLAILLLLALGTFVAGVHTLSWQTCVLGLVMALSVPAIAWIEESALVLV
FT                   FVLLMLLVVGGVILTTARRGRGRDDSLGEEAL"
FT   gene            complement(227525..228049)
FT                   /locus_tag="Rvan_0190"
FT   CDS_pept        complement(227525..228049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69480"
FT                   /db_xref="GOA:E3I6B9"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6B9"
FT                   /inference="similar to AA sequence:KEGG:RPB_0499"
FT                   /protein_id="ADP69480.1"
FT                   /translation="MSYNSATAAGERASFDARSAAIVIAAVSIISLAAAWLFELYGYKP
FT                   CPLCLEERVPYYAGIPGGILAAWFATRAPRIAVVILAAIALAFLYNAGLSVYHAGAEWK
FT                   LWPGPDTCASDGTFKPGALLQSLRSNAVVRCDEAALRIWGVSLAGYNVLISAALAAVAA
FT                   FGIWRSRTRKR"
FT   gene            complement(228039..228620)
FT                   /locus_tag="Rvan_0191"
FT   CDS_pept        complement(228039..228620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0191"
FT                   /product="DedA family protein"
FT                   /note="KEGG: rpd:RPD_0978 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69481"
FT                   /db_xref="GOA:E3I6C0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C0"
FT                   /inference="similar to AA sequence:KEGG:RPD_0978"
FT                   /protein_id="ADP69481.1"
FT                   /translation="MLRRLYEKTMRLAEGPNALLALVLVSFAESSFFPIPPDALLIPMV
FT                   LAQRERAFKLAAWCTAASVVGGIVGYAIGALLYDTLGKWIIDFYGYGQNMDAFRATYAE
FT                   WGAWIILIKGLTPIPFKLVTIASGFAGYDFWLFVLLSIITRGIRFFLVAGLLHIYGEPI
FT                   RNFLERRLELVTAGFAAVIVSGFLIVRYVV"
FT   gene            228761..229870
FT                   /locus_tag="Rvan_0192"
FT   CDS_pept        228761..229870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0192"
FT                   /product="ribulose bisphosphate carboxylase large chain"
FT                   /note="PFAM: ribulose bisphosphate carboxylase large chain;
FT                   KEGG: rpc:RPC_2184 ribulose 1 5-bisphosphate carboxylase
FT                   large subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69482"
FT                   /db_xref="GOA:E3I6C1"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C1"
FT                   /inference="protein motif:PFAM:PF00016"
FT                   /protein_id="ADP69482.1"
FT                   /translation="MSRLSVTYHVRGDAASIEARAAAIAVEQSVEMPLDAIADAGILRD
FT                   IVGEVQAIREAEPGLFEVRIGLAVDTTGYEAGQLLNMLFGNSSIQPDVTLVDAEIPEAM
FT                   AEAFGGPNVGTEGLREKVGAGARALTCTALKPQGLSPDELAALAARLAGGGIDFIKDDH
FT                   GLADQIYSPFADRVRAVASALRETNAKTGFRTLYAPNVSGSFDQAADQIALAEAEGIEA
FT                   VLIEPMLIGVSNFHRLTRLFPNVAFIAHPAMAGAARIAPPFLLGTLFRLFGADVTIYPN
FT                   YGGRFSYSPETCRAIAETARRPWADLKPCCPSPAGGMTLQRVDELLDFYGADTMLLIGG
FT                   SLLAARERMTEEAAAFQARVVRHFEGLHE"
FT   gene            229867..230334
FT                   /locus_tag="Rvan_0193"
FT   CDS_pept        229867..230334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0193"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69483"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C2"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADP69483.1"
FT                   /translation="MTERERSNIRQASDNGFRWDGVDILAYKEEGAAPFKAITRQVLFQ
FT                   RPELSCELRYFEMAPGGHSTFERHEHVHGVMIFRGRGLCLVGEEVREVAAPDLVFIPPM
FT                   TWHQFRANAGEPFGFLCMVNAERDKPQLPTPEELAELKKNPAIAAFFAEAD"
FT   gene            complement(230346..231371)
FT                   /locus_tag="Rvan_0194"
FT   CDS_pept        complement(230346..231371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0194"
FT                   /product="poly (3-hydroxybutyrate) depolymerase"
FT                   /note="KEGG: bid:Bind_2068 poly (3-hydroxybutyrate)
FT                   depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69484"
FT                   /db_xref="GOA:E3I6C3"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C3"
FT                   /inference="similar to AA sequence:KEGG:Bind_2068"
FT                   /protein_id="ADP69484.1"
FT                   /translation="MAVAASALAAAACTTTTADSLPALKADISKQTVSGLSSGGYMAGQ
FT                   FQIANSSRVFGAGIVAAGPFGCAMSAGAKAIPFFPAALALNTAQAQNGCMADYLSSLGV
FT                   LDASRLLAQARKLADAGSIDPLSNLKASKIYLFSGANDRTVALAVVKAARDFYLAAGVP
FT                   EANIDFVSRGPGGHAFSTAMAGNACETTEPPFVNNCKYDQAEAILRFLYGSLEPKGAAA
FT                   EADFTVFDQRRYASSDATMANEGVVYVPPACRDGGCRVHVVFHGCRQTRALVGDALTKG
FT                   SGFADWAATNRLIVLFPQVQASSANPNACWDWWGYTGLDFLTKNAPQMKAVSAMVEALG
FT                   K"
FT   sig_peptide     complement(231315..231371)
FT                   /locus_tag="Rvan_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.775 at
FT                   residue 19"
FT   gene            complement(231395..233068)
FT                   /locus_tag="Rvan_0195"
FT   CDS_pept        complement(231395..233068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0195"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; KEGG: mar:MAE_03780 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69485"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C4"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADP69485.1"
FT                   /translation="MAAASILIAAVLTFGIGGAAMAAPDKTALKAQEGSSALLRGRYDL
FT                   AVSAYDEALREAGLPPARQATILSDRGVAKWRMKQLDDAAADFTKAVSLNPDYALAYNN
FT                   RGNVFLEMNRPDDAFRDFDRAVALSPDFGAAYANRANASQKLNHPDVAEKDFRKAIELM
FT                   PASSIPLNGCGRIAAGEGRLYTGLRYLNRAITLNAQFAPAYHNRAAIYAALKRNDEAAQ
FT                   DLDKVIALAPDNVALYVARGQAHAKEKRWQPAFRDFSKAVELASDNVPALIGRASQNLE
FT                   RKRADLALDDLNHAISLDANAAEAYFWRGQAKYGTGDVEGADADLSKALELAPAYADAY
FT                   RFRGSYRERGGRRDEAIADYRKALELDPLNRDLRDGYKAASGETADAVVKPLAPAVDGW
FT                   EVYRSATGHYTALNERYPKMPVMLETQGAAPAEILEWTPLKETLAGIGLLRYRSGEKGG
FT                   IPHEFVAIIDLSRAQVTGIEPYITGDAKSKWAWTQYGVTVTDTDGLSSVYDLRKPRQEM
FT                   PQQAARRDENPWSTVFGGGGGGGGGGGRRGGPSIFGWLFR"
FT   sig_peptide     complement(233000..233068)
FT                   /locus_tag="Rvan_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.986 at
FT                   residue 23"
FT   gene            233162..234538
FT                   /locus_tag="Rvan_0196"
FT   CDS_pept        233162..234538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9166 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69486"
FT                   /db_xref="GOA:E3I6C5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C5"
FT                   /inference="similar to AA sequence:KEGG:mll9166"
FT                   /protein_id="ADP69486.1"
FT                   /translation="MAHRNIPILRGLALGLALIAAEPCLATGATEYSGVAFATEASPEA
FT                   GASRDLTGQRVKTAQNNGESGNESTAEAQKKLKQELDRLRRPPRDGWATTTPTTQQKPP
FT                   QPQKPTPTAPTEAQPKPKRPPTTNTTAQTPQKPKPAAPAVAPIAAPLPIGPAIDPAIDR
FT                   AAGKVLFLRFSGTTPNDGGSKAMRAMLQTGQIAGVMFSRQNIASKAQLRDLVKFLWQGN
FT                   AAQRPYFAIREIGGKDDALPQLKEFEAWPSPSDIAGRGDPEYAYSTYRSLGFNLAHLGF
FT                   NLNFGPALSPSGAAADPSSFGANPLQSGVFAKTFILGHKDTNVIPVPVVDQSELSVRAL
FT                   KSLLVAYPGTPVAAVIGDETASLSVYETLVRGPRFCFLTMTAGAAETVSSFAKGCDVLV
FT                   VDGGKESPAATRAALAAAIADAVNNGTLALADLQASAQRLSTLRGSTASISNGFTTTAQ
FT                   "
FT   sig_peptide     233162..233242
FT                   /locus_tag="Rvan_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.817 at
FT                   residue 27"
FT   gene            234604..235668
FT                   /locus_tag="Rvan_0197"
FT   CDS_pept        234604..235668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0197"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mag:amb0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69487"
FT                   /db_xref="GOA:E3I6C6"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69487.1"
FT                   /translation="MATIAILHANHNHPAYTGASLRAGAVAGTESSAIYLAEALARRGH
FT                   RVFALNRLKASSVENGVTWLPLESRTSLPPVDFAIALNSDRLYWGFKARHKLTWLHTPP
FT                   TLGKFLKRRNALALLWHRPTAVLLGGYHASTLDPRVLYRRRVEIAHGVADMFFAPEPDA
FT                   EPRAPKAVFCSRPSRGLDFVARLWPSVHATVPDAELHVFCPQSSLDEAAARIGGSAPGI
FT                   RLRGGVARSELAAELRTARVMLVPGDPDETYCLAAAEATASGVPLVTLGIGALKERLRD
FT                   GETGFLASGADDFARHAQNVLTDDALWLRLNRGCVAESALCRWDDRAAEWERLFVALDT
FT                   RDAPALEPFLVAAR"
FT   gene            235719..236111
FT                   /locus_tag="Rvan_0198"
FT   CDS_pept        235719..236111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0198"
FT                   /product="inner membrane protein"
FT                   /note="KEGG: bid:Bind_0501 inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69488"
FT                   /db_xref="GOA:E3I6C7"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C7"
FT                   /inference="similar to AA sequence:KEGG:Bind_0501"
FT                   /protein_id="ADP69488.1"
FT                   /translation="MTTELTMLVWTIVLAIVQIGLFSIARTAQYGAKWNMGARDDKQPP
FT                   LNPIADRLGRAQANLYETLPLFIAAVLIAHVAGRENATTALGAQLYFWGRVVYVPLYAF
FT                   GVPYVRTLVWGVATAGLLMVLWPLIG"
FT   gene            236393..237523
FT                   /locus_tag="Rvan_0199"
FT   CDS_pept        236393..237523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0199"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69489"
FT                   /db_xref="GOA:E3I6C8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C8"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADP69489.1"
FT                   /translation="MDNTIRLSPHATFWVVIVALATMGLMVFSDVLMPFAAGFVLAYLF
FT                   QPLVERLNRIGVHRGAAAFAIIAVLSLIFIAIFALLIPPLVDQLRQFAQDLPVYYQRAR
FT                   AYLWENYPQYLRSLQSTVQQQEGGAAGQAQDVAGMVAGYLKGLAESSLAFFNTLALLFL
FT                   TPIVTFFLLRDWDQMFASIDSLLPKRDAPTIRKLAGEVDDTISGYLRGMFIVLSILSIF
FT                   YMVTLGLIGLNYGLLIGLFAGIISFVPYLGSTSGLLVAGGVALAQFAPDYSMVALVIGV
FT                   FIFGQIIEGNVLTPNIVGNQVRLHPVWLLFALVAAGYLLGFTGLLISVPLAAVIGVLVR
FT                   FAIRKYQESEIYGEENSEAAEEAVEGAKPQRSAAIG"
FT   gene            237533..238231
FT                   /locus_tag="Rvan_0200"
FT   CDS_pept        237533..238231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr7968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69490"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6C9"
FT                   /inference="similar to AA sequence:KEGG:mlr7968"
FT                   /protein_id="ADP69490.1"
FT                   /translation="MSAQLVLDLPRRFAYDEADFFVTARNDRAFGLVCQWPDWHAPAAV
FT                   IWGPPQSGKTYLAHIWQARANAAFADPAALEGHVWAARQPLVLEDVDASALPETALFHH
FT                   LNLAREHGSFILLTARTPPGSWRIALPDLRSRIRSYPTAEIQPPDEEHLAALLLKHFSD
FT                   RGIEIAPDVIAYLVQRIERSMAAADAVASLLDKAALAERRRITRAFAAKVLKTVSGGSD
FT                   EADDEPDANF"
FT   gene            238486..240711
FT                   /locus_tag="Rvan_0201"
FT   CDS_pept        238486..240711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0201"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="TIGRFAM: Polyphosphate kinase; KEGG: bid:Bind_1568
FT                   polyphosphate kinase; PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69491"
FT                   /db_xref="GOA:E3I6D0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D0"
FT                   /inference="protein motif:TFAM:TIGR03705"
FT                   /protein_id="ADP69491.1"
FT                   /translation="MKTAEAEPAPTYRDRIEAFGDERFFNRELSWLAFNRRVLEESANT
FT                   RNPLLERVRFLAISGSNLDEFYRVRVAGLHEQAATEIVEVSPDGLTPRQQVEKINEAVM
FT                   PLSAIQQERWNALREDMAKEQIYMASAKSLSDAERDWLEIYFMRRVFSALSAVAVDAAH
FT                   PFPHVQSQELVLVLECTRELALVGDSDFEGEPRLMYALVVIPNGLDRFIRLPQTVGENG
FT                   KPAIRFIAMEVLIALHAHTLLPGFKVKHAGLFRPLRNSGIEFQEKSEDLQKVLRKALVR
FT                   RQLGEVIRLEMSESLPVAARELIIAGLKIDRADVVPVDGLFAIADISQLVVSDRPDLVY
FT                   KPFEIRFPERIAEFENDCFAAISSKDIVVHHPYESFDVVLQYLRQAASDPDVVAIKWTL
FT                   YRTSKRSPIVEALRQAREAGKSVTVMIEVTARFDELNNLEWAKQLEAVGVHVVYGLTQL
FT                   DLKTHAKLGQVVRKENGELRTYCHIGTGNYHPATAKIYTDLSYFTADAAVGRDVSRIFN
FT                   YVTTYSRPNNLERMYISPHGIKARIIEEIHNEIAHAKAGRPAAIWMKLNALVDPEVIDA
FT                   LYEASLSGVPVDLVIRGICCLKPGIHGLSENIRAKSIIGRFLEHSRIYCFGAGHGLPSE
FT                   DAHVYISSADMMPRNLERRVEAMTAITNPTVHEQVLDQIMIANLKDNLQSWKIESDGSS
FT                   QRFHLKPGEEPFSAHEYFMTNPSLSGRGGALKQNFPRRFAVASAPHA"
FT   gene            240993..242561
FT                   /locus_tag="Rvan_0202"
FT   CDS_pept        240993..242561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0202"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: xau:Xaut_3126
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69492"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D1"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ADP69492.1"
FT                   /translation="MDNSTLGSISGRLPGARPVAVIDIGSNSIRLVVYERLTRAPTPLF
FT                   QEKAMCGLGRYLNELKRLNPETVPSALASLARFRKLADICGVRERDIHPFATAAVRWAE
FT                   DGPDFLAKAEEACGVPIRVIGNAEEAELAATGVRAGFVNPRGIVGDLGGGSMELVRING
FT                   DTLSDQISLPLGSLSLAERTHGEKTEAIPIIEDALASVDWLNNVRGENFYAIGGTWRAL
FT                   AKLQMAQTNYPLSAVHGYKMDARKALQITARYANNSPTGLKRLAGMSAGREETVPFGAL
FT                   LLNSLIRKMQPSDVVFSAFGVREGTIYRLLSEAERAEDPLLSACETVATLRARSPQHGR
FT                   ELIEWTDGLFARSNEHEQEDERRLRHAACLLSDISWRAHPDYRGEQSAVLISQSAFAGI
FT                   DHPGRAFLALCVYHRYERKLQGELMPKLAHLLPRPLQKRALIIGQTVRLAHTLTAGMKG
FT                   QLPQTTLLCEGGKLVLSLPTKLESLDGEQLRRRLRSVAREMALQPEVVVSKHVKQTFFG
FT                   GLFGG"
FT   gene            242677..243615
FT                   /locus_tag="Rvan_0203"
FT   CDS_pept        242677..243615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0203"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="KEGG: sme:SMa0116 DnaJ/CbpA-type protein; PFAM:
FT                   chaperone DnaJ domain protein; heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69493"
FT                   /db_xref="GOA:E3I6D2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D2"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ADP69493.1"
FT                   /translation="MDQDLYAVLGLKRTATNDEIRRAYRRLAKDLHPDQNKGDPVCEEK
FT                   FKRVSAAFAVLGSPEKRKRYDAGEIDSMGNERANPFYRDYAAGGGAGHHEGFGGYHNGG
FT                   AGGGDFSDIFGDLFGRRGPSGGAFTMRGMDYRYNLEISFLEAVNGVKKRVQFPDNETLD
FT                   ITVPAGVESGQTLRLRHKGGPGAGRGEPGDALIELKIQPHPLFSRDGDNITLELPVSLD
FT                   EAVLGSRVEAPTIGGRVTVAIPKGASSGQVLRLRGKGVRNPRSGTHGDQLITLKIVLPP
FT                   VIDPELERFMQEWAKKQPYDPRARFREAAGA"
FT   gene            complement(243573..243962)
FT                   /locus_tag="Rvan_0204"
FT   CDS_pept        complement(243573..243962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpr:GBP346_A0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69494"
FT                   /db_xref="GOA:E3I6D3"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D3"
FT                   /inference="similar to AA sequence:KEGG:GBP346_A0377"
FT                   /protein_id="ADP69494.1"
FT                   /translation="MRAFRLLMLLIVFLCLVPILALIGAGAAARVAGCDLDPGQSLPCP
FT                   VLGSDYGDELFSVLNFGMHTVEAIAVLGAVIVVWVIVEIVAAIGGKPRNPRPSQQDGGS
FT                   RAAPRPWRKSPPQAPAASRKRARGS"
FT   sig_peptide     complement(243873..243962)
FT                   /locus_tag="Rvan_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.433 at
FT                   residue 30"
FT   gene            244156..245100
FT                   /locus_tag="Rvan_0205"
FT   CDS_pept        244156..245100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0205"
FT                   /product="Ureidoglycolate lyase"
FT                   /EC_number="4.3.2.3"
FT                   /note="KEGG: mag:amb2827 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69495"
FT                   /db_xref="GOA:E3I6D4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D4"
FT                   /inference="protein motif:PRIAM:4.3.2.3"
FT                   /protein_id="ADP69495.1"
FT                   /translation="MTTIEVPLDSKLRLLTFADEQGRARLGVVRPDGHVTDVAETARHA
FT                   DRWLCFDGTSMRALIEGGAEALAEVRELAELGLHNGFKVSEAHILPPLPRLNGNIFCVG
FT                   WNYVEHFSEGAAFRDPNQKLPEHPLFFSKGVAALNGPFDPIPYDAAISAQVDWEAELGV
FT                   VIGRRGKNITEFEALDYVFGYTAINDVSARDIQKARHGGQWLKGKSLDGTAPMGPWIVP
FT                   AGDFDASAVRIITRVNGVVKQDGNTRDMYFNIPRIIAELSRGMTLQPGDVISTGTPSGV
FT                   GMGRTPPEWLKPGDVLETEIEGIGTMRNVIHEA"
FT   gene            complement(245429..246325)
FT                   /locus_tag="Rvan_0206"
FT   CDS_pept        complement(245429..246325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0206"
FT                   /product="hydroxyneurosporene synthase"
FT                   /note="PFAM: hydroxyneurosporene synthase; KEGG:
FT                   mrd:Mrad2831_2823 hydroxyneurosporene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69496"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D5"
FT                   /inference="protein motif:PFAM:PF07143"
FT                   /protein_id="ADP69496.1"
FT                   /translation="MTIIAFIGSVFSPYYAKERRRAIVDPAQHCSINVAVYGRGAARWA
FT                   MTERCRHALGATPEQLAIGPSSLSWDGTRLIVRIDEKAPVTGLPVRGVVTLEPEIRSDF
FT                   ATDFGTDGRHLWAPIAPRARVEARFDAPAISWTGTGYFDTNRGDEPLEDGFSYWNWSRA
FT                   CLSDSAVMLYEGTRQNGSKFNMGIQIAADGSVSPVELRERCDLPLTRYWKMPRETRVDA
FT                   GHTANVEQTLEDTPFYSRSMIATHLLGEPVHAMHESVSLDRFRKRWVQSLLGWRMPRVT
FT                   LQGSSRGVFGMSRDQIE"
FT   gene            complement(246322..247890)
FT                   /locus_tag="Rvan_0207"
FT   CDS_pept        complement(246322..247890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0207"
FT                   /product="phytoene desaturase"
FT                   /note="KEGG: mex:Mext_2726 phytoene desaturase; TIGRFAM:
FT                   phytoene desaturase; PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69497"
FT                   /db_xref="GOA:E3I6D6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D6"
FT                   /inference="protein motif:TFAM:TIGR02734"
FT                   /protein_id="ADP69497.1"
FT                   /translation="MPETRVVIVGAGIGGLSAAVNLAAEGVAVTVVEKFDKPGGKMREV
FT                   DAGGTAIDAGPTVFTMREVFEAIFEKAGASLSDYLTVKPAEIIARHAWEDGSTLDLFAD
FT                   EERSFDAIADFAGAENAQGYRAFCREAAEIYRILDPSFIRAQKPSLPKLIWRVGPVAFS
FT                   DLWRINPYETFWNAVCRHMSDPRLRQLFARYSTYCGASPFASPATLMLVAHVEQQGVWL
FT                   VDGGMHKIALALESLGRRLGVVYRYGAEVAEVTAEFGRASGVRLASGEHIAADAVVLNA
FT                   DPSPVAAGRLGRDAASATRRVPPRRRSLSALTLAFQAEASGLPLARHTVFFPAAPYHLE
FT                   FDAIFRQRKLPPAPTVYLCAQDRDGRGGRSEDGAERFLTVVNAPALLNGSGLSLAEIEE
FT                   CETKTFRLMETCGLTLRPLPGALVRTAPQDFETLLPGTGGAIYGRASHGWMASFQRQGT
FT                   RSTMPGLYFAGGSVHPGPGIPMAALSGALASEALLADLALPRLLHRMATPGGMSMRSAQ
FT                   TIATD"
FT   gene            248017..249177
FT                   /locus_tag="Rvan_0208"
FT   CDS_pept        248017..249177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0208"
FT                   /product="O-methyltransferase family 2"
FT                   /note="KEGG: rce:RC1_2092 hydroxyneurosporene
FT                   methyltransferase; manually curated; PFAM:
FT                   O-methyltransferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69498"
FT                   /db_xref="GOA:E3I6D7"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D7"
FT                   /inference="protein motif:PFAM:PF00891"
FT                   /protein_id="ADP69498.1"
FT                   /translation="MDKRSNFNALMDRAFAFRDRVLSSPRFIRFAETFPLTRPIARREA
FT                   GALFDLCSGFIYSQVLLSCVRLGLFEHLRGGPLARDEIARRLGLGEDATARLLTAAVAL
FT                   RLAEERSGGRYGLGRLGAAVLASPGLTAMVEHHGLVYRDLEDPVALLRGESKTPSAGEA
FT                   VNPAADKGTHLASYWPYAEGDTSADRDAVSAYTALMAATQPAIAEEVLDAYDFTRHRCL
FT                   MDVGGGDGTFLRAAARRVPALDLVLFDMPAVADLADAKFKAANLAHRAKAAGGDFTKDL
FT                   PKGADVVTLVRVLLDHDDDTALKILTSVRAALPQGGVLVVAEPMAGTRGAEKVAAYFSL
FT                   YLMAMGRGRPRTEAQLRDLLQRAGFTAIKRCATHQPLLVRVLAATF"
FT   gene            249261..250226
FT                   /locus_tag="Rvan_0209"
FT   CDS_pept        249261..250226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0209"
FT                   /product="chlorophyll synthesis pathway, BchC"
FT                   /note="KEGG: msl:Msil_2051 chlorophyll synthesis pathway,
FT                   BchC; TIGRFAM: chlorophyll synthesis pathway, BchC; PFAM:
FT                   Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69499"
FT                   /db_xref="GOA:E3I6D8"
FT                   /db_xref="InterPro:IPR005903"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D8"
FT                   /inference="protein motif:TFAM:TIGR01202"
FT                   /protein_id="ADP69499.1"
FT                   /translation="MALLQEFPTETLAVVLEEPEKLGLRRLALPSPGDADVVIDVEWSG
FT                   ISTGTERLLYTGRMPHFPGMGYPLVPGYESVGRISWAGPAAGISVGERVFIPGANCYGE
FT                   VRGLFGGTASRIVMPGARAIPIAESLGEQGILFALSATAHHAAFSDKGVPADLIIGHGV
FT                   LGRLIARIVVASGASAPTIWEKNPARFDGAQGYTVLDPDQDPRRDYRVICDVSGDSTII
FT                   DSLVARLAPGGEIILAGFYADRLSFSFPPAFMKEARFRVAAQWQKADIASVSKLVDSGL
FT                   LSFDGLITHRVSADNAPAAYRTAFEDPACLKMVLDWRTLA"
FT   gene            250223..251233
FT                   /locus_tag="Rvan_0210"
FT   CDS_pept        250223..251233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0210"
FT                   /product="chlorophyllide reductase iron protein subunit X"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: chlorophyllide reductase iron protein
FT                   subunit X; KEGG: rpt:Rpal_1710 chlorophyllide reductase
FT                   iron protein subunit X; PFAM: NifH/frxC-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69500"
FT                   /db_xref="GOA:E3I6D9"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR010246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6D9"
FT                   /inference="protein motif:TFAM:TIGR02016"
FT                   /protein_id="ADP69500.1"
FT                   /translation="MSLDANEANALERQAAQLRAEAQEEPAAVPSGEVKKETQIIAIYG
FT                   KGGIGKSFTLSNLSYMMAQQGKRVLLIGCDPKSDTTSLLFGGRATPTIIETSSRKKAAG
FT                   EELRIEDVCFKRDGVFAMELGGPEVGRGCGGRGIIHGFETLEKLGFHEWGFDYVLLDFL
FT                   GDVVCGGFGLPIARDMCQKVIIVGSNDLQSLYVANNVCSAVEYFRKLGGNVGVAGIVIN
FT                   KDDGTGEAQAFAEAVGIPILSAIPQHEELRRMSANYQIVGIPGTTWAPVFETLATNVAE
FT                   APPVRPTPLSQDGLLNLFKGDAVGRGIVLEPASQSDMRGHEIVEKPSLEIVYDVA"
FT   gene            251252..252844
FT                   /locus_tag="Rvan_0211"
FT   CDS_pept        251252..252844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0211"
FT                   /product="chlorophyllide reductase subunit Y"
FT                   /note="KEGG: rce:RC1_2095 chlorophyllide reductase subunit
FT                   Y; TIGRFAM: chlorophyllide reductase subunit Y; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69501"
FT                   /db_xref="GOA:E3I6E0"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010245"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E0"
FT                   /inference="protein motif:TFAM:TIGR02015"
FT                   /protein_id="ADP69501.1"
FT                   /translation="MTALERQSSQAATGEVVYDDAGRVAAAETSAVKSDAGVDGAGVSC
FT                   HAGAEEMKKAAAAAGQSEILEQFAKDYPQGPHDQPQTMCPAFGSLRIGLRMRRTATILS
FT                   GSACCVYGLTFTSHFYGAKRTVGYVPFSSETLVTGKLFEDIRDAVYKLADPANYDAIIV
FT                   TNLCVPSASGVPLRLLPKEINGVRVVGIDVPGFGVPTHAEAKDVLSGAMLRYARGEAEA
FT                   GPVQAPRGGRSEKPTITLVGEMFPADPVTIGMMLEPLGLAAGPVVPTREWRELYSALDC
FT                   AAVAAIHPFYTASFREFESAGRSITGSAPVGYDGTAAWLLSIGELCGVARDKVDAALNR
FT                   ILPAVRTALAKAPVKGRITVSGYEGSELLVARMLIESGADVPYVGTACPKTRWSESDRE
FT                   WLEAKGVRVQYRASLEQDIAAVDEFHPDLAIGTTPVVQHAKAKAIPGLYFTNLISARPL
FT                   MGVAGAGSLAQVVNAAIASKARFEEMKAFFGSVGTGYTAGVFDEAPKEPAKVKELPLKK
FT                   PSANDLPKEAMGC"
FT   gene            252838..254289
FT                   /locus_tag="Rvan_0212"
FT   CDS_pept        252838..254289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0212"
FT                   /product="chlorophyllide reductase subunit Z"
FT                   /note="KEGG: rpc:RPC_1295 chlorophyllide reductase subunit
FT                   Z; TIGRFAM: chlorophyllide reductase subunit Z; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69502"
FT                   /db_xref="GOA:E3I6E1"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010244"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E1"
FT                   /inference="protein motif:TFAM:TIGR02014"
FT                   /protein_id="ADP69502.1"
FT                   /translation="MLIADLDRAGGYWGAVYVFTAVKGLQVIIDGPVGCENLPVTAVLH
FT                   YTNALPPHELPIVVTGLSEEELGKTGTEGAMRRAHKVLDPRVPSVVVTGSIAEMIGGGV
FT                   TPEGMNIQRFLPRTIDEDQWQSADRALVWLWKEYGVKKKVKAKPKAADAKPSVNIIGPS
FT                   YGVFNTPSDLAEIRRLVEGIGAEVNLVFPQGTHLNDIPRLASADANICLYREFGRLLCE
FT                   ALEKPYLQAPIGLHSTTKFLRALGETLGLDPEPFIEREKLTTIKPLWDLWRSVTQDFFG
FT                   TASFAIVANETYARGVRHFLEDELGLPCTFAVSRRTGMKTDNDEVRRLVREKPPLVLFG
FT                   SYNERMYLAEAGGRSMYIPASFPGAIIRRHTGTPFMGYAGATYLVQEVCNALFDALFNI
FT                   LPLGKDLDRIEATPSRLARQLPWDEDAKALFDELVEAQPVLVRISAAKRLRDAAEKAAR
FT                   EAGEAKVTAVRLGQSTALAIDGRAA"
FT   gene            254286..254561
FT                   /locus_tag="Rvan_0213"
FT   CDS_pept        254286..254561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_2855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69503"
FT                   /db_xref="GOA:E3I6E2"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E2"
FT                   /inference="similar to AA sequence:KEGG:Mpop_2855"
FT                   /protein_id="ADP69503.1"
FT                   /translation="MTAADLESGKTEKDARIVTSLCTQDVGLHASMRAKEAQEFRLMFI
FT                   ATFPLFLAAGLVKRAVSPRRGAARRKSVFAEARAAANTCIPFAFMR"
FT   gene            254682..254900
FT                   /locus_tag="Rvan_0214"
FT   CDS_pept        254682..254900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0214"
FT                   /product="antenna complex alpha/beta subunit"
FT                   /note="PFAM: antenna complex alpha/beta subunit; KEGG:
FT                   rce:RC1_2097 light-harvesting I complex, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69504"
FT                   /db_xref="GOA:E3I6E3"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002362"
FT                   /db_xref="InterPro:IPR023623"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E3"
FT                   /inference="protein motif:PFAM:PF00556"
FT                   /protein_id="ADP69504.1"
FT                   /translation="MAQEERDVSLTGLTEGEAKEFHSIFVASFIGFTIVAIIAHVLSWN
FT                   WRPWARPLADLGDGVQTAALTIVQYLA"
FT   gene            254920..255096
FT                   /locus_tag="Rvan_0215"
FT   CDS_pept        254920..255096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0215"
FT                   /product="antenna complex alpha/beta subunit"
FT                   /note="PFAM: antenna complex alpha/beta subunit; KEGG:
FT                   mch:Mchl_2962 antenna complex alpha/beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69505"
FT                   /db_xref="GOA:E3I6E4"
FT                   /db_xref="InterPro:IPR000066"
FT                   /db_xref="InterPro:IPR002361"
FT                   /db_xref="InterPro:IPR018332"
FT                   /db_xref="InterPro:IPR035889"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E4"
FT                   /inference="protein motif:PFAM:PF00556"
FT                   /protein_id="ADP69505.1"
FT                   /translation="MWRIWLLFDPRRVLVALFAFLVVLGLLIHFILLSTTRYNWIDTPA
FT                   PAAASQNSALPAR"
FT   gene            255210..256034
FT                   /locus_tag="Rvan_0216"
FT   CDS_pept        255210..256034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0216"
FT                   /product="photosynthetic reaction center L subunit"
FT                   /note="KEGG: mch:Mchl_2963 photosynthetic reaction center L
FT                   subunit; TIGRFAM: photosynthetic reaction center L subunit;
FT                   PFAM: photosynthetic reaction centre protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69506"
FT                   /db_xref="GOA:E3I6E5"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005871"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E5"
FT                   /inference="protein motif:TFAM:TIGR01157"
FT                   /protein_id="ADP69506.1"
FT                   /translation="MALLSYEKKYRIRGGTLVGGDLFDFWVGPFYVGFFGVTTLFFALL
FT                   GTALIVWGAAQGHTLNIWKINIAPPDLSYGLGMAPLAKGGLWQLITICATGAFVSWALR
FT                   EVEICRKLGIGYHVPIVFSVAIFAYISLVFIRPVLMGAWGFGFPYGILSHLDWVSNTGY
FT                   QYLHFHYNPAHMLAIAFFFLTTLLLAMHGGLILSALNPGGRDVVKTPEHENAFTRDLLG
FT                   YSVGTIGIHRLGVFCAIMAVLFSALCIVLSGPFWTKGWPEWWNWWFNIPVWR"
FT   gene            256048..257025
FT                   /locus_tag="Rvan_0217"
FT   CDS_pept        256048..257025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0217"
FT                   /product="photosynthetic reaction center, M subunit"
FT                   /note="KEGG: msl:Msil_2059 photosynthetic reaction center
FT                   subunit M; TIGRFAM: photosynthetic reaction center, M
FT                   subunit; PFAM: photosynthetic reaction centre protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69507"
FT                   /db_xref="GOA:E3I6E6"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005781"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E6"
FT                   /inference="protein motif:TFAM:TIGR01115"
FT                   /protein_id="ADP69507.1"
FT                   /translation="MAEYQNIFTQVQVKGPAHLGVPLYRDQYGRTGKPFHVYLLGLIGD
FT                   AQIGPIYLGLTGVASIIFGFIAIEIIGLNMAASVDWSPAQFVKQLPWLALEPPAPENGL
FT                   KIPSLNNGGWWLWAGFFMTASVLLWWARTYLRARQLGMGTHIAWAFASAIFLMLSCGLF
FT                   RPVLMGTWGEAVPFGIFPHLDWTATFSIRYGNLYYNPFHMLSIAFLYGSTLLFAMHGAT
FT                   ILAVSRFGGEREIEQSTDRGTALERAGLFWRWTMGFNASMESIHRWAWWFAVLCPITGG
FT                   IGILLTGTVVDNWYLWGIKHGFVPVYPETLPVIVDPALLPGAPK"
FT   gene            257022..258086
FT                   /locus_tag="Rvan_0218"
FT   CDS_pept        257022..258086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0218"
FT                   /product="photosynthetic reaction centre cytochrome c
FT                   subunit"
FT                   /note="PFAM: photosynthetic reaction centre cytochrome c
FT                   subunit; KEGG: rce:RC1_2101 photosynthetic reaction center
FT                   cytochrome c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69508"
FT                   /db_xref="GOA:E3I6E7"
FT                   /db_xref="InterPro:IPR003158"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023119"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E7"
FT                   /inference="protein motif:PFAM:PF02276"
FT                   /protein_id="ADP69508.1"
FT                   /translation="MSYKQRILTLALAGAALAVFLVVFSYYTLQRPTVEWLQWGYRGTG
FT                   LVHIVNSRDIHSQKQQALNAVPAPEENIDPAGTKASAVYQNVKVLGDLDSNEFLRFMTA
FT                   ITKWVAPEQGCAYCHNEADFADENVYTKIVSRRMIQLTQDLNAKWKSHVAINGQGVTCY
FT                   TCHRGNPIPKNVWYTPVEPRFSKALLGNLAGQNQRAPAVGLTSLPFDPFTPFLMKSEQI
FT                   RVVGPTALPTTNHMSLKQAEWTYGLMMSMSKSLGVNCTYCHNTQNFQSWGASSPQRVTA
FT                   WYGIRMVRDINNNYINPLTPLYANVPGRKGPAGDIAKANCATCHQGAFKPLYGVSMLKE
FT                   YPVLAGPAATVKTQ"
FT   sig_peptide     257022..257099
FT                   /locus_tag="Rvan_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.635 at
FT                   residue 26"
FT   gene            complement(258454..262302)
FT                   /locus_tag="Rvan_0219"
FT   CDS_pept        complement(258454..262302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0219"
FT                   /product="double-strand break repair helicase AddA"
FT                   /note="KEGG: atc:AGR_C_39 hypothetical protein; TIGRFAM:
FT                   double-strand break repair helicase AddA; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69509"
FT                   /db_xref="GOA:E3I6E8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E8"
FT                   /inference="protein motif:TFAM:TIGR02784"
FT                   /protein_id="ADP69509.1"
FT                   /translation="MSDALHDARLAEASRKQRSAADPSVSAWVRANAGTGKTHVLVQRI
FT                   LRLCLAGAAPRSILCLTFTKNAAAEMEARVLKTMGEWATADAATLEAALAALLDRPAEA
FT                   GELAAARTLFATVTDAPGGLPIMTIHAFCERLLRRFSFEANVPPGFTVMTEEEARDALA
FT                   AAKAAAFSEAKSGAMRDALATAVAHAGEDEFGRVLKDMLGHRRTIHYLLSVGPEGDRIA
FT                   PVNARLRRIFGLAANETAASLIDRAAAVLSDETIREIVAIFAEGGKTEAEIAASLRLAM
FT                   SAPDAASKCACIKKALGTKGGEPKKRLATAPTQRRAPSLCERLSRAQTDFFDLDRKICA
FT                   AKVVAATAALFRLAAAIFDAYEAEKRARGAVDFDDLIEKTLALLHREDAAEWVLYQLDG
FT                   RIDHVLVDEAQDTSPEQWAIVAALTAEFFSGESARATMPTLFAVGDEKQSIYGFQGARP
FT                   EFLAAFGAAYEQKARATQMPFRTIGLDLSFRTLAPVLSAVDHVSAALGGGLSTAPMPHI
FT                   ANRDDDGGLVELWQPERGARQDKGDVWVPEDDAATSAKPAEALASRIATKVRGWLDGGA
FT                   ALGREGRPVDPGDIIILLKKRQPMASLLQAALKREGVPVAGADRMSLVDDLAVMDLLAL
FT                   GDALLQPEDDLALAAALKSPLFGLSDDDLFALRNPREGSLWAALGARAEAEAVGRFAEA
FT                   AARLASWRDLAHRLSPFDFYAQVLDHPLPAASDSDDGRGGQADDPHIGGASVASFGEDT
FT                   NHFRGVGGDDMSTGKIDSISLSTETRYASAAAHTPPDGRAAFGARLGPQCFEALDEFSN
FT                   LAETFSAGGRGDLADFLVFVRHGAAEVKRETDQATREVRIMTVHGAKGLEAPIVILADA
FT                   CGARAGRQPPILLLEDRADGVRVPVWTIKGAGALPPVADQKEELAEAARRESGRLLYVA
FT                   MTRARDRLYIAGSHTGDTLPEGCWFDTVKSALEPHAAGGVDDHGRLFWRLGSELHGVSG
FT                   AGGNHGEPMPVALPDWAGKSAPAGNSRVLLSASALVPPALIRNRFDAETLTDIQRRAAS
FT                   GSPNDALKSSREPASLNAHQPPVDAFFLRAPALETASDLDEWGPNPHDGVARKVAQQTG
FT                   IFIHRLLEILPGLPEGRRGEAAQLAAAAFREALPGNRIEAAFESVERLLATPHLRPGDK
FT                   RVLSEAGIAIALESNERAAILGQCDRISIGTDGIELLDYKSGTLSDGDPLPAVYVAQLA
FT                   AYRLALGQLYPAANIHASLINARSASLLEADAEALDAFATLLAGSLADPFHEAGLEG"
FT   gene            complement(262295..265570)
FT                   /locus_tag="Rvan_0220"
FT   CDS_pept        complement(262295..265570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0220"
FT                   /product="double-strand break repair protein"
FT                   /note="KEGG: azl:AZL_027200 double-strand break repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69510"
FT                   /db_xref="GOA:E3I6E9"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6E9"
FT                   /inference="similar to AA sequence:KEGG:AZL_027200"
FT                   /protein_id="ADP69510.1"
FT                   /translation="MTGGGAQLELGFSAARGSAVFACPPHRPFLPALAAAILDGALFGG
FT                   GEPEPHDIPALNVYVPSQAAVTPLKLALLDLSPCGATFLPRIRVLGDADPLDMFAAYAP
FT                   HMDAGDALALLRDAVDVPKPVGDIERRVHLSAAAMKAARDIHSTRMEFGEQLFSGVTAT
FT                   SAAKIAADIASLIDDAHRERADLAKIDRLDRGHASGGEQISLQILRAVRKAWDAHKKRS
FT                   RRLDREERRNRLMALEAAFIRASDAPVIVAGSTGSVAATMGLMEALGGRARSAIVLHGL
FT                   DRALDDASWQAIAEHPEHPQHGLWQLLARLVVCRNEVSELETVRALPAGGDPIRAAFLS
FT                   EAMRPASTTARWADYVAARKAEGSRDAGATARDVWADVSLCDAPRGTLAPGLTLVEADT
FT                   SQEEAVVVALILRAALEDEAAHVALVTPDDALTARVRHALAAWGMASELPAAPRHAFAL
FT                   RVAATATSGKPEDFTALLRLGLLEPRSAYLRQRESDLTEADPGADRDRFLRLAELVDLG
FT                   AARQMWRPASMDGIPAALARAQHAIASGEARHPAMRRIDAEAWDAARLLAGDVLDALSP
FT                   LTENAADPASDAAPTLPFRRWVAAHDEALARLAAIGLACDAGDDAPSLGDAFGVDAPSL
FT                   ALDINDYAAFFAELARGEPTPAAGSPHPRLSLLSPLDARLLSADVIVLGGLNEGAWPQT
FT                   PGPSPWLNRQDRAAIGLSPEERRIGQAAHDFASLAAAAPRVVLTRAKKANGSLARPSRW
FT                   IARITTLARGTGRLAEIETGADWLEMARARRMPATVTPIAPPEPRPPLSARPRRLSVTA
FT                   IETWFANPYAIYASFILDLKPLRRIGESHDARDKGTLYHAALNRFFEAYPDRVPDDAAA
FT                   RLVACLDRSAEEFGFDLDAAPFWRPRFARFAEWFAATEAQRRDGLRLLKSEVGGKLKLV
FT                   AEGAAGPFEVTARADRIDLGADGSLRIFDFKTSANAATTSARRGAPQLALEGMLAMEGA
FT                   FAGLPAGGAPDLCYIIASGGEPPGDIVTLKVPSEEAIAAAKAGLLLRIARFDDEATPYA
FT                   YEARAIFRDKADNDPYAHLARVKEWSAAADGEDVGAEDGGGDE"
FT   gene            complement(265545..266282)
FT                   /locus_tag="Rvan_0221"
FT   CDS_pept        complement(265545..266282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0221"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mno:Mnod_1607
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69511"
FT                   /db_xref="GOA:E3I6F0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F0"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADP69511.1"
FT                   /translation="MTREGKIETAMVLAAGFGTRMRPITDTIPKPLVRLDGRALIDHAL
FT                   DRLADAGILRAVVNVHYLADQIEAHVRPRRTPEITVSDERDAVLETGGGVAKALPLLGL
FT                   HPFIVHNSDSVWSEGARSNIAALTAAWEPHRMDVLLLLSHRDRSLGYDGRGDYTLGDDG
FT                   RLARRPRDGEAAHVYAGVSILNPALFDGIADRAFSLNRIFDKAMAEGRLFGVELDGTWM
FT                   HVGTPEALADAERFLNDRRRRTA"
FT   gene            complement(266339..267256)
FT                   /locus_tag="Rvan_0222"
FT   CDS_pept        complement(266339..267256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0222"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="KEGG: mes:Meso_2140 branched-chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69512"
FT                   /db_xref="GOA:E3I6F1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F1"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADP69512.1"
FT                   /translation="MAGPAPIPYDQRDGFIWMDGGLVPWRDAKVHVLTHALHYGSGVFE
FT                   GARIYEGEVFASRRHAERLRASAEILGFEVPYSAEQLEQAFRDVIKAQKLDEGYIRPVA
FT                   WRGPEEMGVAAKHSKIHVAVAVWDWGSYFPMEERLKGIRLCFAKYRRPDPATAPSTAKA
FT                   AGLYMICTIEKHRSMDLGYNDALMLDWRGYVAEATGANIFFVKDGQIHTPDADCFLNGI
FT                   TRQTLIAQAKARGITVHERRIQPEEMAGFEQCFLTGSAAEVTPVSEIGEYRFTVGEITK
FT                   SLMEEYSALARPSTRPDKLRHLAA"
FT   gene            267432..268166
FT                   /locus_tag="Rvan_0223"
FT   CDS_pept        267432..268166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0223"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: rpb:RPB_4173 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69513"
FT                   /db_xref="GOA:E3I6F2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP69513.1"
FT                   /translation="MTAVTASAVPSFEMDAPPLSDDAPHILVVDDDERIRDLLAGYLRQ
FT                   NGFRVTQAGDGAAARSKLRSIAFDCLILDVMMPGESGFDIAEWLRKESDVAILMLTARS
FT                   EPEHRVRGLELGVDDYVAKPFEPRELLLRLQNILRRHASPKTKHGEVRFGPFVFDLKKN
FT                   ELKRGDEPIRLTDREREVLREFALAGGELVSREDLARLGEYENERAVDVQINRLRQKIE
FT                   TDQANPAYLHTVRGKGYILYLD"
FT   gene            268272..269675
FT                   /locus_tag="Rvan_0224"
FT   CDS_pept        268272..269675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0224"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: oca:OCAR_7201 two-component hybrid sensor and
FT                   regulator; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69514"
FT                   /db_xref="GOA:E3I6F3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP69514.1"
FT                   /translation="MPKESGPPERASFLSRVFSALGSLAPKGLYTRALIIIIAPIVILQ
FT                   SILAFVFLDRHWQVVTRRLSVATAQDIAMLADTYEAMNAKTEADLDRLSRLARENLSLS
FT                   VRFLPGDQLPVTRSKPFFGFLDRYLSGEISRRINRPYWIDTVGSSNYIEVRIKLDGAVM
FT                   RVLAQRAQLIPSNTHFFIVWMVTSATVLLIVAILFLRNQIRPILALADAADRFGRGRPA
FT                   PPDFRVRGAREVRLAAQAFLDMRDRIERHVEQRTIMLAGVSHDLRTILTRFRLQLAMMR
FT                   APQIEALKRDVDEMQQMLEDYMAFAKGAAGEKIRRVDVRSILEEVQTAAEEPGKTLRLD
FT                   VRQNPLIVALRRNALKRAVLNLVTNATRYASTVQIRALRSHGWLTVVVEDDGPGIPADK
FT                   REVVFRPFHSLDAARNQNKKSTGLGLAIARDIVRSHGGDITLDKSNLGGLKAVIRIPST
FT                   HVSEDVATD"
FT   gene            269784..270830
FT                   /locus_tag="Rvan_0225"
FT   CDS_pept        269784..270830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0225"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rsq:Rsph17025_1960 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69515"
FT                   /db_xref="GOA:E3I6F4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69515.1"
FT                   /translation="MGLAATIDIAEAPAAPALSQTRDATTPLSRICVGICTIRRPGMLK
FT                   NCLESIGRQEGVEDYDVRVVVVENDTAPATKPVVDAFAAMSPFPVHYIHEPRRGIPFAR
FT                   NRVVDAALAMAADHVAFVDDDQITHPTFLAKHIEAAARDGADVVQAHIVPMFPTPQPFW
FT                   ATGRTGAVEVVDEDRPVSERKRRSAGTCGVMFSARLIRPDGMGLRFDERIGLGRGSDSD
FT                   FFSRANNGGMLIVNSRLPIVMDEIHRSRLTYWRHILGGLAQGNSHFVRYRNDNGYRAAL
FT                   ARYGTVSVVRFFRGIGQLAIAPLLAPFNLNGFKVSALEGGRNIFFAVGAIGGIFSVQYQ
FT                   YYRNIDGY"
FT   gene            complement(271178..271969)
FT                   /locus_tag="Rvan_0226"
FT   CDS_pept        complement(271178..271969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: type III restriction-modification system,
FT                   restriction endonucleasesubunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69516"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F5"
FT                   /inference="similar to AA sequence:KEGG:LKI_10376"
FT                   /protein_id="ADP69516.1"
FT                   /translation="MTDAGAQITLNVFSNCSEVDVRKIPVKETVESFFACFGRDIVART
FT                   VYFIDPSPFRRSYEAHRQRISEFHTQLGPFEIHYTYGLAFGYRKSIVLSETEYAFQLEH
FT                   DWRFNAPLIRHSIEHLVAAMRAGGIDHLRFNQHVNATNRYDVELEETNFASVPMVRTPM
FT                   RSNNPHLIHIPTYREKWLHLIDPARGKSKGVEENLWRVPNSAIYGPLNYPATIEHDDGR
FT                   ERLRKLGKKLGKPAFNFLIRSGAMEAAFEAEHFVKRRLGRA"
FT   gene            complement(272032..272454)
FT                   /locus_tag="Rvan_0227"
FT   CDS_pept        complement(272032..272454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0227"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: bid:Bind_3577
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69517"
FT                   /db_xref="GOA:E3I6F6"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F6"
FT                   /inference="protein motif:PFAM:PF02152"
FT                   /protein_id="ADP69517.1"
FT                   /translation="MATTYSLQNILAHDASDARQRPYDRVLVRDLVLPAHIGIWSEEKG
FT                   IEQRVRFTVELSVLPGAHRPGDLSSVVSYDFIIDGIREAVAAGHVLLTETLAERVAEHC
FT                   LSHRRAMEVRVVVEKLDRVPGASLGCEIIRFRPHQP"
FT   gene            272960..273583
FT                   /locus_tag="Rvan_0228"
FT   CDS_pept        272960..273583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ncr:NCU01022 similar to domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69518"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F7"
FT                   /inference="similar to AA sequence:KEGG:NCU01022"
FT                   /protein_id="ADP69518.1"
FT                   /translation="MIRQSMLSGAAFLFTACALCLPLASASAGGWDASDYSGGRGGGWS
FT                   ERFKDRMRGDDDYERRERRAALREMLSDPEGRAELRSLMVEAMHERAMQGGMQGGMSDR
FT                   WGGRGGDMMDRMRDRGGMMGSGSDCPGRSAMRDQMRGDSQGGMRERFKAGSNRMADRSD
FT                   DIRELILERLRKNGEVKVLIARIQDRVADSDDDDSDDDDDGGKL"
FT   sig_peptide     272960..273046
FT                   /locus_tag="Rvan_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.499 at
FT                   residue 29"
FT   gene            273688..274626
FT                   /locus_tag="Rvan_0229"
FT   CDS_pept        273688..274626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0229"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69519"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F8"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADP69519.1"
FT                   /translation="MYKAVFLVAALALTPLPAMSQEPQQQRGQSGGDQQMGTSGGGAAG
FT                   GSMQQRDGTGDGGGADESSRSSRRDDILDRLSRSELRDRVAMAMGRVEDACGDDIDRFC
FT                   GEVTPGRGRIAACMEAYSDQLSRRCRFTLRRVSGYMQTAVRDVADSCRTAIRTQCGDAE
FT                   NRDACMGQKVSSLPPSCQMIVAAARQYPGMMASAQSSRMDGGSGQATADNGQQSQSGQQ
FT                   QSQSGSSDMRGMPVYSSDGVNLGKVVQIDRSSDGSIKSVKIEIGRLLGLGDKVVNITSD
FT                   ELQQMADRIKLRLNSDQVRKLPESKSGQQTR"
FT   sig_peptide     273688..273750
FT                   /locus_tag="Rvan_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(274667..276193)
FT                   /locus_tag="Rvan_0230"
FT   CDS_pept        complement(274667..276193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0230"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: oca:OCAR_6542 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69520"
FT                   /db_xref="GOA:E3I6F9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6F9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP69520.1"
FT                   /translation="MSTARSLRWRRFKQKTSIAAPQQSNSSAVKHDFAYDLLIMFVRNE
FT                   TVAALTVPILAIFVAATMLNWATEPRQLLLWLATIFITEGILLALCRQFKRQPRETVDL
FT                   VQWRRNLAAAEFLYGVCWAAVAFTPFVVQSQAAFFFLFAALTVVTAIRMMFAASVMQIL
FT                   HAGTAPVTGALALRFLMTGEPFYWALAVVAVGIHFYFVFLVKNLQRTALSMLDYRAEKD
FT                   RLIEELERAKAASDEARVRAEAANVAKSKFLANMSHELRTPLNAIMGFSEMIKDEVLGP
FT                   IDNENYRSYAADIHESGSHLLKLINEILDLSRIEAGRYELTEKPIDVAATALESLRLMR
FT                   IDAHQKNLRVVTDFRPDMPRIMADERALRQICLNLLSNAIKFTPDSGLIAVRAGILPSG
FT                   EAVLSVRDNGPGIPEEEISQVLRAFGQGSLALKTGESGTGLGLPIVSGLAELHGGRFEL
FT                   RSKLGVGTEASLILPKARVLPAVPQPRKPAPAPQPAATAEAVPYLMRGAA"
FT   gene            276365..276976
FT                   /locus_tag="Rvan_0231"
FT   CDS_pept        276365..276976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0231"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mes:Meso_1555 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69521"
FT                   /db_xref="GOA:E3I6G0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR034346"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G0"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADP69521.1"
FT                   /translation="MKILDEKRAPNPRRVRVFLAEKAIAVPFENVDIMTGAHKTEAFAG
FT                   LNPVQRVPVLVLDDGTAISESLAICRYFEALQPEPSLFGRTPLEIATVEMWNRIAELSF
FT                   FLPVTHCFRHSHPAMTSLEVPQVTAWAEANKPRVSDIIRTLDRRLGETPYLAGERFSVA
FT                   DITAMIATDFMKPARLAVPEGVPHFARWYSEVTARPSSKA"
FT   gene            276984..277727
FT                   /locus_tag="Rvan_0232"
FT   CDS_pept        276984..277727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0232"
FT                   /product="beta-lactamase-like protein"
FT                   /note="KEGG: mdi:METDI2760 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69522"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G1"
FT                   /inference="similar to AA sequence:KEGG:METDI2760"
FT                   /protein_id="ADP69522.1"
FT                   /translation="MELTVIGCGDAFASGGRINSCYLLDTAHGRLMIDCGATAPHELAR
FT                   AGIRASSADAILISHCHGDHFGGLPSLVLERMFIDRTDKPMEILGPPGIESRFESLMEN
FT                   VYPGILGVKKPFEILFRDLHPGFAIEWRGLMIEAFEVDHFSGSPSLALSVSDGDKQFSF
FT                   SGDSGFCGGVIAAGRGADLYLVECSTYSTKVEMHLDYLRLSAKFPSIGAKRYLLTHMGD
FT                   EMLASLDRIDTRVCIAAVDGLKVTI"
FT   gene            277838..278338
FT                   /locus_tag="Rvan_0233"
FT   CDS_pept        277838..278338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0233"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: avi:Avi_2055 transcriptional regulator AsnC
FT                   family; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69523"
FT                   /db_xref="GOA:E3I6G2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADP69523.1"
FT                   /translation="MLDLMDIKILTILQEDSTLPVAEIGKKVGLSTTPCWRRIQKLEQD
FT                   GVIQRRVALLDPKSVSAGVTVFVAITTNQHNAVWLERFQKVVASFPEIVEAYRMSGAVD
FT                   YQLRVVVPDIASYDRFYKAFISQIDLTDVSSSFAMEQIKFTTALPLSFAAAVASKRPQQ
FT                   QPA"
FT   gene            278373..279542
FT                   /locus_tag="Rvan_0234"
FT   CDS_pept        278373..279542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0234"
FT                   /product="glutamate 5-kinase"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: pla:Plav_1479 glutamate 5-kinase; SMART: PUA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69524"
FT                   /db_xref="GOA:E3I6G3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G3"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADP69524.1"
FT                   /translation="MTLSGTQSARIALDARPEWRNQRRIAIKIGSALLTDSETGTLKKA
FT                   WLEAIGDDVAELKAQGREVILVSSGAIALGRRALGLAPGALKLEEAQASAAVGQVTLAH
FT                   AYQTVFRERGITTAQILVTPGDTEERRRYLNARSTIATLLKLGAVPVVNENDTVATAEI
FT                   RYGDNDRLAARVATMMTADCLVLLSDIDGLYTAPPAKNPHAQHIDVVTQITPEIEAMAG
FT                   DAGTELSRGGMVTKITAAKLAVSAGTHMVIASGKELHPLRALANGAPCTWFLASANPVA
FT                   ARKRWIAGTLEPKGVVLIDDGAARALRSGRSLLPAGVTGVSGAFERGEAVIIRDGHGCE
FT                   IGRGLIAYCAEEAARIAGRSSHEIEATLGYAGRAALIHRDDLALLHDLD"
FT   gene            279583..280224
FT                   /locus_tag="Rvan_0235"
FT   CDS_pept        279583..280224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0235"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: scb:SCAB_61941 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69525"
FT                   /db_xref="GOA:E3I6G4"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G4"
FT                   /inference="similar to AA sequence:KEGG:SCAB_61941"
FT                   /protein_id="ADP69525.1"
FT                   /translation="MRKQKHRAEKCERFSDHAMQSACIAPVYGVRFSNDGTGETMKASY
FT                   TYAVGDYLDIARTLRGRSFLTRFGLHCLAATVVSSLLIVTLPLTGVQNAPLWFAATLAV
FT                   VLIAVEVVVRANIIEKAAFRKSGMARVAVSFDLGDDGIRWARSGASGLIGWEQVSNAAF
FT                   LPEALVVVFGERQGIALPARGFATPAAFDEARAFIRSRLAERGVALNKEH"
FT   gene            280355..281653
FT                   /locus_tag="Rvan_0236"
FT   CDS_pept        280355..281653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0236"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: xau:Xaut_2058 gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69526"
FT                   /db_xref="GOA:E3I6G5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G5"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADP69526.1"
FT                   /translation="MTLAIADTKLDLRLLKIELLAIGQEARKAARSLALAPTEQKNAAL
FT                   FAAAAALRARMDDILRTNAEDRDAARASGRPESFIDRLTLTPARVEAMAKGLEDIAALA
FT                   DPVGETIAAWERPNGLRISRVRVPLGVIGMIYESRPNVTADAGALALKAGNAVILRGGS
FT                   ETIASNRAIHACLAEGLRAAGLPETAIQLIGTTDRAAVGLLLEGLDGAVDVIVPRGGKS
FT                   LVERVQKEARVPVFAHLEGICHVYVDEAADAEKARAIVLNAKLRRTGVCGSAETLLVDD
FT                   AAADRLLAPLIIALLDAGCEVRGDAATRAVDARVVPATEQDWATEYLDAIISAKVVPGV
FT                   AGAIAHIERYGSHHTDSIVTEDAATAETFLAEVDSAIVLHNASTQFADGGEFGMGAEIG
FT                   IATGRFHARGPVGVEQLTTFKYVVRGNGQTRPV"
FT   gene            281650..282279
FT                   /locus_tag="Rvan_0237"
FT   CDS_pept        281650..282279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0237"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; KEGG: rpt:Rpal_0160 nicotinic acid
FT                   mononucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69527"
FT                   /db_xref="GOA:E3I6G6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G6"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADP69527.1"
FT                   /translation="MTRHAGVSEADLRPPHAAPGMRIGLLGGSFNPPHAAHRLISLNAM
FT                   KRLGLDRVWWMVTPGNPLKDHRELAPLAERIAHARDVSRHPKIEVTAFEAAIGTAYTAA
FT                   ALRHLRRRMPRVRFVWLMGADNLAGFHRWNEWETIFETVPIAVEDRPHWRHRALASPAA
FT                   HRFARSRVPESYAAALPNLPTPAWAYLSGPLSKLSSTALRAQRRDR"
FT   gene            complement(282376..282621)
FT                   /locus_tag="Rvan_0238"
FT   CDS_pept        complement(282376..282621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69528"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69528.1"
FT                   /translation="MHDFVLHCLSDPMRCGENISQCLARIKDFIRVWKGVAPGRSNNFS
FT                   DSATIYATILAQTLRGREKLKIWAKKAKFFHMLELL"
FT   gene            282742..282966
FT                   /locus_tag="Rvan_0239"
FT   CDS_pept        282742..282966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_1708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69529"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G8"
FT                   /inference="similar to AA sequence:KEGG:Bind_1708"
FT                   /protein_id="ADP69529.1"
FT                   /translation="MSDAYVIELQGNAVGIIVRQKHEPNTFRFLSALHAFNDLEGREFA
FT                   SPFHAEKAARELWRQRPYIIPVRKGEKAA"
FT   gene            complement(283141..283593)
FT                   /locus_tag="Rvan_0240"
FT   CDS_pept        complement(283141..283593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0240"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bpr:GBP346_A1693 thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69530"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6G9"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADP69530.1"
FT                   /translation="MSDASKKHPASRADYPHHAPIQTRWMDNDVYGHVNNVTYYSYFDT
FT                   AVNRYLIEAGALDIETSAVIGLVVETSCRYRAPITFPEAVTAGIRVARIGTSSVRYEIG
FT                   LFRKDEDSACAEGHFIHVYVDRATRRPVPLPEALRAALAPLRASEN"
FT   gene            283648..284352
FT                   /locus_tag="Rvan_0241"
FT   CDS_pept        283648..284352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0241"
FT                   /product="protein of unknown function DUF1045"
FT                   /note="PFAM: protein of unknown function DUF1045; KEGG:
FT                   rsq:Rsph17025_0908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69531"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H0"
FT                   /inference="protein motif:PFAM:PF06299"
FT                   /protein_id="ADP69531.1"
FT                   /translation="MESTRLELDQGMTDRFRRYAIYWTPQQGSAFEAFGAAWFGGENCG
FT                   LDPELAARAKRAPARYGLHATLKAPFRLRSGATIDDMQRALDAFCRIRRAPEASPLGFI
FT                   RHQRYVVLSPGGRTAAIDWLAAECVTHFDSFRAPLTDADRAAGEIDTMTDRERAYLEDF
FT                   GYPYVLSEFRFHVSLAGPLETGEADAVRGALEPHLAPMLREPFRIEALTLLGEPEGGGA
FT                   FQILSRHRFRFT"
FT   gene            complement(284345..285595)
FT                   /locus_tag="Rvan_0242"
FT   CDS_pept        complement(284345..285595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0242"
FT                   /product="polyhydroxyalkanoate depolymerase, intracellular"
FT                   /note="KEGG: mlo:mll4552 intracellular PHB depolymerase;
FT                   TIGRFAM: polyhydroxyalkanoate depolymerase, intracellular;
FT                   PFAM: PHB de-polymerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69532"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H1"
FT                   /inference="protein motif:TFAM:TIGR01849"
FT                   /protein_id="ADP69532.1"
FT                   /translation="MLYHLYEFGHAAMSPARMAANSTRLMMRNPLNPFSYTELGRNAAA
FT                   AAELVERTTRRYKKPRFKLGSCTVGGESVAIAEEVVWKKPFCNLIHFKKAMPDGARHEA
FT                   PRVLMVAPLSGHYATLLRGTVEAMVPHADVYITDWTDARQVPLRAGGFDLDDYIDYIIE
FT                   MIELFRGDVHVMGVCQPGVPVMAAVALMEARKNPFAPKSVILKGSPIDTRVSPTGVNRL
FT                   AEERGTDWFRRTVVTSVPWPNAGAGRLVYPGFLQLTGFMAMNLDRHVRAHNDLFVDLVK
FT                   GDGDSVEKHKEFYDEYLAVMDLAAEYYIQTIDHVFVKHLLPKGEMRHRGHAVNLSAIRR
FT                   VALMTIEGEKDDITGHGQTEAAVHLCTGLSDAKKLHYTQPGVGHYGIFNGSRYRTEVVP
FT                   RVMSFIAEHDAGSAALR"
FT   gene            complement(285715..286341)
FT                   /locus_tag="Rvan_0243"
FT   CDS_pept        complement(285715..286341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0243"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   bja:blr1131 putative cytochrome c oxidase assembly factor
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69533"
FT                   /db_xref="GOA:E3I6H2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H2"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADP69533.1"
FT                   /translation="MKRKSVIVIALAFLCAAGAALYAISHFSNAGSTATKPLIGGAFSL
FT                   VDTNGKRVTDADFRGKLMLVFFGYTHCPDVCPTGLQQAADVLAKLGPDAGDVVPVFISV
FT                   DPARDTPPVMKSYVENFDPRIVGLTGDPAEVASAAKAYRVYFRKSGSGEDYSVDHSAFV
FT                   YLMDRHGKFITNFMFNAPIDVMVGELKKQIAAGTSRETVSPPTKS"
FT   sig_peptide     complement(286249..286341)
FT                   /locus_tag="Rvan_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 31"
FT   gene            286501..287829
FT                   /locus_tag="Rvan_0244"
FT   CDS_pept        286501..287829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0244"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: azc:AZC_4692 histidine kinase A; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69534"
FT                   /db_xref="GOA:E3I6H3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP69534.1"
FT                   /translation="MDIPRFPADSPRSQASRLRLRTTIRHRWFAVAGQTGTILLLYYGF
FT                   EFPVPLVACFVFILLSATLNLVLSLSFPRSQLLSTRYSAALLCFDMLQLTGLLLVTGGI
FT                   ENPFIFLLIVPVAVSASTQRLRVTVLLAALTVVLATILAIWHWPLPWAGEPPVLPPDYQ
FT                   VGLWAAVVSCIVFMAVYAWRIEQEAREMSQALSATEMVLARETRLTALDGLAAAAAHQL
FT                   GTPLSTITLVARELEREIPKDAPIREDIELLQTQAARCRDILSQLSRAGREEEQDEIFS
FT                   QMRLRHLLEEVVAPLRTPETDIIVTVKDTSPQGKTVAEPIILRNPGLMHSIENLIDNAA
FT                   EFANTCVTVDASYNAEEVKVRIRDDGPGFHPTVINRLGEPYVTNRPRDEAEDEEHGMGL
FT                   GFFIAKTLLERSGASISIANRTAPETGAIVEISWPRDRLAASL"
FT   gene            287937..288491
FT                   /locus_tag="Rvan_0245"
FT   CDS_pept        287937..288491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0245"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: azc:AZC_4693 transcriptional regulator; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69535"
FT                   /db_xref="GOA:E3I6H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP69535.1"
FT                   /translation="MATLASPEIRTDNSLLIVDDDKPFLSRLAKAMEARGYAVRTAETL
FT                   EAGKQAIREAAPAYAVVDMRLDDGNGLEVIKLLRETRPDCRSLVLTGYGNIATAVTAVK
FT                   LGAVDYLSKPADAEDILAALTASGETKPKPPENPMSADRVRWEHIQRVYELCNRNVSET
FT                   ARRLHMHRRTLQRILAKRAPK"
FT   gene            complement(288619..289092)
FT                   /locus_tag="Rvan_0246"
FT   CDS_pept        complement(288619..289092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0246"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rhi:NGR_c04170 putative cytidine and deoxycytidylate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69536"
FT                   /db_xref="GOA:E3I6H5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H5"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADP69536.1"
FT                   /translation="MQEALIEAERAAALGETPVGAVVVAPDGSIAGRGHNLVISVRDPF
FT                   GHAEMRAIRQACEAVQSERLPGYDLYVTLEPCTMCAAAISFARIRRLYFGAWDEKGGAV
FT                   ENGVRFFSAATCHHAPEIYGGIAQAEAAALLRAFFQERRDERAQVNASRTPRD"
FT   gene            complement(289208..290257)
FT                   /locus_tag="Rvan_0247"
FT   CDS_pept        complement(289208..290257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_1751 NADH dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69537"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H6"
FT                   /inference="similar to AA sequence:KEGG:HNE_1751"
FT                   /protein_id="ADP69537.1"
FT                   /translation="MRRERIIKAVNSLREALHAAQIRELLRVARTGQQADGVNRTQRIL
FT                   LAYNEFTRHYQQFGDEEKDLMTFFGLNPLLDLAFWSSLIDGEQSVNRKLLSDVDVGAYN
FT                   VIFVMPKLRELLTRDTDKGELVIADAQGVEREIRRVRVLIAEKERSLTDPQIVINVIRS
FT                   MDELYGSLSSLHPDMGVSLAIGSIDSGGAKSFDFFGAGVVMDDMSTLLVNVWDRVKYSP
FT                   EENFRYQIEVAMMAAGFVSRIKEAQAQQIIGEELAQRTMRVVAKSIETLFRSGAYTEEM
FT                   DAGREVRASNVLKPRTQLIEFKHEDRADVKRDDARPALDAAAVPMPKAADILRDLQDQL
FT                   DLKETAEAA"
FT   gene            290434..292836
FT                   /locus_tag="Rvan_0248"
FT   CDS_pept        290434..292836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0248"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69538"
FT                   /db_xref="GOA:E3I6H7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H7"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ADP69538.1"
FT                   /translation="MIGEKRVSVNGSIIESAALDVSPTDRVAVDGHPLPAREPPRLWRY
FT                   HKPKGRVTTHKDPEGRPTVFEALPDNLPRLISIGRLDFNTEGLLLLTNDGELARHMELP
FT                   STGWARRYRVRAFGEIDQASLDKLKNGVRIAGVNYGPVEASLERETGDNVWITLLIREG
FT                   KNREVRRIMEHLGLTVNRLIRISFGPFMLGDLEPGQVEEVKTSVLKDQLGPRLARSLGV
FT                   RREVVREEKRLSTPSRGKPTYLRRKEAEPERPRRAFEEPQMRRRRVLSEDASEAPIVEL
FT                   VPVPKPPRADRGERGEKRDFAPRDRGERSFDRPRDDAGGERRSFGRREDSGGERPAFPS
FT                   RADGDRAPRSARDGDGGERKPYPKRREGEGEGERRFNPRDAGDRPAFRKREGDRAERPS
FT                   RAGGGERPPFQRRESDAGAEHGGDAPKRTWAPRIDATTEDHSTPRFKRREEGGEGRPSR
FT                   PSDARGERRPFNRDARPEGRFDRKPRDGDAGGERRPFVRREDGAERPAFRSRSDGDRPA
FT                   FRSRSDGDRPARFARDGEGGERKSSTARPGFRSRDAGEGRADNRSAEGSGERRSFRPRE
FT                   GGGERKSFGPRDGADRPPFRKREGDRTDRPSRAAGEDRPRFRRSEDGGDSARGPRPDRA
FT                   PGDRPAYRSRSNEGGAGGERKSFDKPFRERREGAGDRAPQREGERQASGAPFEKRGGAG
FT                   GARTYGKKPFGSRDGAKSFSGRGGSGAGTGDKPFGARPSGAAGRDRSGGEGGEGKPFGA
FT                   RKTFGTRGGKPGGGAGGGKFGKPSTRRDGPSKPRTGGGPRKPRGDKA"
FT   gene            292833..293390
FT                   /locus_tag="Rvan_0249"
FT   CDS_pept        292833..293390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0249"
FT                   /product="methyltransferase"
FT                   /note="KEGG: rhi:NGR_c04190 putative methylase protein;
FT                   TIGRFAM: methyltransferase; PFAM: Conserved hypothetical
FT                   protein CHP00095"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69539"
FT                   /db_xref="GOA:E3I6H8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H8"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADP69539.1"
FT                   /translation="MRIVGGRFRGRGIAAPDGTTTRPTSDRVRESLFNILVHGIDGPPL
FT                   EGARVLDLFAGTGALGLEALSRGAAYCLFVEDEAAARGAIRENIEALGLTGASKLWRRD
FT                   ATKLGVAAPMQPFQLVFADPPYAKGLGELALNAALDGGWLAAGAICVLEERADVAVALP
FT                   EAFEPLDARIYGETALHFFRKG"
FT   gene            293484..294251
FT                   /locus_tag="Rvan_0250"
FT   CDS_pept        293484..294251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0250"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="KEGG: reu:Reut_A3459 trans-aconitate
FT                   2-methyltransferase; PFAM: Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69540"
FT                   /db_xref="GOA:E3I6H9"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6H9"
FT                   /inference="protein motif:PRIAM:2.1.1.144"
FT                   /protein_id="ADP69540.1"
FT                   /translation="MPWSSEQYLKFEDQRTRPARDLLNAVPAEVIARAADLGCGPGNST
FT                   ELIAGRFPEADIVGVDSSSDMLDAAKKRLPGVKFRFGRIEEWSEPGPWDLIYANASLQW
FT                   VGQHERLLPRLAERLSDGGLLAVQMPDNLAEPSHASLRTVAATPAYVAKLGKAIKLRSP
FT                   LPRAEWYYKLLKPYASRVDIWRTTYLHVMPSHDAIVEWVKGTGARPFLKPLDEDEQTAF
FT                   LAAYREELAKAYPALDDGTVLLPFPRFFLVATR"
FT   gene            complement(294261..294842)
FT                   /locus_tag="Rvan_0251"
FT   CDS_pept        complement(294261..294842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0251"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="PFAM: Conserved hypothetical protein CHP00730; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69541"
FT                   /db_xref="GOA:E3I6I0"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6I0"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADP69541.1"
FT                   /translation="MKRLCVFCGSSRGADPAYAEAARQLGAALAEADIGLVYGGAAVGL
FT                   MGILADACMEAGGTVTGVIPEALIRKEVGHAGLSDLRIVSSMHERKALMAELSDGFVAL
FT                   PGGIGTLEEIFEVWTWAQLSDHEKPCALLNVNGFYDGLSGFLDHVVAQGFLRPLHRDML
FT                   IVADEPGALLLAIEAYRAPAAVKWIGEEEY"
FT   gene            complement(295178..295831)
FT                   /locus_tag="Rvan_0252"
FT   CDS_pept        complement(295178..295831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0252"
FT                   /product="ribosomal protein L19"
FT                   /note="KEGG: ara:Arad_4429 50S ribosomal protein L19;
FT                   TIGRFAM: ribosomal protein L19; PFAM: ribosomal protein
FT                   L19"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69542"
FT                   /db_xref="GOA:E3I6I1"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6I1"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ADP69542.1"
FT                   /translation="MNIIQTLEKEQMAQLEAKRRIPTFQPGDTLRVNVKVVEGARERVQ
FT                   AYEGVCIARFGGGFQESFTVRKISYGEGVERVFPLYSPLIDSITVIRRGKVRRAKLYYL
FT                   RGLRGKAARIPERTDVRAKALKAEFKGFKRPKGNPDDLKLIKGLQAADEKRLAELNVIK
FT                   FEQLASFTDEEIALVDDYLKLGGRLEREDWPGQALKLLAETTADEVPAEDKAEA"
FT   gene            296041..296646
FT                   /locus_tag="Rvan_0253"
FT   CDS_pept        296041..296646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_10544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69543"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6I2"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_10544"
FT                   /protein_id="ADP69543.1"
FT                   /translation="MRHLYLRAPAAAFIALLALNSPASAGDQAKSIINSLDPKSMTELF
FT                   EVSRRQPDAALTNITPVSANTFRFLFIWPGSNPVMTYDRVGRSFAERFVGFADQLKLLV
FT                   RGFCLPTSHMFFGTASYGGEEVNVAYRDIQVRFRAGWQPDCAGRYLSVADVDRLFAPLP
FT                   VTGYGAALPYRPRPDKPTPPPQNDLKPFLNPAQPAPIQ"
FT   sig_peptide     296041..296118
FT                   /locus_tag="Rvan_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(296712..297800)
FT                   /locus_tag="Rvan_0254"
FT   CDS_pept        complement(296712..297800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0254"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bbt:BBta_7064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69544"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6I3"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADP69544.1"
FT                   /translation="MRNFRSKSVALVFGSAGLGLAILIATGVYQPGGSPAWSEPQPAAP
FT                   ATSLWAAAAPGRVEPKGRELRIAAPMPAAIKDVLVSADEHVKKGDLLFRLDDGELAARL
FT                   AAFEAQVAVKLADRDDAKVKGAALDRRKAEDAVYDAEREAFETRMDLDAALANRKLYKA
FT                   SEADVAKARTAVSTAADRVERERQKLRRVEERDLPKLTREEAALAAARAEVTGVAANLE
FT                   RLRVRAPADATVLKVDARTGEMAAAVAPLILLGDSEHMQARAEVEERDVRKVFVGQRAI
FT                   VKSEAFPDRIFDARVATMAKTLGSPELTSRGPRKHTDVDILEVVLDMDPGGPLLPGMRV
FT                   DVMFRDAESAEQTSLAKDATTR"
FT   sig_peptide     complement(297684..297800)
FT                   /locus_tag="Rvan_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.800 at
FT                   residue 39"
FT   gene            complement(297793..298581)
FT                   /locus_tag="Rvan_0255"
FT   CDS_pept        complement(297793..298581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0255"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbt:BBta_7063 putative ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69545"
FT                   /db_xref="GOA:E3I6Y0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69545.1"
FT                   /translation="MRAFPILEARQIVKELGQGEGKVQALKGVDLALYEGEFTLLMGPS
FT                   GSGKTTLLSILGCLLTPTSGTLTLGGEAVVHRSAEDLADLRRRHLGFIFQSYNLFPTLS
FT                   ALDNVRLGLDVRGFPSRECKERAAEALIEVGLGHRLKAYPGTLSGGEKQRVAIARAIAP
FT                   EPPVILADEPTAALDTENGHAIMELLSCVARKNGRAVLAVTHDPRTIPFADRVIEIEDG
FT                   IISGERKKHAATVIPARLRQPQAAHGTPAPYQERKRQAHA"
FT   gene            complement(298578..299693)
FT                   /locus_tag="Rvan_0256"
FT   CDS_pept        complement(298578..299693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0256"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bbt:BBta_7062 putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69546"
FT                   /db_xref="GOA:E3I6Y1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADP69546.1"
FT                   /translation="MVTKLAIRNLVHDRARFLVTLIGILFAVVLLAVQLGLYLGARKMI
FT                   VDTIDHANGDIWIAAYGSNSFEQATILHGRERFAALSVPGVSAVEPVVASFAPWTRDDT
FT                   STTSVVVVGSDGTLPPWNVAEGSVSALSPDGVAVDRTYADTLGISGVGSVAEINGQRLR
FT                   VDALTEGIRSFTTSPYIFMSLAKARELLSVPSDQATFYLVKVQPGVAVSSVKRALETKL
FT                   PGTSIFTKAEFRQTNLDYWLFGTGAGVALLGGAVLGLIIGTVVVAQTLYSSTKDHLAEF
FT                   ATLRALGSSSFYIHKVILTQATVSAFLGYALGIAVSFAVAQASLHTPMPIMLTPQLAAM
FT                   LLVVTVVMCAVSALSSIFKVTKIDPAMVFAR"
FT   gene            299983..300399
FT                   /locus_tag="Rvan_0257"
FT   CDS_pept        299983..300399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0257"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; KEGG:
FT                   transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69547"
FT                   /db_xref="GOA:E3I6Y2"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y2"
FT                   /inference="protein motif:TFAM:TIGR02420"
FT                   /protein_id="ADP69547.1"
FT                   /translation="MGAVDLPPDYRPSEDEPFMNERQRAYFRKKLLDWRDEILRESRET
FT                   LDFLQDSTQHPDITDRASHESDRGIELRARDRQRKLIAKIDAALVRIDDGSYGYCEETG
FT                   EPIGVKRLDARPVATLSLEAQERHERRERIYRDD"
FT   gene            complement(300472..302814)
FT                   /locus_tag="Rvan_0258"
FT   CDS_pept        complement(300472..302814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0258"
FT                   /product="malic protein NAD-binding protein"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; phosphate acetyl/butaryl transferase; KEGG:
FT                   mlo:mlr5329 malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69548"
FT                   /db_xref="GOA:E3I6Y3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y3"
FT                   /inference="protein motif:PFAM:PF03949"
FT                   /protein_id="ADP69548.1"
FT                   /translation="MSVSKNTSPTRPKAVSEGQTGENRHTTPVAAPPKFTRQEALQFHA
FT                   EGKPGKLEIVPTKPMATQRDLSLAYSPGVAVPVEAIAENPRLAYDYTAKGNLVAVISNG
FT                   TAILGLGNLGALASKPVMEGKAVLFKRFADVDAIDLEVDTQDVDAFINAVRYLGPSFGG
FT                   INLEDIKAPDCFIIEQRLRELMDIPVFHDDQHGTAIIAAAGLINAVHLTGRDIADVKLV
FT                   VNGAGSAGIACLELMKALGVRHENATLCDTSGVIYRGREKGMNQWKSAHAIDTKARTLA
FT                   DAIQGADVFFGLSAAGALTKEMVATMADKPIIFAMANPDPEITPEDVAEVRSDAIVATG
FT                   RSDYPNQVNNVLGFPYIFRGALDVQASTINEPMKIAAANALAELARADVPDAVAKVYGR
FT                   RLRYGPDYIIPAPFDPRLITAIPLAVAKAAMDSGVARRPIVDMEGYKVRLSARLDPAAG
FT                   FINSIHEALRLRPKRVVFAEGEEEQVVRAASSFANQKLGTPILIGREAQIRQAFFMAGV
FT                   NNVESFEQHNIATSEYNQQYAEFLYQRLQRKGYLYRDCLRLVHNERNVFAACMVAMGHA
FT                   DAMVTGVTRNWSTALQDVRRVLDPMPGRRVIGVSVIVTRGKVVLIADTSVHDMPNSQEL
FT                   ADIAVEAAGVASRFGLTPRVAMLAATTFGNPQSDRSDQLRGAVKLLDERGVDFEYDGEM
FT                   AADVALSRRAMSLYPFCRLSDTANVLIMPAFHAASIATKMLQELGGGIVIGPMLVGLSK
FT                   PVQIASLGSSDNDLVNMAALAAFDVTG"
FT   gene            303252..304097
FT                   /locus_tag="Rvan_0259"
FT   CDS_pept        303252..304097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0259"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   azl:AZL_f01070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69549"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y4"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADP69549.1"
FT                   /translation="MIGAFLVVLVLLFMPQSADAQRRSSQADAPKTFRDCSNCPEMVPL
FT                   PAGEFLMGSPETERGRNKDEGPQRRVSVPAFAAGKYEVTFAEYDACVADGACASKPADE
FT                   GWGRGRKPAINVSWDDAQAYVSWLSRTTGQPYRLLTEAEWEYAARGQTTVAERALPFST
FT                   GRTINYRQANYDANFVYPGGQQGEYRQKTTNVGSFQKNAFGLHDMHGNAWEWVEDCYRP
FT                   TYEGAPTDGTAVQDATCELRILRGGSWNYHPRLLRSAYRYATPGTIRLNSFGFRVARPL
FT                   "
FT   sig_peptide     303252..303314
FT                   /locus_tag="Rvan_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.824 at
FT                   residue 21"
FT   gene            304119..305747
FT                   /locus_tag="Rvan_0260"
FT   CDS_pept        304119..305747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0260"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpb:RPB_2782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69550"
FT                   /db_xref="GOA:E3I6Y5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR016915"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADP69550.1"
FT                   /translation="MKKFKLITSCAFVVLVVAGLSAPAPTPADARSNRYTDDDYTRPRF
FT                   GAAPVLAIVGLKQQRITVYDARGKMLESPVSSGATGYETPPGIYSIVQKKEEHHSNLYD
FT                   DASMPYMQRILWTGIALHEGVLPGYAASHGCIRLPGSFAQRLFGLTNMGMRVIVAREDI
FT                   APAPIAQPFLFGAREVAEESDGETSILGIPVSVGRDNGSDLLQRLRLSAMAKTGEAEAA
FT                   ARREKELKQIAQKKAVEAAPALKVVAAAERDVARAEADFAATAKLIEAADTDAKAEKAA
FT                   KAKESATTKLALAREKLAQATAQAEAKAAAASTAKQEAEAAEEAKSTAQDAADEAELNT
FT                   APVSVLISRKTHRLYIRKANQPIYEGPVSIRDDDKPIGSFVYTAVDTSRSGALNWTVVS
FT                   LYKDALNVEPYVKQKEPASKKKQPPAPPHATDVAAATAALDRLTVPQEALDKISAVVLP
FT                   GSSLIITDEAPSVETGKDTDFIVFMSGEPAGSMAIRKRAPSQGWARRGGETDFWGNPRP
FT                   RRYGGGGGGWSRGGGGGFPSFFGGF"
FT   sig_peptide     304119..304211
FT                   /locus_tag="Rvan_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.889 at
FT                   residue 31"
FT   gene            306120..307220
FT                   /locus_tag="Rvan_0261"
FT   CDS_pept        306120..307220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0261"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.5.1.72"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   KEGG: rpe:RPE_4400 quinolinate synthetase; PFAM:
FT                   Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69551"
FT                   /db_xref="GOA:E3I6Y6"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y6"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ADP69551.1"
FT                   /translation="MAFLDSGVEPIRRQRGADPVRALDADIDIEPARHHFDAAFVREAI
FT                   RELKPVYAKVERVIPSFEWAAHAPYIKAIRDLKREKNAVILAHNYMTPEIFHGVGDILG
FT                   DSLQLAKEAAKTDADIIVQCGVHFMAETSKLMCPEKKILIPDPKAGCSLASSITAEDVR
FT                   ALRAAYPGVPVVTYVNTSAAVKAECDICCTSANAVKVVESLGAPRVLLIPDQYLARYVA
FT                   TQTKVEIISWKGACEVHERFTGAELRGYREAEPNVKIIAHPECPPDVIAEADYTGSTAG
FT                   MIMWVTDHQPKRVVLVTECSMADNVAYAAPKTEFTRPCNLCPHMKRISLPKILDSLLYE
FT                   KVEVTVDPAVAARARLAVERMVKLPL"
FT   gene            307465..309117
FT                   /locus_tag="Rvan_0262"
FT   CDS_pept        307465..309117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0262"
FT                   /product="L-aspartate oxidase"
FT                   /note="KEGG: oca:OCAR_6943 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69552"
FT                   /db_xref="GOA:E3I6Y7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y7"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ADP69552.1"
FT                   /translation="MIDTRAKDLLPFRRRTGPDRVLVVGGGLAGLFTALRLAPLPVTVL
FT                   TPKPLGEGSSSAWAQGGIAAAIGAGDDADSHAADTIAAGAGLTDPEVARVVTSEAGDRI
FT                   RDLLSYGVPFDRELDGKLRLSQEAAHSARRIVRVDGDRAGKAVMAALIATVAKTPSISV
FT                   LENVEAVELVKRDGRVVGLYATRSGSHGRASFLAGRAVVLATGGIGQLFRVTTNPAEAR
FT                   GGGLAMAARAGAIIADPEFVQFHPTAFDVSRDPAPLASEAIRGDGGRLVNRDGERFMLA
FT                   IDPRGELAPRDVVARGVHREIAAGRGAFLDVRALDLARSFPTAYEVCTEAGIDPANQPI
FT                   PIAPAAHYHMGGVSTDMRGRTSVTGLWACGEVACTGLHGANRLASNSLLEAVVFAARVA
FT                   DDIAADAPHWPAMGEIEAPETIAVPVVEPAEEARLLKRLREVMATHVGVERTAATLKAA
FT                   LQSVVDISRMAASPALANMAASAILIASAAHERKESRGAHCRLDFPAAKERSRHTFMTL
FT                   TDAVGIAARVTGKSAFDAEDARVVRARAADLAG"
FT   gene            complement(309281..315265)
FT                   /locus_tag="Rvan_0263"
FT   CDS_pept        complement(309281..315265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0263"
FT                   /product="putative DNA helicase"
FT                   /note="KEGG: mrd:Mrad2831_4673 putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69553"
FT                   /db_xref="GOA:E3I6Y8"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y8"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_4673"
FT                   /protein_id="ADP69553.1"
FT                   /translation="MMIGPSIDDTDLPAPSVKLRANVAPHINLAFQVNSIPAVGEIEIA
FT                   NETDGDFSDVAISITSEPAFLKPKALRLDRLRAGDTRSISPVDVDLDPAFLNRLTEAAD
FT                   GEIRISVRAGDESLAAITIPCRALAPTEWTGLSTPPELVAAFVRPNDPAVEVILRNAAE
FT                   KLRLHGRNSALDGYAGNRKGRSWEVAEAIWAALVDAKIVYALPPSSFEQDGQKIRMPGA
FT                   ILERKLGTCLDLTLLYAACLEQAGLNPIVGFVTGHAFCGLWLTPDAFSSCVVDEAETVR
FT                   KRLQLQEMILIETTLLTNHPPLKFRTAVDKAASYANEDEPRRFELVVDIAQARQRRIRP
FT                   LGVELDGQQDALPVTAEAGESVGLDEPPSFMEEAAKPAEPDQPLDRVEQWKRKLLDLSL
FT                   RNRLLNFKSGKSAVDLFCPDAGALEDRLASGDTIKILATADVMSGDDPRDAEVYQLKAG
FT                   EDAARQHALEALLRGEVLTALSDDELQDRLTEIHHAARSSLEESGANSLHLAIGFLSWS
FT                   PAGKDQRCRAPLLLVPVRLERRTIRSGFRLVRHDDDARINPTLLQMLRQDFGLDMPEFE
FT                   RDLPSDASGLDVAQIWRIARQQIKDMKGFELTEEVTLSNFSFAKYLMWKDLVDRAELLK
FT                   RNAVVRHLIDTPKDTYGDPRDMPEERALDREIHPKDLFMPLLADSSQTAAVVAASRAKD
FT                   FVLFGPPGTGKSQTIANMIAQLLGDGRSVLFVSQKTTALEVVRKRLNDIGLGSFCLEVH
FT                   SAKAQKTAVLAQLKTAWESRAADAANEWDAATGDLKALRDKLNEVVLALHRRHGNGLSV
FT                   HKALGRVIAHRDFAPKLKLSFASPDQHDQAAMRALRDLCRSLRTAVQALGTAPANHPLK
FT                   EIGHADWSPVWRGELEAACGAFRKSVVDLSSAGAVLAKHFGTSETEDPHRLYSMIVLAA
FT                   LAFKPEAQDAAALTGRDIRALKPVFEAWRKDRAACDAARARLANRYRDAVFSLDLGRLM
FT                   QDWRDALAASFLTRNGRKKRVWDALAPFTNGDSPEDVGAEIVGLMELKEARAKAMRHDA
FT                   TLGALGAIWQGLETDPARVEAAFAWLAQVTDAAASLANTERDKAGWLACIAALILDRPD
FT                   FMREGGRFATDAGKTLTAYKAFQAVRKELVHLAHLSDDYFGLPRSAHWLREAASLAETW
FT                   EANAPKTQRWCDWLRHAAAARARGLAPLIDALTAGNIVASDIDIAFEVAYARWWVEQTV
FT                   HRDALLRGFVSNQHEDAIARFIELDHKVAQLARHVVVARLSGAVPARNAFGQDPEFGVL
FT                   SREIEKRARHMPLRRLFSQLPNALTALTPCVMMSPLSVAQFLPADSQPFDVVIFDEASQ
FT                   IPVWDAIGAIARGKQVVVAGDPKQLPPTSFFDRGSNATEDASEVEDLESILDECLAANI
FT                   PSKRLAWHYRSRHESLIAFSNEKYYDGSLVTFPSPVTEDRAVRFMHVPDGVYERGSGRV
FT                   NRQEAHAVVADVVRRLSDPAFAASGSSLGIVTFNGEQQRLIETLLDKERREKPELERFF
FT                   GAEWSEPVFVKNLENVQGDERDVILFSIAYGPDQAGKVSVQISTLNKDGGTRRLNVAIT
FT                   RARSELVVFATLRPDQIDLSRTKAAGIRDFKHFLEYAERGPRALATASEPLGDTESPFE
FT                   DAVKKALEQKGWQVHPQVGVSGFRVDLGVVHPDAPGRYLAGVECDGATYHRSATARDRD
FT                   RLREGVLRNLGWRILRVWSTDWWVDPDSAFAHLNARLTEHLECDRTAEMAKLQEIPIEA
FT                   AAAPVEAVLALISDTPPDDAPSPPESAVPAEEADAVEAEEDAPPQSTIYAGRADGEQLT
FT                   FLVTDAAGYRAADLAAAGFAPDRDGFYETWYRPTLRKMVAHVIETEGPVFDDVLVRRIA
FT                   RAHGFDRAAGRIRETVLDVIERRFPRSTEDGRKIYWPENADKSRLPRFRASSAELRDHT
FT                   DIPLPELAALAERFLAEGAKPDEAAIMLARHMGIGRLREAARERFLAAAHHAVRYQQEL
FT                   SD"
FT   gene            complement(315516..315587)
FT                   /pseudo
FT                   /locus_tag="Rvan_0264"
FT   gene            complement(315814..317364)
FT                   /locus_tag="Rvan_0265"
FT   CDS_pept        complement(315814..317364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0265"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="KEGG: rpa:RPA0082 2-polyprenylphenol 6-hydroxylase;
FT                   TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM: ABC-1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69554"
FT                   /db_xref="GOA:E3I6Y9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Y9"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ADP69554.1"
FT                   /translation="MFKAIRNTYRLTKAGATLARYGVGFVPDYVTLPAPLRILRADERE
FT                   SAAKRQARGERLAKAIRALGPTYIKLGQFLATRPDVVGPHLANALGSLRDRLPPFSVDK
FT                   AHHEIEAAFNRRWQEVFAEFGPPLAAASIAQVHKAAVRTPGGNTRAVAVKILRPDIEKR
FT                   FERDLESFYFAAHTAERVSQPMRRLRPVAAVDTLAQSVVLEMDLRLEAAAISEMADNIA
FT                   KSGDVGFRVPRVDWERTSKRVLTLDWIDGIPLTDIEAVRAAGVDMEALGLTVIQSFLKH
FT                   AIRDGFFHADMHQGNLFVDPRDGALIAVDFGIMGRLGPKEQRFLAEILYGFITRNYYRA
FT                   SEIHFEAGYVPANQSVAAFGQALRAIGEPIMGRPSEEISMARLLSQLFENTEVFQMKMR
FT                   PELLLLQKTMVVVEGVARSLDPKLNIWVAAEPIVREWLTGQLGPRAQIRDAVSNVGALA
FT                   IALKHAPDLIERGAKIVDALDPDKPREASPQPSRWPIALPLWLATGALLAIAAKLLFP"
FT   gene            complement(317550..318338)
FT                   /locus_tag="Rvan_0266"
FT   CDS_pept        complement(317550..318338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0266"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="KEGG: exodeoxyribonuclease III; TIGRFAM:
FT                   exodeoxyribonuclease III Xth; exodeoxyribonuclease III;
FT                   PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69555"
FT                   /db_xref="GOA:E3I6Z0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z0"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADP69555.1"
FT                   /translation="MLTVATWNVNSIKQREIAAVQWLKRARPDVLCLQEIKCQTEAFPR
FT                   GAFEDLGYNCAVIGQKSFNGVAILSKFPIDETVVGLPGDDTDEQSRYIEAVLSLPGGGA
FT                   FRVASVYAPNGNPVASPKLDYKLEWLARFKAHAETLLSYEEPFALAGDYNIIPRGIDVY
FT                   NPAAWTEDALYRLESRQAFRRILNLGLADAVEACNSGGGQFTFWDYQAGAWQKNLGLRI
FT                   DHILLSPQAFSRLRSTVIDRTPRSWDKPSDHTPVQVTLGM"
FT   gene            complement(318345..318680)
FT                   /locus_tag="Rvan_0267"
FT   CDS_pept        complement(318345..318680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0267"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: oan:Oant_2353 iron-sulfur cluster assembly
FT                   accessory protein; TIGRFAM: iron-sulfur cluster assembly
FT                   accessory protein; PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69556"
FT                   /db_xref="GOA:E3I6Z1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z1"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADP69556.1"
FT                   /translation="MTTEVNISVSERAANRIREIVGSAQGENALRISVQGGGCSGFSYN
FT                   FEIVLEAAADDIVIEKSGARVVIDPVSVPFMAGSEIDFIDDLMGSSFKITNPNATASCG
FT                   CGTSFSI"
FT   gene            318791..319990
FT                   /locus_tag="Rvan_0268"
FT   CDS_pept        318791..319990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0268"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase; PFAM: metal-dependent phosphohydrolase
FT                   HD sub domain; KEGG: met:M446_2467
FT                   deoxyguanosinetriphosphate triphosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69557"
FT                   /db_xref="GOA:E3I6Z2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z2"
FT                   /inference="protein motif:TFAM:TIGR01353"
FT                   /protein_id="ADP69557.1"
FT                   /translation="MMELAPYAAHAEMSVGRLHSESPCPTRDVYQRDRDRIVHSTAFRR
FT                   LIHKTQVFIYHEGDHYRTRLTHTLEVAQIARTLARALALNEDLTEAIALAHDLGHPPFG
FT                   HAGEDALNAAMAAIGGFDHNAQSLRIVTLLEHRYAAFCGMNLTFETLEGIVKHNGPLVT
FT                   ADGLPVARHAESGLPLAIRAYAREQDLRLDTQAPLEGQIAALADDIAYNNHDIDDGFRA
FT                   GYITVREMEEVPLVARMLAEVRDRYGDLADAPLVYEMNRRMVAAMVQDVLAETRARIAA
FT                   AAPASIEAVRTAPAPLAQFSDDMAASIADLRRFLFARVYKHRDIVKKMTDAQAILRELY
FT                   DYFAANPAEMHLEATRVASLSDDTARLRAAGDFVAGMTDMFAIKAYAAIRSGLAKAAPR
FT                   "
FT   gene            complement(320037..321068)
FT                   /locus_tag="Rvan_0269"
FT   CDS_pept        complement(320037..321068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0269"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="KEGG: mgm:Mmc1_2527 cytochrome-c peroxidase; PFAM:
FT                   Di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69558"
FT                   /db_xref="GOA:E3I6Z3"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z3"
FT                   /inference="protein motif:PRIAM:1.11.1.5"
FT                   /protein_id="ADP69558.1"
FT                   /translation="MKRIFSLALGLGLMLPTVASADDLRADANAVFKPIPSVVPAVKDN
FT                   AVTHEKVELGKMLFFDPRLSRSQIISCNSCHNLGTGGVDAGPTSIGHGWQKGPRRAPTV
FT                   LNSVFNIAQFWDGRAEDLKAQAKGPVQASVEMNNTPANVVATLAAMPGYVDAFKKAFPR
FT                   EKEPITFDNFAKAIEAFEATLITPAARFDQFLEGSETAFDDAEKKGLRLFMDKGCAACH
FT                   NGINVGGNGYYPFGVIQKPGAEILPLGDKGRFAVSKTASDEYVFRAAPLRNVALRAPYF
FT                   HSGQVWSLEQAVAVMGDSQLGEKLTDEDTKLIVAFLKTLTGEQPRVEMPILPVRTKDVP
FT                   KPE"
FT   sig_peptide     complement(321003..321068)
FT                   /locus_tag="Rvan_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            complement(321525..321743)
FT                   /locus_tag="Rvan_0270"
FT   CDS_pept        complement(321525..321743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nhl:Nhal_1542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69559"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z4"
FT                   /inference="similar to AA sequence:KEGG:Nhal_1542"
FT                   /protein_id="ADP69559.1"
FT                   /translation="MKRAAAFALVCLLATNAEATTTTYKIRDVCKFDMEQYCKDIKAKR
FT                   LRDLKACLAKNERNLLPRCQDHYKEAN"
FT   sig_peptide     complement(321684..321743)
FT                   /locus_tag="Rvan_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 20"
FT   gene            complement(321972..322448)
FT                   /locus_tag="Rvan_0271"
FT   CDS_pept        complement(321972..322448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69560"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z5"
FT                   /inference="similar to AA sequence:KEGG:Dole_0419"
FT                   /protein_id="ADP69560.1"
FT                   /translation="MPALAARLLFLAVLLPFSLPALALDDTPQNREAQADRYLAAVPPK
FT                   SQIADTVAGIAETLPPEQQEQFKTLMIKYFDIGKVSVAIRQAMVKTFTADELKALADFY
FT                   GSEVAKSAVGKMDAYRNEVLPATEQELQAALGKVQAELHPQKAGDEKPAEEQKK"
FT   sig_peptide     complement(322377..322448)
FT                   /locus_tag="Rvan_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            322625..324025
FT                   /locus_tag="Rvan_0272"
FT   CDS_pept        322625..324025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0272"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; KEGG: oan:Oant_0822
FT                   S-adenosyl-L-homocysteine hydrolase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69561"
FT                   /db_xref="GOA:E3I6Z6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z6"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADP69561.1"
FT                   /translation="MSNDFLVKDLSLADWGRKEMDIAETEMPGLMAVREKFGKEQPLKG
FT                   ARVAGCLHMTIQTAVLIESLQALGADVRWASCNIFSTQDHAAAAIAARGTPVFAIKGET
FT                   LDEYWDYVDRILEWPNGETANMILDDGGDATLIVLLGAEAETNPAVLENPHSEEEASLF
FT                   KTIKARLAKTPGWYSKVKANIKGVSEETTTGVLRLYQMEKKGTLAFPAINVNDSVTKSK
FT                   FDNRYGCRESLVDGIRRATDVMMAGKVAVVCGYGDVGKGSAQSLRGAGARVVVTEIDPI
FT                   CALQAAMDGFSVQTLDDVADKADIFVTATGNKDVITLEHMRKMKDMSIVCNIGHFDNEI
FT                   QIANLKNYKWTNVKPQVDMIEFPGGNRILLLSEGRLVNLGNATGHPSFVMSASFSNQVL
FT                   AQIELWTNVGKGKYENKVYVLPKHLDEMVARLHLEKLGVHLTQLSKEQADYIGVPLEGP
FT                   FKSDLYKY"
FT   gene            complement(324215..324976)
FT                   /locus_tag="Rvan_0273"
FT   CDS_pept        complement(324215..324976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0273"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: rpb:RPB_0700 DNA repair protein RadC; TIGRFAM:
FT                   DNA repair protein RadC; PFAM: DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69562"
FT                   /db_xref="GOA:E3I6Z7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z7"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ADP69562.1"
FT                   /translation="MANCFEESPLFELLSLEAGASVPPPQPPRPKPHYWGHRDRLRKRF
FT                   LEGGADPLPDYELLELVLFRAIARRDVKPLAKDLLARFGSFGEVMNAPRDRLLEVEGVT
FT                   EAVVTEFRVVQAAALRTAQGEVKKRPIFAAMSTVLDYLRSAMAFEDREQFRILFLDRRN
FT                   KLIADEVQSRGTIDHTSVYTREVVKRALELSASAVILAHNHPSGDPTPSRADIEMTKEI
FT                   AEVGSKLGVTVHDHIILGRDGHLSLKSVGAF"
FT   gene            complement(325200..325781)
FT                   /locus_tag="Rvan_0274"
FT   CDS_pept        complement(325200..325781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0274"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="PFAM: Conserved hypothetical protein CHP00730; KEGG:
FT                   met:M446_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69563"
FT                   /db_xref="GOA:E3I6Z8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z8"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADP69563.1"
FT                   /translation="MKRLCVYCGSGSGIDPRFLDAARTLGRTMAEAQIGLVYGGGGNGM
FT                   MGTVAQTVIDHGGHVTGIIPASLLEIENALETISERYVTSGFHERKMLMFNLSDGFVAL
FT                   PGGVGTLEELVEQLTWTQLGHHDKPVFIVNTAGYWDLLLAMFDRMREQLFIRPGLDTRY
FT                   IVVEKAEDVVPFFLKHRPSKKAPPPTLIRA"
FT   gene            325980..327974
FT                   /locus_tag="Rvan_0275"
FT   CDS_pept        325980..327974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0275"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bra:BRADO4693 multidrug ABC transporter
FT                   ATPase/permease; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69564"
FT                   /db_xref="GOA:E3I6Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E3I6Z9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69564.1"
FT                   /translation="MHHHASRSVPPEKHGKTDHKAIFRYLLPFAWPKGRADLKARLVLA
FT                   AVVLVAAKVVTVFMPVTYKYAVDALTAMPKTDGAQAAWTLAAVPLFMTLAYAGARIAMT
FT                   GFQQLRDVLFAPIEQNATRMLTTSAFRHVHDLSLRFHLDRKTGGLTRVFDRGKIAVDLI
FT                   IRMGVLNLVPTILEVLFVCLLFGFYFGWTFVAIVLGMIVIYTWYSIAVSEKRIAIRREY
FT                   IEADTDATTKAVDSLLNYETVKYFGNERWEADRFDRSMRRYERASIKTATSLAALNFGQ
FT                   TVIFTLGMVTAMALSAHGVATGAMTVGDFVLINAVFIQLYQPLNLMGVIYREIKQAFVD
FT                   IEALFELIGQKPEVKDKPGAKPLIVGAGAIRFDNVTFSYDGVRPILRGVDFEVPPGHMV
FT                   ALVGPSGAGKSTISRLLYRFYDVKTGRITIDGQDVRDVTQESLRAAIGIVPQDTVLFND
FT                   TIEYNIRYGRVDATDTEIREAARMAQIDGFIKQLPLGYKSMVGERGLKLSGGEKQRVAI
FT                   ARTILKGPPILILDEATSALDSFTEKEIQSALDSVAKGRTTLVIAHRLSTVIGADTILV
FT                   LDKGRIVERGTHASLLEARGLYAALWTRQQEAEEARRKLAEMVEEGALPTVEPNASGAA
FT                   VPAHMREVQSRRSCDLEETADDKVVVSRT"
FT   gene            328122..328904
FT                   /locus_tag="Rvan_0276"
FT   CDS_pept        328122..328904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_3726 outer membrane protein Omp31
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69565"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E3I700"
FT                   /inference="similar to AA sequence:KEGG:AZC_3726"
FT                   /protein_id="ADP69565.1"
FT                   /translation="MSVVKSVGGAALGMFLAAQVAYAADPYYGGGYGGYGGYKDPYPPQ
FT                   PVAPIPLWQGFYIGGNIGGAWSTIETASNVVFVNGATTVLSDRSVEGSGFLGGLQLGYN
FT                   IPIGNFLWGIEGDLGGLGNDASKSFAVGGVLPSVLTVSSDGGWYGDVTVRGGFLYGNAL
FT                   IYLKGGFGFYTGETNVTLVTDNISALRQSSGTFTGWTLGGGLEYQVSPRWSIKAEYLYF
FT                   DFGDSTLNFDDRQFNNDMSVNTFKIGFNVFLNGVGPLY"
FT   sig_peptide     328122..328193
FT                   /locus_tag="Rvan_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(328923..330104)
FT                   /locus_tag="Rvan_0277"
FT   CDS_pept        complement(328923..330104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0277"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bra:BRADO5110 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69566"
FT                   /db_xref="GOA:E3I701"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3I701"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP69566.1"
FT                   /translation="MPVLSAGSSRLGVILALGTTQTLAWASSYYLLAILAGPIAASTGM
FT                   SANGVFAAFSFSLLISALVGPRVGRTIDRFGGRTVLMLSNAFFAAGLFVMAGASDWVWV
FT                   WLAWAFMGAGMGFGLYDAAFATLARIYGATARPAITGVTLMGGLASTVGWPLTAWGLAA
FT                   VGWRETCVIWAFAHLFIGVPLNAMLPRVRGDLPSPANPAPRIEIDRTMILLGFAFAAGW
FT                   TISTGMAAHLPHLLQDLGATGTQAIAAGMLIGPAQVAARIAEATLFKRAHPLTSARLSA
FT                   GLHPLGAALLFFGMPGIAIFALLHGAGNGILTIARGTVPLAIYGPENYGYRLGILGVPS
FT                   RMAQAASPLLFGLLIEALGAGTFVVSAVIMLAALAAFCLVQTEPVKGHGDERG"
FT   gene            330406..330624
FT                   /locus_tag="Rvan_0278"
FT   CDS_pept        330406..330624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0278"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: pla:Plav_0526 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69567"
FT                   /db_xref="GOA:E3I702"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E3I702"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADP69567.1"
FT                   /translation="MSKEELLEFPGIISELLPNATFRVKLDNGHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   gene            330584..331324
FT                   /locus_tag="Rvan_0279"
FT   CDS_pept        330584..331324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0279"
FT                   /product="maf protein"
FT                   /note="KEGG: rpd:RPD_4276 Maf-like protein; TIGRFAM: maf
FT                   protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69568"
FT                   /db_xref="GOA:E3I703"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E3I703"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADP69568.1"
FT                   /translation="MILPRDASLIASNRGSILSSKQQPEERGHPAAVQSAARKLLVLAS
FT                   ASPRRLALLEQVGIEPDALRPASIDETPKRGEAPRSYAQRLARQKALTARERLEREPNL
FT                   GGAFVLAADTVVAVNRKIIGKPEYLNEAAAALQTLSGRSHRVFTSVCLITDTGSVKMRT
FT                   VETRVRFKRLSAEELDSYLACGEWRGKAGGYAIQGIAGAFVQKIVGSYTNVVGLPLIEV
FT                   VQLLTGEGFPVYFNWLNRAEVDSL"
FT   gene            331327..331524
FT                   /locus_tag="Rvan_0280"
FT   CDS_pept        331327..331524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0280"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   msl:Msil_0756 protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69569"
FT                   /db_xref="GOA:E3I704"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:E3I704"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ADP69569.1"
FT                   /translation="MTEDRDEKAEGAPPCVICGMRPQVPEYRPFCSRRCADVDLHRWLG
FT                   GVYAIPVKPEEEEDEGDATG"
FT   gene            331642..331863
FT                   /locus_tag="Rvan_0281"
FT   CDS_pept        331642..331863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69570"
FT                   /db_xref="UniProtKB/TrEMBL:E3I705"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69570.1"
FT                   /translation="MPLVRKSSPGARSIESDDALGMTKAISKPEGSRSPCTLRQPIETM
FT                   VDNGRKGGQAFALHKFCSSRLCFSEPSS"
FT   gene            331907..331992
FT                   /locus_tag="Rvan_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            331907..331992
FT                   /locus_tag="Rvan_R0003"
FT                   /product="tRNA-Leu"
FT   gene            332009..333112
FT                   /locus_tag="Rvan_0282"
FT   CDS_pept        332009..333112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0282"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69571"
FT                   /db_xref="GOA:E3I706"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I706"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADP69571.1"
FT                   /translation="MYASLSKKTQLILCGMAAFLFGAQGAVAGPALLTEPATGLVLYAE
FT                   DADLPWRPASLTKLMTAYLTFEAIRDGRLSPEDMLTSTALSRSQPPSKFGLPLGAQIKV
FT                   DLAIKALIVKSANDVAIMLAEKIGGSSEAFVDQMNRTAKRLGMTNTKFVNPNGLPQFNP
FT                   DGTETPEQAVTTARDMALLSNMILKEFPQYTPIFSMTEVRVGNRLLTSHNGILKSYDGA
FT                   DGMKTGFVCAAGYNVVASATRNGRQLVAVVLGERSSGARTIRAAALFEHGFEIYPWKAV
FT                   LAPTLATWPVETPEGAQPADMRGIVCSGRKPAVSAKQKSKRPASQPGHGASTAKPKAAH
FT                   APGDKKKPAPKAAHPAAASPAAARTNG"
FT   sig_peptide     332009..332095
FT                   /locus_tag="Rvan_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.958 at
FT                   residue 29"
FT   gene            complement(332992..333492)
FT                   /locus_tag="Rvan_0283"
FT   CDS_pept        complement(332992..333492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1654 ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69572"
FT                   /db_xref="GOA:E3I707"
FT                   /db_xref="UniProtKB/TrEMBL:E3I707"
FT                   /inference="similar to AA sequence:KEGG:Bcav_1654"
FT                   /protein_id="ADP69572.1"
FT                   /translation="MEPVKRSHVRQIMRPPTSCVSGRGTTACFFDQLSASSSPIQARGS
FT                   KVMRVVIRTRLALSVGRHVQRTSGSVAPKAALRFRDISFYASCCVGLIVAGLLRTAKRF
FT                   RRRSTEADCLAFGVGNTGRSPSVYPFVRAAAGLAAAGCAAFGAGFFLSPGACAAFGFAV
FT                   DAP"
FT   gene            333725..333991
FT                   /locus_tag="Rvan_0284"
FT   CDS_pept        333725..333991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0284"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mes:Meso_2258 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69573"
FT                   /db_xref="GOA:E3I708"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3I708"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADP69573.1"
FT                   /translation="MLTGAQLRAARSLIGIDQKTLADQAGVSLPTVQRMEASPGIVRGV
FT                   VDSLTKIVEALDRAGVELIGEGAVSGGGGRGVRLKKPLERAEE"
FT   gene            333988..336006
FT                   /locus_tag="Rvan_0285"
FT   CDS_pept        333988..336006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0285"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: bja:blr6339 hydrogenase 4 subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69574"
FT                   /db_xref="GOA:E3I709"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E3I709"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADP69574.1"
FT                   /translation="MTGAGWQLQALFVALAIYAGAALAAVFLPRRRLGFVYAASAAAAS
FT                   LAIAADVSAFFNEVLLKEHLPIGLPGVGLHIRLDGLSAFFGFIVNVGVLMASIYGAGIK
FT                   RDDLSRRIEPLYPAFCAAMNAVLLADDAFGFLFFWELMSLSSWALVVSRHDDPDNRKAG
FT                   YVYLLMAAGGTMALLFAFGGLAGASGGYAFDTMRASHLTPLVSALVLGAALFGAGSKAG
FT                   IMPLHAWLPLAHPAAPSHVSALMSGVMTKVAIYALIRVVFDLLGDPQWWWSLPFILLGA
FT                   ASAVGALLYAVQDQDLKRLLAYSTIENVGIIFAGIGLAIAFKSSHIPPAAGIALAAALI
FT                   HALNHSWFKSLLFLGAGAVLHSTGTKQLDRLGGLIHRMPKTSAFWLIGALAISALPPLN
FT                   GFVSEWLLFQAVLTGPVFPEPILRFLSPVLGAMLALAAGLAAACFVRAYGTVFLGRPRS
FT                   PEAANAHEAPFAQTLAIGLLAVLCILGGLFGGLTAFALNPLLVEYAGAAAAINTQTGPT
FT                   PFSLIAFDQGRAIYDAPTIAFFVAVSAFATMAAIHLFASKKTRRSPAWDCGFPDPSPAT
FT                   QYTASSYSQPLRRVYGGVVYSSTETVDMPPPGSLREGHFNIRFTDYIWRFLYVMPANAL
FT                   WSLSERFDLIHYLTIRRYLVLMFSTLIVLLVITATFM"
FT   gene            336006..336971
FT                   /locus_tag="Rvan_0286"
FT   CDS_pept        336006..336971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0286"
FT                   /product="NADH dehydrogenase"
FT                   /note="KEGG: bid:Bind_2475 NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69575"
FT                   /db_xref="GOA:E3I710"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:E3I710"
FT                   /inference="similar to AA sequence:KEGG:Bind_2475"
FT                   /protein_id="ADP69575.1"
FT                   /translation="MPATLQSFVAQGAQMFFVLAIAPAVTGITRKVKARLMRRRGPSLF
FT                   QPYRDLLKLVRKESVLAPNATWFFRSAPYMIFAFTWVAAALVPTLASGLMFNWAADVVA
FT                   LVALIGAARALLALAAMDAGTAFGGIGSSREMMIASLAEPASLLVALTIAFAAGTTRLP
FT                   EVAQFLITQPLEIRVSFALAFVALVIVAMAENARIPVDNPATHLELTMVHEAMVLEYSG
FT                   RHLAMIEAAGHLKLTLYISLIICLFLPFGMAPFDGSAGAWAIGIGSYLAKLMLAAVALG
FT                   VWEVSIAKMRVFRVSEFLGGAFTFAFLAILLEFLSREVQR"
FT   gene            336968..337633
FT                   /locus_tag="Rvan_0287"
FT   CDS_pept        336968..337633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0287"
FT                   /product="putative hydrogenase-4 component E"
FT                   /note="KEGG: xau:Xaut_0168 putative hydrogenase-4 component
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69576"
FT                   /db_xref="GOA:E3I711"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:E3I711"
FT                   /inference="similar to AA sequence:KEGG:Xaut_0168"
FT                   /protein_id="ADP69576.1"
FT                   /translation="MTNAYDVAHFLAGMMLVCSFTLLYQDRILAVLNTFAVQAIMLSLA
FT                   VAWQGYVRNAPDLFITAAMAFGLKGIIIPVALNRMVEKLGIKRDVDQVVNVGVAMFLGL
FT                   GLTSLALLLVLKVTPGAASFTREGLALALAIILLGLLQMILRRNAVTQIVGFMSIENGL
FT                   ILAATGARGMPLVVEVSVAFSVLIALFVFAVFLFRIRERFDSVDVESLDKVRAARAHR"
FT   gene            337630..339066
FT                   /locus_tag="Rvan_0288"
FT   CDS_pept        337630..339066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0288"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: rpe:RPE_0955 hydrogenase 4 subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69577"
FT                   /db_xref="GOA:E3I712"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E3I712"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADP69577.1"
FT                   /translation="MNEAVYAVVGIPFLSAILLALIPSYRVTALGNVLASGLTFVAGLS
FT                   FLTLPPVTETYVILDDLNKFFIILNTLVGFTTSLFSRSYIGHEIETGHLTPLFVRFYHA
FT                   MFQGMMGAMNLALLANNIGLMWVGLEFATLMTVIMVGIYRTPAALEAAWKYFILGIVGI
FT                   SLAFFGTILVYLTGQGVLGEGEAAMTWSELIKIAPQLDAPLLNIAFIFLLVGYGTKVGL
FT                   APLHAWLPDAHAEGPTPISAVLSGLLLNVALFALLRFKMLIAANPNALAPGPILITMGL
FT                   VSLIFAAFMLYQRQDIKRLFAYSSIEHMGLITFAFGLGGPLLNFAALLHMVMHSLTKSA
FT                   IFFAVGHVTQAKGTQELSAIRGLSVSNPLLSVALAAGVIAISGLPPFGAFMSEFLILTS
FT                   TFAREPLLALAVAFGLLVALGALLMRLQDILFGEPTTPNHPVSAASAPIFVHLSLILIA
FT                   GMFLPPAVVVWFKRAAEMLG"
FT   gene            339063..340577
FT                   /locus_tag="Rvan_0289"
FT   CDS_pept        339063..340577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0289"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: xau:Xaut_0170 NADH-ubiquinone oxidoreductase chain
FT                   49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69578"
FT                   /db_xref="GOA:E3I713"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E3I713"
FT                   /inference="protein motif:PFAM:PF00346"
FT                   /protein_id="ADP69578.1"
FT                   /translation="MITINERSRDAEPVALADAIRAALQVRADGFARIEADAALWIGLA
FT                   KACTAGWHDLGALWVDDHHVRMALWDAQENCRAIVSLSLKAGAYPSVGLHHPPALRLER
FT                   AMRDLYGAIPDGIPDERRWLDHGVWPGREHEPGYHFLPVEGNGLHQIPVGPVHAGIIEP
FT                   GHFRFTANGETVARLEARLGYVHKGVEALAQGASIEKAAKLAARMSGDSTVAYSFAFSR
FT                   AVEAALGWEIPPRAQILRGVMAELERLSHHVSDVGGICNDAAVAVLLARCSLIREDILR
FT                   TQAALFGHRMMMDAIVPGGVARDIDAAGATAILALLERIEIGFHRVVRAYDQSPSIQNR
FT                   THGTGIVQLDFIRQFAAGGFVGRAGGRAFDARASFPYPPYNAVAFKVPTREESDVDARI
FT                   WIRIEEIAESAGIIRQLLAKLEDGPIHAAPPPFQPGAGAALVEAFRGDLFLAVRIEDES
FT                   RIAHMHARDASWFQWPLLETAIDGNIVADFPLCNKSFNCSYSGVDL"
FT   gene            340585..341112
FT                   /locus_tag="Rvan_0290"
FT   CDS_pept        340585..341112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0290"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: bja:blr6344 hydrogenase-3 subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69579"
FT                   /db_xref="GOA:E3I714"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:E3I714"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /protein_id="ADP69579.1"
FT                   /translation="MHILLLDALLKGPATERAPSPEEAAVADLARALGTRARARLGRSL
FT                   AIREVDAGSCNACELEIHALGNPVYDVERFGLKFVASPRHADVLLVTGAVSWNMREGLE
FT                   RTYAATPDPKWVVAAGDCAAGCGVFAESRACAGAVAKIIPVDLVIPGCPPTPTDLLKGL
FT                   LALVEGTAQPSR"
FT   gene            341109..341345
FT                   /locus_tag="Rvan_0291"
FT   CDS_pept        341109..341345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0291"
FT                   /product="SirA-like domain-containing protein"
FT                   /note="PFAM: SirA-like domain-containing protein; KEGG:
FT                   sil:SPO1895 SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69580"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E3I715"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADP69580.1"
FT                   /translation="MTDAITIDTRGLSCPLPVLLAKKQLRAIAPGALVRILATDPLAPE
FT                   DFRDFCRVSGCAWVGSREAKDGALEITIRQTEA"
FT   gene            complement(341370..342113)
FT                   /locus_tag="Rvan_0292"
FT   CDS_pept        complement(341370..342113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0292"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   met:M446_6952 molybdopterin binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69581"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:E3I716"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /protein_id="ADP69581.1"
FT                   /translation="MTGAFASEVTAALLVIGDEILSGRTKDKNIGTIADHCTENGIRLK
FT                   EVRVVADEEAAIVAAVDALRTAYDYVFTTGGIGPTHDDITADAIAKAFGVALPIDERAR
FT                   ALLLERIPEGEMTPARLRMARIPVGADLIENTVSKAPGFMIGNVIVMAGVPSIMQAMLK
FT                   AVTPRLRTGAKMLSVSVRVDRPEGAVAAPLEACQRAFPDVPMGSYPFMDEGRYGTTLVL
FT                   RSVDEARLAAAKADLEARLAAVFGG"
FT   gene            342329..343201
FT                   /locus_tag="Rvan_0293"
FT   CDS_pept        342329..343201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0293"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; KEGG:
FT                   azc:AZC_4203 methionine aminopeptidase; PFAM: peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69582"
FT                   /db_xref="GOA:E3I717"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E3I717"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADP69582.1"
FT                   /translation="MRLTFKRVGARDLGMNGSDYGAPVRLAQDSKIRLYGPEAFVAMHK
FT                   AGQLCAVALDQIADMVKPGVPTDAIDQFVFDFAMDHGAVPATLNYRGYTKSTCTSLNHV
FT                   VCHGIPGPRVLLEGDILNVDVTLILDGWHGDSSRMYTVGKVARKAERLIEVTHEAMMRG
FT                   IAVIKPGAHVGDIGYAIQSFAEAERCSVVRDFCGHGVGRVFHDKPNILHYGTAGEGVTL
FT                   EEGMIFTVEPMINLGKPHVKMLSDGWTAVTRDRSLSAQFEHTVGVTATGVEVFTYSPKG
FT                   YHQPPYPAA"
FT   gene            complement(343242..344231)
FT                   /locus_tag="Rvan_0294"
FT   CDS_pept        complement(343242..344231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0294"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ank:AnaeK_3134
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69583"
FT                   /db_xref="GOA:E3I718"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E3I718"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADP69583.1"
FT                   /translation="MEKRKLGTQGLEVSALGLGCMGMSYAYGAGDDAESIAVIQHALDL
FT                   GITLFDTAEMYGPFTNEVLVGKALKDRRDEAIIATKFGFVIEEGVRQYKANGRPEHAKK
FT                   VCDEALKRLGVDHIDLYYQHRVDPNVPIEETVGAMGDLVRAGKVRFLGLSEASPATLRR
FT                   AHKEFPISALQSEYSIWERGVEEGVLATCRELGIGFVPYSPLGRGFLTGTAKRAEEYPE
FT                   GDFRRTQPRFEGENFDRNMKIVDAVKAIAKTQGAAPGQVALAWLLAQGPDIVPIPGTKR
FT                   RKYLEENVDAARLHLSADDLAALDEAAPRGAASGERYGSAALLDLLDK"
FT   sig_peptide     complement(344145..344231)
FT                   /locus_tag="Rvan_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.668) with cleavage site probability 0.650 at
FT                   residue 29"
FT   gene            344341..345180
FT                   /locus_tag="Rvan_0295"
FT   CDS_pept        344341..345180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0295"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   rlg:Rleg_3579 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69584"
FT                   /db_xref="GOA:E3I719"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:E3I719"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADP69584.1"
FT                   /translation="MSLAHAGYDRRPLGDFLQSRRGRLNPAECGFPAGRRRTSGLRREE
FT                   VAQLAGVSVTWYTWLEQGREIQVSTQTLEGIARALRLDRAEREHLFLLAQGRPPAMAEW
FT                   RPREITAALQRMLDGLTYSPAYIRTKRWDIVGWNRAVALTFADYGAMEPHERNSIRLVF
FT                   AHPAWRTLMVDWEADAKKALAIFRADFARAGNDPRFLELVDELDRLSPEFHQWWPRHDV
FT                   RNHGEGVKAVRHPKVGLMSLEYTAFIVESDPDLRMVVYTPAPGSDTADKIARLVDGG"
FT   gene            complement(345193..346086)
FT                   /locus_tag="Rvan_0296"
FT   CDS_pept        complement(345193..346086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0296"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: azc:AZC_4162 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69585"
FT                   /db_xref="GOA:E3I720"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3I720"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP69585.1"
FT                   /translation="MANISLKQLRYFDALARSLHFGRAAEACAVTQPALSMQIQDLERE
FT                   LGTVLIERTRTGAKLTREGEEAARRVASILAAVRDLEASARQGDALLSHALRLGVIPTI
FT                   APYVLPRLLPVLRETYPDLDLELRESQTHHLLADLAGGRLDAVLLALPVDLPDIETLPL
FT                   FEDEFVFALPESRPVPEGALASPDMFLNERILLLEEGHCLRDQALSVCSLNRAGKLDTM
FT                   GTTSLSTLVQMVAGGFGVTLLPRMSLDIEARSGVRLMRFAPPIPHRTIGLAWRTSSPKK
FT                   TDFRELGRIVTELGGG"
FT   gene            346182..347657
FT                   /locus_tag="Rvan_0297"
FT   CDS_pept        346182..347657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0297"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: rru:Rru_A2489 catalase; PFAM: Catalase related
FT                   subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69586"
FT                   /db_xref="GOA:E3I721"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:E3I721"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADP69586.1"
FT                   /translation="MADKPILTTTAGAPVPDNQNSLTAGERGPVLLQDVHLLEKLAHQN
FT                   RERIPERVVHAKGWGAHGTFTVTSDITKYSRAKVFSDIGKKTDIIARFSTVAGELGAAD
FT                   AERDVRGFSVKFYTEEGNWDLAGNNTPVFFIRDALKFPDFIHTQKRHPQTNLRSPTAMW
FT                   DFWSLSPESLHQVTILFSDRGIPVAPMFMNGYGSHTYSFINAQNERFWVKFHFKTLQGH
FT                   RHFTNGEAEDIVGKDRESYQRELFGTIDRGDFPKWRLFVQIMPETDADKTPYNPFDLTK
FT                   VWPHGDYPLIEVGILELNRNADNYFAEIEQLAFSPSNVVPGISHSPDKMLQARVFSYAD
FT                   AHRYRLGTHYEALPVNAPKSGVHTYHKDGAMRFFGSQTGNVDAFYEPNSFGGAVEAPQY
FT                   REPPLKVSGDADRYNHRVGNDDYSQPRALFRLFDAEQRERLFSNIAEAMQGVPVEIVKR
FT                   QVVHFYRVDPEYGLGVAAKMGLAPEDVQLKAAE"
FT   gene            complement(348069..348539)
FT                   /locus_tag="Rvan_0298"
FT   CDS_pept        complement(348069..348539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_2879 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69587"
FT                   /db_xref="GOA:E3I722"
FT                   /db_xref="UniProtKB/TrEMBL:E3I722"
FT                   /inference="similar to AA sequence:KEGG:Pden_2879"
FT                   /protein_id="ADP69587.1"
FT                   /translation="MTDIAATLDASATIAATGQHFKPFKPHRWTAQNSPAALRLVPDRE
FT                   GVPVIPRDDLDFLLNASARDLLIWRYDPRFPVERRCAYPEAAGYRPDELIAFLKTRQPQ
FT                   DQARVCPLLPLGPVNAMRRGWFRPTRLELLISVGVAAVSAILSFQGIMAVAL"
FT   gene            complement(348697..350562)
FT                   /locus_tag="Rvan_0299"
FT   CDS_pept        complement(348697..350562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0299"
FT                   /product="cobalt chelatase, pCobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="SMART: von Willebrand factor type A; TIGRFAM: cobalt
FT                   chelatase, pCobT subunit; KEGG: pla:Plav_1712 cobalt
FT                   chelatase, pCobT subunit; PFAM: Cobalt chelatase CobT
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69588"
FT                   /db_xref="GOA:E3I723"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3I723"
FT                   /inference="protein motif:TFAM:TIGR01651"
FT                   /protein_id="ADP69588.1"
FT                   /translation="MPNTPRKKADPTQPFKQAVSLATRSLAENNSVNVTFGPETPGYDG
FT                   KTVRLPLPSRAITKKEIAIIRGYSDSLALMISAHDEKLHNAYAPPSGEARSAYNAMERA
FT                   RVEALGSLRMRGVAKNLDAKLAAIYERFPDRDVDRQDAPLADALALMVRERLTGQKPPR
FT                   GANGIVNVWRDWVNERAGNILDRADDTVADQAAFAKLTRDVLVALQLMEAPVEDPETEQ
FT                   SADADEQKNEDNPGESSQEESDQSSQASEAQADDAEGSDADDDADAADITEKDYKPSET
FT                   EGKEQPHSSRRPNTSVLDAPGDFGYKVYTRQFDEFVTAESLCDADELERLRAFLDKQLA
FT                   VIQVAVSRLANRLQRRLLAQQNRSWAFDLEEGILDTAKLSRVVTDRFQPLSFKMERDTE
FT                   FRDTVVTLLIDNSGSMRGRPIMVAACCADILARTLERCGVKVEILGFTTRQWKGGQARE
FT                   QWLAAGKQPQPGRLNDLRHIIYKAADMPWRRARRNLGLMMREGLLKENIDGEALTWAHA
FT                   RMLARPEQRRILMMISDGAPVDDSTLSVNTGTYLEKHLRQVIYEIETRSSVELIAIGIG
FT                   HDVTRYYRRAVTISDAEELAGAMTEKLAELFAERGRSLGRRGKFH"
FT   gene            complement(350671..351657)
FT                   /locus_tag="Rvan_0300"
FT   CDS_pept        complement(350671..351657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0300"
FT                   /product="cobalt chelatase, pCobS small subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="SMART: AAA ATPase; TIGRFAM: cobalt chelatase, pCobS
FT                   small subunit; KEGG: msl:Msil_0318 cobalt chelatase, pCobS
FT                   small subunit; PFAM: ATPase associated with various
FT                   cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69589"
FT                   /db_xref="GOA:E3I724"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I724"
FT                   /inference="protein motif:TFAM:TIGR01650"
FT                   /protein_id="ADP69589.1"
FT                   /translation="MTNGEAGLAGLPDMKVSVRQVFGIDSAMEVPAYSQSSEYVPDLDT
FT                   DYLFNRETTLAILAGFAYNRRVMIQGYHGTGKSTHIEQIAARLNWPCVRINLDSHVSRI
FT                   DLVGKDAIVVRDGQQITEFREGILPWALQSNTALVFDEYDAGRPDVMFVIQRVLEVSGK
FT                   LTLLDQSRVIRPHPAFRLFATTNTIGLGDTSGLYHGTQQINQGQMDRWSIVATLNYLPY
FT                   EDELNIVVAKAKGYETDVGRRAVGNMVRVAELTRTAFVNGDLSTVMSPRTVITWAENAT
FT                   IFGDVGFAFTLSFLNKCDELERGLVAEFYQRCFGEELPASTANIALS"
FT   gene            complement(351734..352390)
FT                   /locus_tag="Rvan_0301"
FT   CDS_pept        complement(351734..352390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0301"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="KEGG: mes:Meso_3068 heat shock protein DnaJ-like;
FT                   PFAM: heat shock protein DnaJ domain protein; SMART: heat
FT                   shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69590"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E3I725"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADP69590.1"
FT                   /translation="MKLDSKYFDSIRVTKGRGRSRAEKPAAAAPRACQWRGCTKPGLHK
FT                   APKGRDAEGEYYLFCRDHVVEYNKTYDYFAGMKDEEVADFQKSAATGHRPTWSMGVHGH
FT                   DAPELHAARDAAAAAAAATAANDPFELLKRVRGREQARSAEAVKQRRAVSKGALKHLHS
FT                   LNLDETASSDDIKIQFKALVKLHHPDHNGGDRSSEDRFREVLAAYNYLKQSGLVR"
FT   gene            352573..352857
FT                   /locus_tag="Rvan_0302"
FT   CDS_pept        352573..352857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0302"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: ptr:457263 bolA
FT                   homolog 1 (E. coli)"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69591"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E3I726"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ADP69591.1"
FT                   /translation="MSVEKSIREKLEKAFLPTVLAIENESGKHAHHVEQQGRAGPSGDT
FT                   HFRVRIVSSAFEGKSSLERHRAVNAALAEELAGPVHALAIKALTPAETA"
FT   gene            352882..353541
FT                   /locus_tag="Rvan_0303"
FT   CDS_pept        352882..353541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0303"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   xau:Xaut_3842 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69592"
FT                   /db_xref="GOA:E3I727"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I727"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADP69592.1"
FT                   /translation="MPALLDGPRLAPASGGEAKQLVIFLHGYGADGNDLIGLGREWAPL
FT                   LPDTAFVSPDAPETIPGYFGGRQWFSLSTRSEREWEEGVLSAEPALAAFIEDEARKAGL
FT                   PLSKVALVGFSQGTMMALQTGLRLPEPVAGIVAFSGHLAGATRLESEIKAKPPVLLLHG
FT                   SADEVIPVAAIHLARETLAAVGVPVQWQIRPGLGHGIDGQGLLAAGRFLRACFGLD"
FT   gene            complement(353551..355188)
FT                   /locus_tag="Rvan_0304"
FT   CDS_pept        complement(353551..355188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_2797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69593"
FT                   /db_xref="GOA:E3I728"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E3I728"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_2797"
FT                   /protein_id="ADP69593.1"
FT                   /translation="MQEKVMLPQEAKTQAPGRIAHHFREIVLWPLQIITSGEKSGFGGC
FT                   GALFDLECEGTPWRSAGPFGGDHFEERHYREFISFLPHAQRFLYGDAPDAGRKNPGDLP
FT                   MKVYRRCDIKKVRITTERGATPVICDVSHIDLYFFYEVNTAILVCEIGAENIPLEIAQG
FT                   ITQTFGRAYPAGWTRDGQPVHCAARVEWLDDNDAVLCASDYEDRERYIDFVGTRRSPCI
FT                   ARHWEFVLSPIVNAASSDTGRLRFREIEYYRMPVMTYITLPSLDVLTKRDYIALTLATR
FT                   PSKTGIMPYSKRFVQKFEANHVYDRMYSGGLDAPELETRFLTSGEAFAIVSAGDNPSLT
FT                   DDQRGLLSQFRHQYFRLFLVAHFHKASLLMISDQLVATLKRLDPSKPDSRMAFRDETLL
FT                   LQENFLRFSQRYFFTELSGRAHVRDLFRMLRKHLAIDALFAEVRSELFDLVKYLDSNAL
FT                   RKQNASMHRLTVVTTVGLIGTIVTGFLGMNLIAYAEEPMSFRVEYFIAVLVAVTIFVGL
FT                   TIIYSRRLTDLFDRLSGENQRDREEPPF"
FT   gene            355684..356427
FT                   /locus_tag="Rvan_0305"
FT   CDS_pept        355684..356427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0305"
FT                   /product="protein of unknown function DUF1614"
FT                   /note="PFAM: protein of unknown function DUF1614; KEGG:
FT                   smd:Smed_5957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69594"
FT                   /db_xref="GOA:E3I729"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:E3I729"
FT                   /inference="protein motif:PFAM:PF07758"
FT                   /protein_id="ADP69594.1"
FT                   /translation="MLSSHLDYLPVSSGLYIALMGALLVLGVLVKIGLIRYVYTRLGIT
FT                   PLSAILLLLASLAGSYVNIPLAHFPDETVVVRQYVDFFGMEVVLPREVDWPGTIIAINI
FT                   GGAVIPILLSLYLLAVNKIWLPSIVATAIVSAVCYMVAEPVPGAGIMIPIFIPPLFACA
FT                   AALIVAWNKAPAVAYVSGSLGTLIGADLFNLDEIQKIGTPVASIGGAGTFDGIFVTGIF
FT                   AVLLASLVGAISERRATERASSGDA"
FT   gene            complement(356459..356680)
FT                   /locus_tag="Rvan_0306"
FT   CDS_pept        complement(356459..356680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_2485 ABC-type sulfonate/nitrate
FT                   transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69595"
FT                   /db_xref="UniProtKB/TrEMBL:E3I730"
FT                   /inference="similar to AA sequence:KEGG:mma_2485"
FT                   /protein_id="ADP69595.1"
FT                   /translation="MARTAGAFNIYSLPSKGHHDRIDVAKTLRSTARRVAEFVRGDRAR
FT                   DAESFIRQRGGVMSDDVERELIKRYGSM"
FT   gene            complement(357032..357670)
FT                   /locus_tag="Rvan_0307"
FT   CDS_pept        complement(357032..357670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69596"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:E3I731"
FT                   /inference="similar to AA sequence:KEGG:TM1040_0952"
FT                   /protein_id="ADP69596.1"
FT                   /translation="MESRSIQRLIAKELLVWSVALVGAYATFHSFEPLYERVRQAATDA
FT                   GFSHLFSFEQTSPGVSRFNTRVLTASSLPLRGTINAGQTDQASTARKVVLSANDYGHFH
FT                   ALAAIRGQQVEFMTDTGATYVALSYETAQKLGLQPQSLRFNGRSTTANGVARVASVTLD
FT                   QVRIGDITVRDVQAVVAEPGRMAQNLLGMSFIKQLSGFELNGSKLTMIE"
FT   gene            complement(357721..358431)
FT                   /locus_tag="Rvan_0308"
FT   CDS_pept        complement(357721..358431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0308"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: putative transmembrane signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69597"
FT                   /db_xref="GOA:E3I732"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:E3I732"
FT                   /inference="similar to AA sequence:KEGG:Snov_0874"
FT                   /protein_id="ADP69597.1"
FT                   /translation="MIFLAIGLLAVSLALYLLTGDGDTIAGLPRDEFPRVAALLALLIF
FT                   LMAGVTRLTAGRVAEALKALGSWAAIFLVVISLYTYRTEIGEVRDRVVEELNPGTVQTV
FT                   SPGMEGSGKGAVVSVKRQGDGHFIAKVQVNGKAVRMIVDTGASTVVLRPEDARRAGILI
FT                   SALDYTVPVDTANGRAFAARVKLDKVSLGAVTLEKVDALITRPGALHQSLLGMSFLSRL
FT                   RSYEFSGNRLVMKS"
FT   sig_peptide     complement(358372..358431)
FT                   /locus_tag="Rvan_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.786 at
FT                   residue 20"
FT   gene            358599..360482
FT                   /locus_tag="Rvan_0309"
FT   CDS_pept        358599..360482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0309"
FT                   /product="DNA primase"
FT                   /note="TIGRFAM: DNA primase; PFAM: DNA primase catalytic
FT                   core domain; TOPRIM domain-containing protein; KEGG:
FT                   azc:AZC_3642 DNA primase; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69598"
FT                   /db_xref="GOA:E3I733"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E3I733"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ADP69598.1"
FT                   /translation="MRYPPDLLDEIRSRLPVSRVVERRVKLKRQGREYIGLSPFKTERS
FT                   PSFTVNDHKGFYHCFATGEHGDVFTFLMKVEGLSFPEAVERLAAEAGVMLPEPEPVDAV
FT                   KESHESRVRAALEETCRFFEVALASLDGMAARAYLEKRGVGAAEVAAFRLGYAPDSKTR
FT                   LKQHLSAKGFTLAEMEDAGLLIHGEDIPVPYDRFRGRLIFPITDAKRRVIAFGGRALQP
FT                   DQQPKYLNSPETLLFHKGHVLFNHAAARDASKVERAVILAEGYMDVIALARGGFPNAVA
FT                   PLGTALTADQLRLLWAMSPLPTLCFDGDSAGRKAAHRALDTALPFLEPGRSLQFAFLPE
FT                   GRDPDDMVSGGARDALAKLLAEPLPFIDVLWSREAEKHALDTPEQRASFEARLTEAAQK
FT                   IEHKSLRFHYMAGFRERLRGIGHKSGGLPRPRPDAESWRARSMLAPTGGARKPRAPAGG
FT                   RSMLPQRTSELLSSPLTQATAPVTAPREAVIISAILAHPWLIDEHMEEIARIPFIDPDC
FT                   NRIRNAVLTVHQFDESLDNKKLLEHLSKEGYEAELERLDKACAHKADPHFAPDAEREQV
FT                   QEGWRHVMMLHDKAGVPSSLLEAESEWMSDQSDENSVRLIAVKQQVEIVST"
FT   gene            360743..362836
FT                   /locus_tag="Rvan_0310"
FT   CDS_pept        360743..362836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0310"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="KEGG: xau:Xaut_1238 RNA polymerase sigma factor
FT                   RpoD; TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 1.1 domain protein; sigma-70 region 1.2; sigma-70
FT                   region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69599"
FT                   /db_xref="GOA:E3I734"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:E3I734"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ADP69599.1"
FT                   /translation="MATATTKNEDQETQASESTDSPVLDLLDAAVKRLIKTAKARGYVT
FT                   YDEINEVMPPEDVSPDQIEDIMTMFSDLGINVVDAEEVEEASAEHLDDEEDDRAAPANL
FT                   PVKQERSTEVGERTDDPVRMYLREMGSVELLSREGEIAIAKRIEAGREAMIGGLCESPL
FT                   TFQAIIIWRDELNEGKILLRDIIDLEATYSGPFSRPEEGDGSEEEYDPEPQPQLQPVSG
FT                   PRPVVTNGGGATNGVTGLNGANGHARPEGTDAVGPEGETAEFRGEEDDDDLENSLSLAA
FT                   MEAELKPKVLETFDRIATEYKKLRKLQDQHVERKLADDALSPQQEKRSRRLRDAVIQDV
FT                   KSLSLNPARIESLVEQLYDINKRLIGYEGRLLRLADGFGVRRDEFLSYYQGSELDPNWI
FT                   DRIGTLKGKGWQKFVEKERQRIDEIRQEIYALATETGLDIAEFRRIVKIVQKGEREARQ
FT                   AKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATW
FT                   WIRQAITRSIADQARTIRIPVHMIETINKIVRTSRQMMHEIGREPTPEELAEKLSMPLE
FT                   KVRKVLKIAKEPISLETPIGDEEDSHLGDFIEDKNAILPIDAAIQSNLRETTTRVLASL
FT                   TPREERVLRMRFGIGMNTDHTLEEVGQQFSVTRERIRQIEAKALRKLKHPSRSRKLRSF
FT                   LDN"
FT   gene            complement(363062..363400)
FT                   /locus_tag="Rvan_0311"
FT   CDS_pept        complement(363062..363400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0311"
FT                   /product="glutaredoxin-like protein"
FT                   /note="KEGG: mch:Mchl_0014 glutaredoxin-like protein;
FT                   TIGRFAM: glutaredoxin-like protein; PFAM: glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69600"
FT                   /db_xref="GOA:E3I735"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3I735"
FT                   /inference="protein motif:TFAM:TIGR00365"
FT                   /protein_id="ADP69600.1"
FT                   /translation="MSEDVQSWIKDQVTTNDVVLFMKGTKEFPQCGFSGRVSQILNFLG
FT                   VPYQDINVLTDDGIRDGIKAYTNWPTIPQLYVKGEFIGGADIVSEMFQSGELQKVFADK
FT                   GVPTSKAA"
FT   gene            complement(363479..363715)
FT                   /locus_tag="Rvan_0312"
FT   CDS_pept        complement(363479..363715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0312"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: azl:AZL_006630 BolA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69601"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E3I736"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ADP69601.1"
FT                   /translation="MPMEAHEIERLIKEHLPDAEVQIEALKGDGDHYAALVTSTAFAGK
FT                   SRVQQHQLVYAALKGRMGGELHALALTTRLPGE"
FT   gene            complement(363917..365947)
FT                   /locus_tag="Rvan_0313"
FT   CDS_pept        complement(363917..365947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0313"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   acr:Acry_0383 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69602"
FT                   /db_xref="GOA:E3I737"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I737"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69602.1"
FT                   /translation="MKNKNQIICLNMIVKNEAAVIRRCLDSVRPIIGHWVIVDTGSTDG
FT                   TQDIIREHLRDLPGELHERPWRDFAHNRTEALELARGKGDYTLIIDADDVLEFEPGNTI
FT                   PELAADQYAIEIQHGSIVHSRTQIVRSALPWRWEGVLHEYLTCEEASSDGQLPGIRLKV
FT                   NDDGARRKDPETYRRDARVLETALRTETNPFLIARYRFYLAQSYRDCRESVRALQQYLI
FT                   RAELGFWQEEVFISLYSVAQLKEELGHAEQDVIDAYLRAADASPSRAEALHGASKFCRL
FT                   KGRNEEGYQLAKRGLQIPMPSDGLFVEAWIYETGLLDEFSVNAYWSGHMRDCLYASLKL
FT                   LASGKLSDEDRTRVSANAQVASESLDQDRNLGSLVADDFVQQHALVAPRMLRSRLKAAP
FT                   RVLVAILAKQKEEFLPLHLECIESLDYPKSSIVLYIRTNNNTDGTERILREWAKRVGHL
FT                   YADVEFDAEEVEVPVEQFSVHEWNETRFDVLGHIRNVSLSRALAHRCDFYFVADVDNFI
FT                   RPCTLRELVALDLPIVAPFLRSLSPDDPYSNYHAEIDASGYFEDCDQYSWILNRWIRGV
FT                   IEVPVTHCTYLIRADVLGELAYRDGTARHEYVIFSESARRHGIPQYFDNRQVYGYIAFG
FT                   DGHDRYIAGGAELARELLRGDPMFGHGTETTVAVRSIELCA"
FT   gene            366022..366888
FT                   /locus_tag="Rvan_0314"
FT   CDS_pept        366022..366888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69603"
FT                   /db_xref="UniProtKB/TrEMBL:E3I738"
FT                   /inference="similar to AA sequence:KEGG:mll0578"
FT                   /protein_id="ADP69603.1"
FT                   /translation="MRRRHFLFLLGGSLLLPLKTTPAWPICNSVSVLDAPLELEGKWGG
FT                   SAPSDAAAVMERMRTACLAGVALVSDRQPDRLRVDNHAGTLPSIWLHSQPPRTGWIIVS
FT                   IGTRDWCKLAYQFGHELGHVLCNSWQSDAKPQTPCQWIEEALVEAFSLRGLGLLADAWE
FT                   HAPPFPRDAAFADAIRNYREKMVVDYRAASKEQDETASLRTWFNRHEASLHVNGGVKAA
FT                   AGAVSTMLDLLESDATMIADLGALNRWPGRSGVALHHYLNLWEKSCAELKAPGRLPVRL
FT                   RNLLAQQ"
FT   gene            complement(366952..368748)
FT                   /locus_tag="Rvan_0315"
FT   CDS_pept        complement(366952..368748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0315"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: acr:Acry_1896 Sel1 domain-containing protein;
FT                   PFAM: Sel1 domain protein repeat-containing protein; SMART:
FT                   Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69604"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3I739"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADP69604.1"
FT                   /translation="MIGLDILHKLLDRLVARSPKRARARAERLSKAAPERALALFVAAA
FT                   EAGDAEAAFIVGERYLEGKGALAHPVSAARWYQLAAEAGHVEAQCRLAALHLFGVPKAA
FT                   VGTDERLFESADSDAPDYHAAVVWAKKAAETGAPDAQAMLAFILSSGPEELRDPDAAFE
FT                   WYRKSAAQDCPQGRLGYAIALMLRTDIANNALMARDELLRASEAGLPTAHYLLGAAAEG
FT                   GFGTALDEAEARRLYSLAAEAQHTAAQIKLGLMLLEGRGGSVDPLNGESWLRRAAVAGE
FT                   SDAAMHLGELYSRGGALPPNYIEAAHWFRTAAEQGHQAAARALGTLYLTGAGMARDPDE
FT                   AAAWFKRAAEAGDTVAQADLAVLLQDGGVTTLDNRDIPVHEWFERAAEQGDLIGAFNYA
FT                   VCLAEGIGVPRNDARAAFWLKKAADEVVSAQYWYGRMLADGRGLDQDDREAAAWFERAA
FT                   DDGMADAQVALGEFYLQGRGVPYDPEAAKSRFLSAAEADHSGAMFALGIMHNDGTIIGS
FT                   DHDEARRWFSRAAEQGHAVAALMLARYAAQGLGGPKEIEAARAWYERAVALGAQDAAEE
FT                   LATLDLKLTEQAKADVEPEMMA"
FT   gene            complement(368753..370159)
FT                   /locus_tag="Rvan_0316"
FT   CDS_pept        complement(368753..370159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0316"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="KEGG: acr:Acry_1897 HlyD family type I secretion
FT                   membrane fusion protein; TIGRFAM: type I secretion membrane
FT                   fusion protein, HlyD family; PFAM: secretion protein HlyD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69605"
FT                   /db_xref="GOA:E3I740"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:E3I740"
FT                   /inference="protein motif:TFAM:TIGR01843"
FT                   /protein_id="ADP69605.1"
FT                   /translation="MPLLLPRLSKPAKAKRADTSPLPLAALEFESPSAAIIAKPIPRLS
FT                   RATNLFVFLLVVSTVAASGLIKIDKIVSASGKLVADAPNIVVQPFDHSIVESIDVRKGD
FT                   IVRKGQLLARLNPTISAADLTSMQDQLDSLTAKAARLEAQTSGKDYVPDPANSHSTLQA
FT                   AIFYQQSREYKSSLEAHDQKINQYRTEMDGSSAQADHYRKRLGLAANVEGMRQELQNLQ
FT                   VGSKLNTILATDARLNMAVALSQMESESAQAGRKLAAEEAEREAYVNRWDAQLSQELAD
FT                   TRRKLAQARQDFTKANLHNQLVVLTAPRDAVVLSVAKISVGSVVTSAEPLIQLVPLDAP
FT                   LSVEADISGIDSGYVRPGDQVTVKFDTLPFLQYGSAKGTVRLISADSFSPEATPQEGGS
FT                   SLPNRPRTLYYKAYISLTEMQLHDTPPGFRLMPGMPLTADVKVGTRSILEYYVSKILPI
FT                   AHESMREPGA"
FT   gene            complement(370122..372395)
FT                   /locus_tag="Rvan_0317"
FT   CDS_pept        complement(370122..372395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0317"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: acr:Acry_1898 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; peptidase C39 bacteriocin processing; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69606"
FT                   /db_xref="GOA:E3I741"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E3I741"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69606.1"
FT                   /translation="MNFVSPANIPLHIATSDFGEKAASDGQGTTALQARIVAATHVARY
FT                   HGVDPDPSGIRPNAGGAAPTSPALVEWLRQYGLWARAVRLSFGQLMKLDNPAPVLLLLS
FT                   DGGAAVVVGRNHEHGVLLVRDPLAPSSKPPTPIDELRLKQVWDGTALLVRASRGESEDE
FT                   KPFDLGLLTRMVWGEKSILRDVAIGSITITILSVLPVLMIMTTLNTVVTYHSMNTLTLI
FT                   VVVLLIALGFEMLIAWSRRMLLITLATRLDTRLHLAIFNRLMTLPIDFFERNQAGELSY
FT                   KVSQLYRVREFLTGRMITTFIDVAMVLLLLPVLFYMEPTLAWTVLAAAACITLIIWAFL
FT                   RPLADLTGKVIQAESDKGSTLVESIYGIRTVKSLCLESTRAAEWDQRIATVGDLNMRMG
FT                   KLSNWPMVLVMPFEKYTQAGVLALGAYLAMTSNNPLSLGGLIGFMMLGGRVAGPLVNLA
FT                   RLLQDVQEARQALFQVGWVLNRPTEKRALTHGLRPKLEGAISFDEVTFKYEGSKSPALD
FT                   NISFAIEPGMMLGVVGRSGSGKSTVTRLLMGINPEYSGAIKIDGIELREINLRHLRQSF
FT                   GAVLQDNFLFRGSVKDNILAGRPGLSFEDAVRAARLAGAEEFIERLPQGYETWVQEGST
FT                   NLSGGQRQRLAIARALIADPKLLILDEATSALDPESEALINANLQRMARGRTMVIISHR
FT                   LSSLVECDKTLVLDRGKVIDIGPHRELVERCAVYRHLWLQQNRHSDYQGKVHAAPAPSF
FT                   IQAS"
FT   gene            complement(372489..374993)
FT                   /locus_tag="Rvan_0318"
FT   CDS_pept        complement(372489..374993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0318"
FT                   /product="Collagen triple helix repeat-containing protein"
FT                   /note="PFAM: Collagen triple helix repeat-containing
FT                   protein; KEGG: mlo:mlr0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69607"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:E3I742"
FT                   /inference="protein motif:PFAM:PF01391"
FT                   /protein_id="ADP69607.1"
FT                   /translation="MADQLVQVWGRDISGTTEYIYYFDGLNYTLLGSTNNTTAAVDAAV
FT                   GSATIAEYKVIVSLDDTQNPANIVVFNQAGTLQTAGSHTVNGQYDVTLLDVAATGATGA
FT                   TGDTGATGSTGATGDTGATGATGATGATGATGDTGATGATGATGATGATGATGATGDTG
FT                   ATGATGATGATGATGATGDTGATGATGATGATGATGATGATGATGATGATGATGATGDT
FT                   GATGATGATGATGATGATGDTGATGATGATGATGATGATGATGATGDTGATGATGATGA
FT                   TGATGATGATGDTGATGATGATGATGATGATGDTGATGATGATGATGATGATGDTGATG
FT                   ATGATGDTGATGATGATGATGATGATGATGATGATGATGDTGATGATGATGATGDTGAT
FT                   GATGATGEAGEPGATGATGATGATGATGATGDTGATGATGDTGATGATGATGDTGATGP
FT                   EGGPTGPAGATGATGATGATGATGAGETGATGATGATGATGATGENGQNGQNGQNGQNG
FT                   QNGQNGAPGATGATGATGATGATGDTGATGATGATGVGETGATGATGATGDTGATGATG
FT                   DTGATGATGDTGATGATGDTGATGATGATGATGATGATGATGATGATGATGATGATGAT
FT                   GATGATGATGATGATGATGATGATGRTGATGATGRTGATGATGKTGATGATGKTGATGA
FT                   TGATGKKGATGATGATGKSGGHCKPDHGKPDHGHGSNSSDHGSKGDRPTFISGSAKTQG
FT                   STGETAKSTAGDNQLQSIAKQVSASLRPTDVAPKNVASLLNNLKNGSDIKAGGIFKDNG
FT                   NSGSFNPINLNNQTHHLSLPKH"
FT   gene            complement(375504..376724)
FT                   /locus_tag="Rvan_0319"
FT   CDS_pept        complement(375504..376724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0319"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mlo:mll0582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69608"
FT                   /db_xref="GOA:E3I743"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I743"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69608.1"
FT                   /translation="MKWVSIRQEAKLKRQGTPFGNSSEPKAKTVGLCMIVKNEAHCIRR
FT                   CLASVKPLVDFVLVVDTGSTDGTQGVIRTFLEENNIKGVVIDEPWRDFAWNRTFALTEL
FT                   RKYTYIDYCLMIDADEALEFDENVDLTAFKKALSHDFYQLPTFNGGIINLRPLLFRNNI
FT                   NFKYRGVLHEFLESPGKHCTWGVIRGLHNRTFYDSARNKNPQKYLHDAELLERTLKSEQ
FT                   DPFLVSRYTFYLAQSYRSAGDKAKSLTNYLKRAELGFWEQEVFIALLSAGRLMEDLGHS
FT                   EADILATYLRAFNVCPTRAESLHAAARYCRVNNKFHQGYMIARQGIDIKKPEGAALFVE
FT                   PSVYTYGMLDEYAVLAYWAGHYPESLEASEKLLQLKDLPAGYPERIELNAKFAREKIQE
FT                   ANLLQKA"
FT   gene            377269..378888
FT                   /locus_tag="Rvan_0320"
FT   CDS_pept        377269..378888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0320"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: rlg:Rleg_1274
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69609"
FT                   /db_xref="GOA:E3I744"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I744"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADP69609.1"
FT                   /translation="MTINVTTGSMLPTRLNLGSGKDYRADCFNIDVDNSWSPDAVIDLA
FT                   SFDLDADGVSVPTHRFGDVQLRPGTFDTIIANDVLEHVPDLVRLMTNCLKLLRAGGVFE
FT                   ISVPYDLSFGAWQDPTHVRAFNERSWLYYTDWFWYLGWSEARFVLERMSFVPSPAVAPF
FT                   ASATPAELQRMPRMIDSMSVSLRKVDLTPADRQVWEYWRERKRQAQSRWSAPVPAVQEI
FT                   APSTAAPAALATAAATSPVTPQQAEVRQAFAGGWAAHRHAHCLWIVTPEGYKHHQTFDE
FT                   FALGLSEAFAELGGSCPIVRDVLQLNGRVPIVLGTHLLRHCSSVAIPADSVLINFEQVV
FT                   SGGGWLDENYLALLRRFPVLDYSVRNREALIERGITHAGLLGIGHAPGLVRIPKVLEKD
FT                   IDVLFYGSLNPRRKAILEALRARGLNAVHLFGAYGAERDAAIARAKLVINLHFYESAIF
FT                   EVVRVSYLLANGVCVVSEGDEGDPDIAPFEGGLVVCGYDEIVENCAALVADDPYRDAIG
FT                   LRGQRIMMARRQSDLLKALIGD"
FT   gene            379029..379788
FT                   /pseudo
FT                   /locus_tag="Rvan_0321"
FT   gene            379821..380438
FT                   /locus_tag="Rvan_0322"
FT   CDS_pept        379821..380438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0322"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="TIGRFAM: protein-L-isoaspartate O-methyltransferase;
FT                   KEGG: pla:Plav_3032 protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69610"
FT                   /db_xref="GOA:E3I745"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I745"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADP69610.1"
FT                   /translation="MMDERLESLIHLLQRNAIADPRVLATMKDIPRKAFIESPELKPLA
FT                   YADEALPIECGQTISQPYIVAYMTERLNVQRKHDVLEIGTGSGYQTAILSRLARHVYTI
FT                   EIHEELHRLAVARFKALGLTNITALCGDGSKGWPVPRLFDRILVTAGVIAAPPDLIGQL
FT                   GPCGAMVIPLGRTSSQRIMLVVRNGNGVEFQSLIPVRFVPLL"
FT   gene            380625..381710
FT                   /locus_tag="Rvan_0323"
FT   CDS_pept        380625..381710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0323"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   met:M446_5589 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69611"
FT                   /db_xref="GOA:E3I746"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:E3I746"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP69611.1"
FT                   /translation="MAQTVCILLSSEDRSRLAAVIGDRNSPQKHAQRAKIVLHSAERRS
FT                   VFDVARLSGVSRPAVWRWQRRYAEKGVDGLLRDQTRKPGKPPLSAKSVAKVLALPCSEP
FT                   PGNATHWTGRAVAKAAGVSLRTVQRIWGAHRLQPHRLRTFKKSNDPAFAEKVEDVVGLS
FT                   MSPPCHAVVLSIDEKSQIQALDRTQPGLPLKPGKCATMTHDYKRNGTTTLFAALNVLDG
FT                   TVLGRCMKRHRHQEFIKFLNAVERKVPAGKIIHVILDNYGTHKHPKVDAWLADHPRWVF
FT                   HFTPTSASWLNAVENFFSAITRRRIRRGVFKSVADLEDAIKRYIADHNRNAKPFVWTKT
FT                   ADEIFDKLNRLNLHLLNESVH"
FT   gene            381821..383695
FT                   /locus_tag="Rvan_0324"
FT   CDS_pept        381821..383695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0324"
FT                   /product="Peptidase M23"
FT                   /note="KEGG: rpe:RPE_2706 peptidase M23B; PFAM: Peptidase
FT                   M23; Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69612"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E3I747"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADP69612.1"
FT                   /translation="MSKVNAVGKREPSYVRAALKIGIGCVLLGGCSSGGTERFSSLSFG
FT                   SGYETASGPSSPIAPSRVADASPQATGPASYGQSAYRPKASQSQAAYQTQANYRQPSQA
FT                   GYAQTAAYQPNQQGGFQLASATPGQQGGYLQASRVDLPPLAGQQQSSTSTRVKTADGYG
FT                   RYNQAPLPDGSYAGPRVYTPYDDRPRDYAPPPPPPPAVYEPRYERDAPPPPPPPAYDDR
FT                   RSEVTPPYDQRPLPRYAEPAPRDYTPAPRDYSSAPPAYSGERNFYERRREGAVTPKLAP
FT                   RNGSGVDGTGIMSPNATVASERGIGKTVTVKPGDTLYSLAIRHGVTVDMIARANGLDRH
FT                   NSVRPGMDLLIPGSDPAKMTKDDAPKAQPVGCQGDGCHVVKKGETVAAIARGYGLSEKQ
FT                   ILEANNIANARLIKVGQTLAIPGREAPRQEIASNGVKPEAPIAGPQQRQADAQPAPEPA
FT                   QPQMADANNPLKAAPAPDVKMTSAKQEPTCEAALANPLPRMGKSFRKPVEGMIIGQFGP
FT                   QHDGSVNEGLTISVPKGTPIKAAENGVVAYVGDELPGFGNLILIRHADEFVTAYAHTDE
FT                   IMVRKCDVVKRGQVVAKAGSTGDASQPQLHFEIRKNAKPVDPAPLLGS"
FT   gene            complement(383704..383931)
FT                   /pseudo
FT                   /locus_tag="Rvan_0325"
FT   gene            complement(383921..385438)
FT                   /locus_tag="Rvan_0326"
FT   CDS_pept        complement(383921..385438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0326"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   azc:AZC_3298 malonyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69613"
FT                   /db_xref="GOA:E3I748"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E3I748"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADP69613.1"
FT                   /translation="MSGTNHLFSELRANWTDLDKVALETNDGRQFRYRDILALTARFAN
FT                   ALVAAGVKPGDRVAVQVEKSPEALFLYLACVRAGAAYLPLNTAYTDAELEYFLGDAEPT
FT                   VFVARPTHASAPALCTKTGVAGCYTLGADGDGTLIELAADKAETFENIARGPDDLAAIL
FT                   YTSGTTGRSKGAMTTHENLASNARALAEYWRFTDRDVLLHALPIFHTHGLFVASNVIFR
FT                   SGASMLFLPKFDPNEVFRLLPRATTMMGVPTFYTRLIDDARLSRETTKEMRLFISGSAP
FT                   LLADTHRAFEEKTGHRILERYGMTETNMITSNPYDGERVPGAVGFPLPGVSVRIANPET
FT                   GELLGADEIGMIEVTGPNVFIGYWRMPEKTASEFRDGWFITGDLGKIDATGYVHIVGRG
FT                   KDLVITGGYNVYPKEVESEIDALPGVFESAVIGVPHPDFGEGVVAVVVKTKDAAIDEKA
FT                   IHDALKVRLANYKLPKRVFFVDDLPRNTMAKVQKNVLRDAHKDLFVR"
FT   gene            complement(386047..386379)
FT                   /locus_tag="Rvan_0327"
FT   CDS_pept        complement(386047..386379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0327"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pam:PANA_4007 YfbW"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69614"
FT                   /db_xref="GOA:E3I749"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3I749"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP69614.1"
FT                   /translation="MNGTTLGILLVVLCALLEGIGQVLLKKSTMTKVRWFMWISAGVIA
FT                   LAAEALIYTEALKLLDVSVAFTICSLNLIAITILSRFILREEVTRTRWIGVGLIFVGAA
FT                   LVMTRA"
FT   gene            complement(386376..386804)
FT                   /locus_tag="Rvan_0328"
FT   CDS_pept        complement(386376..386804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0328"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mhu:Mhun_2116 putative small multidrug
FT                   resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69615"
FT                   /db_xref="GOA:E3I750"
FT                   /db_xref="UniProtKB/TrEMBL:E3I750"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP69615.1"
FT                   /translation="MVINGRLRWKLLIGLIAAIAFDTMLQIVWKTAVVDTPEVNLSVSA
FT                   SFAAFFANPLFIGVIAIMTLQFFNWLMVLGEADLSYAKPIASLSFASVPIMSVLLLHEN
FT                   FDAVEVAGVICVIAGVFFISQTKPLTSETKLTSRPEAS"
FT   gene            complement(386868..387425)
FT                   /locus_tag="Rvan_0329"
FT   CDS_pept        complement(386868..387425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0329"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   azl:AZL_b05570 FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69616"
FT                   /db_xref="GOA:E3I751"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E3I751"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADP69616.1"
FT                   /translation="MLRIVGVTGSVSSPSRTRAVVEATLARIGDAPDVERTLIDVAELL
FT                   PWLAIRCRDEASPPILHALDAIEGADLLIVGTPVYKGSYTGMLKHLFDLLNYPALFKTP
FT                   VGLIAVGGSDRHALVIEHELRPLFGFFGAKTLPTGIFLSDKTIEGGRVTDDAANARLDH
FT                   LVGEAVHELDLVRLRKAKASTN"
FT   gene            387663..388352
FT                   /locus_tag="Rvan_0330"
FT   CDS_pept        387663..388352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0330"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcj:BCAM0076
FT                   TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69617"
FT                   /db_xref="GOA:E3I752"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3I752"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP69617.1"
FT                   /translation="MVKSALPALEENASGRRLLKSRTDRRREDTRRKLMRATYEIVAER
FT                   GLEGLVIQDITARADVGYGSFYNHFPSKEAIVSAAIEAFRLHTKGMYESLDGLTSNRVE
FT                   AFANDVRVWLRVAKTDRMWGWFMIRAVLAGNDFRFGIADLIRRAVAAGVEEGVFKHADV
FT                   DMARETVAGLLLLATLKLVSGEVDDDYADRIISTALSVLGVPEATILEVMAKPLPDVEL
FT                   PSFLEAA"
FT   gene            complement(388373..389329)
FT                   /locus_tag="Rvan_0331"
FT   CDS_pept        complement(388373..389329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0331"
FT                   /product="Protein of unknown function DUF2236"
FT                   /note="PFAM: Protein of unknown function DUF2236; KEGG:
FT                   cak:Caul_3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69618"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K2"
FT                   /inference="protein motif:PFAM:PF09995"
FT                   /protein_id="ADP69618.1"
FT                   /translation="MSGPEAATAQTFFHGALARRLDRASRALLEPEDGRAVDFRRPAGE
FT                   AALGQPTQVSWRIFKNPLTVFIGGMAAVILELAEPRVRTGVWEHTSFRKQPLRRLRRTG
FT                   LAAMLTVYGPASAAQAMVAGVRRMHARVQGATPDGQPYRADDPDLLNWVQATAAYGFLQ
FT                   AYHAYAAPLSQAARDRYYREGETAASLYGATHPPTSEADLNAAFAAMLPRLEPSPITFE
FT                   FLDIMRTTRIVPPVSRVLTPAAYLAQPMFVRAAVSLTPPEIRERLGLGASYGLRPFERT
FT                   LLRQGGALADRIVLHSSPAVQSCQRLGLPADFLYTSR"
FT   gene            389596..391056
FT                   /locus_tag="Rvan_0332"
FT   CDS_pept        389596..391056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0332"
FT                   /product="trigger factor"
FT                   /note="KEGG: pla:Plav_3235 trigger factor; TIGRFAM: trigger
FT                   factor; PFAM: trigger factor domain-containing protein;
FT                   peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69619"
FT                   /db_xref="GOA:E3I7K3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K3"
FT                   /inference="protein motif:TFAM:TIGR00115"
FT                   /protein_id="ADP69619.1"
FT                   /translation="MQVTETVSDGLKRQLKVVVPAADLKVKVESKLQDLTSKVKLNGFR
FT                   PGKVPIAHVRQMYGRSVLAEVLEETVGESSAKVLEERKERPAFQPDIKLPEDKDVIERM
FT                   LDGTGDLEYTMAFEVLPKIELTDLKAITLTKDVADPKEEDVKGAIDRLLKANVAYETKD
FT                   GAAEAGDRLTIDFKGSIDGEPFEGGAAEDAFLVLGSGRFIPGFEDGLIGAKAADQRDVK
FT                   VTFPEDYQAPHLAGKDAVFDVTVKDVSKPVDAKADDEFAKTLGLESFAKLEDAVRGQLR
FT                   KELDDASRAKLKKELLDALDERHAVELPPSLVTSEFDGIWRGITRQLEQAKKTFEDEGS
FT                   TEEKARAEYQKLAERRVRLGLVLSEIGNQNEIKILDDELRRAMIDRARQFPGQEREVIE
FT                   FYRKNPQALNELRAPVYEDKVITFVLELVKTEENKVSPEDLMKSLAELEREQSLFDGGI
FT                   EEEHEHVHGPDCDHDHDHDHDHAGHKHS"
FT   gene            391312..391956
FT                   /locus_tag="Rvan_0333"
FT   CDS_pept        391312..391956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0333"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: btr:Btr_0876 ATP-dependent Clp protease
FT                   proteolytic subunit; PFAM: peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69620"
FT                   /db_xref="GOA:E3I7K4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K4"
FT                   /inference="protein motif:PRIAM:3.4.21.92"
FT                   /protein_id="ADP69620.1"
FT                   /translation="MRDPVEFYTSQLVPMVVEQTNRGERAFDIYSRLLKERIIFLTGVV
FT                   EDNMASLVIAQLLFLESENPKKEINIYINSPGGHVTSGLAMYDTMQFIRPPVSTLCVGQ
FT                   AASMGSLLLAAGEPGMRWALPNARVMVHQPSAGFQGQASDIERHAEDILKTKRRLNEIY
FT                   VKHTGQPYEVIERTLDRDHFMSPEQAKAFGIIDEVLTKRAAAEETGNPGRS"
FT   gene            392237..393505
FT                   /locus_tag="Rvan_0334"
FT   CDS_pept        392237..393505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0334"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: ATPase AAA-2 domain protein; Clp
FT                   ATPase-like; KEGG: pla:Plav_3231 ATP-dependent protease
FT                   ATP-binding subunit ClpX; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69621"
FT                   /db_xref="GOA:E3I7K5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K5"
FT                   /inference="protein motif:TFAM:TIGR00382"
FT                   /protein_id="ADP69621.1"
FT                   /translation="MTKESRGHDSKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVELC
FT                   MDIIREENKNSYVKSRDGVPTPQEICTVLDDYVIGQDYAKRVLSVAVHNHYKRINHSAK
FT                   NNDVELAKSNILLIGPTGCGKTLLAQTLARILDVPFTMADATTLTEAGYVGEDVENIIL
FT                   KLLQAADYNVDRAQRGIVYIDEVDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASV
FT                   PPQGGRKHPQQEFLQVDTTNILFICGGAFSGLEKIIAQRGKSSSIGFGAKVTSEDDRRT
FT                   GEILRGVEPEDLLRFGLIPEFIGRLPVLATLEDLDEVALVKILSEPKNALVKQYQRLFD
FT                   MEGVQLTLSNEALKSVARKAIERKTGARGLRSIMEAILLDSMFELPSLKGVEEVVISPE
FT                   VIEGNAKPLRIYAERLDESTSAG"
FT   gene            complement(393544..393690)
FT                   /locus_tag="Rvan_0335"
FT   CDS_pept        complement(393544..393690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69622"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69622.1"
FT                   /translation="MAATRVLPPLIRQYMPHKPTVQSAVIKTLIAAIKAAPQTALPVLG
FT                   GVR"
FT   gene            393762..396200
FT                   /locus_tag="Rvan_0336"
FT   CDS_pept        393762..396200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0336"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="SMART: peptidase S16 lon domain protein; AAA ATPase;
FT                   TIGRFAM: ATP-dependent protease La; KEGG: met:M446_6585
FT                   ATP-dependent protease La; PFAM: peptidase S16 lon domain
FT                   protein; AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69623"
FT                   /db_xref="GOA:E3I7K7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K7"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ADP69623.1"
FT                   /translation="MTNPTSDHPTATGQGEIFPVLPLRDIVVFPYMIVPLFVGREKSIN
FT                   ALDEVMRTDRQILLAAQKNAGDDDPEPDAIYTMGMLATVLQLLKLPDGTVKVLVEGTTR
FT                   ARIKGFVPNDNYFEAEVERIEETLGNQDEIEAFARSAISQFENYVKLNKKISPEVLSTL
FT                   SQIEDYSKLADTIASHLAIKIGDKQEILELLSVSERLERVFTLMESEISVLQVERKIRS
FT                   RVKRQMEKTQREYYLNEQMKAIQKELGDSDERDDISEFEEKIENTKLSKEAKDKAIAEL
FT                   KKLKQMSPMSAEATVVRNYLDWLLSIPWGVKGKVKKDLDEAQAVLDEDHYGLERVKERI
FT                   VEYLAVQKRTNMLKGPILCLVGPPGVGKTSLGKSIAKATGREFVRMSLGGVRDEAEIRG
FT                   HRRTYIGSMPGKVIQSMRKAKKTNPLFLLDEIDKMGMDFRGDPASALLEVLDPEQNHEF
FT                   NDHYLEVDYDLSNVMFVTTANTLDIPPALRDRMEIIRLAGYTESEKLEITKRHLLRGQM
FT                   EAHGLQPGEWSVDDEAIVEIIRRYTREAGVRSLEREIAKLARKAVKQIESGKQVKVNVT
FT                   LDNLRDFLGVQKYRYGEAELEDQVGVVTGLAWTEVGGELLTVEGVMMPGKGRMTVTGNL
FT                   RDVMKESIQAANAYVRSRCVAFGIEPPLFDKRDIHVHVPEGATPKDGPSAGVAMVTAIV
FT                   SILTSVPVRRDVAMTGEITLRGRVLPIGGLKEKLLAALRGGIKRVIIPEENAKDLAEIP
FT                   DNVKNGLEIIPVARMDEVLAIALTRKLDPIEWDEAAALAAAKMKEIGQPSVADGSGLPH
FT                   "
FT   gene            complement(396275..396745)
FT                   /locus_tag="Rvan_0337"
FT   CDS_pept        complement(396275..396745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0337"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   gdj:Gdia_0454 protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69624"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K8"
FT                   /inference="protein motif:PFAM:PF06172"
FT                   /protein_id="ADP69624.1"
FT                   /translation="MVPMKTVQADFRDPTLTADQARAALDLRPHPEGGHYRELWRDAPP
FT                   HGERGAASAILFLLAAGERSHWHRVDAAEIWIWQAGAPLALGIAHADGRRETLTLGPNA
FT                   GGGEAFQGVVPAFAWQEAVSLGAWTLVSCIVAPAFCFEGFELASPGWSPDAA"
FT   gene            complement(396893..397085)
FT                   /pseudo
FT                   /locus_tag="Rvan_0338"
FT   gene            complement(397172..398197)
FT                   /locus_tag="Rvan_0339"
FT   CDS_pept        complement(397172..398197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0339"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="KEGG: bra:BRADO6235 putative lysophospholipase L2,
FT                   (lecithinase B); PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69625"
FT                   /db_xref="GOA:E3I7K9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7K9"
FT                   /inference="protein motif:PRIAM:3.1.1.5"
FT                   /protein_id="ADP69625.1"
FT                   /translation="MIGSDMATHGVSPAAELIGITRNPVPGGAICGTFASRDGLQIRYA
FT                   RWDTTAERRIGTVCLFHGRTEFIEKYFETIGDLRRRGFAVATMDWRGQGGSSRMLKNRS
FT                   KGHAENFAQFDDDVRRFMSSIVLPDCPPPYYCLAHSMGGHLVLRLAQTKVCWWDRIVLT
FT                   APMIDFAQTEKRKGLIGLGAEVLTLLGFGDSFIPGGKAQLWERAPFDGNPLTSDRLRYE
FT                   RAQDVLRASPGLGIGAPTIGWVQAACASVATLASTAFMESIRVPTLIVAASNDQIVSNT
FT                   AMERFASHVKNCRLIVVSGARHEILMERDQLRDQFWAAFDAYVPGSTLLPRRLEQPEIA
FT                   L"
FT   gene            398375..398854
FT                   /locus_tag="Rvan_0340"
FT   CDS_pept        398375..398854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0340"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mno:Mnod_1728
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69626"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L0"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADP69626.1"
FT                   /translation="MRRLDLSPLYKSAIGFDHLANVLDQLSGLESESGFPPYNIERLGE
FT                   NVYRVTMAVAGFGENDLSIDVKEGTLTIRGEKKGEPAARAYIHQGIAARNFERRFRLAD
FT                   YVEVSAAALENGLLHVDLKRELPEAMKPRTIQITKGAPQPRVIEGDAASKVEAAA"
FT   gene            complement(398881..400212)
FT                   /locus_tag="Rvan_0341"
FT   CDS_pept        complement(398881..400212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0341"
FT                   /product="(Uracil-5)-methyltransferase"
FT                   /note="PFAM: (Uracil-5)-methyltransferase; KEGG:
FT                   (uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69627"
FT                   /db_xref="GOA:E3I7L1"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L1"
FT                   /inference="protein motif:PFAM:PF05958"
FT                   /protein_id="ADP69627.1"
FT                   /translation="MKKHSSQPRASDSPPEDLETLTLGINAMGAQGDGVARVGDAPVHI
FT                   PFTLAGEIVQAEVAGAKGRLIAVEVASPERVDPVCRHFGVCGGCALQHWAATPYDAWKA
FT                   GLVEAALAQARVRAPSVETRKTYPISSRRRAAFTARKDEGALRLGFNAARSHDLVDIEE
FT                   CPILSPQLAAALPHLRAGLRGAMADRGEAKIQVAAVDNGLDVAIAGPRLASSARHALES
FT                   ELQAADAIRASWNGEALFISGVPRVGFGGVRVSLPGGAFLQAVEACERDMGAFTVEALD
FT                   AAGAGKGPVCDLFAGLGAFTFPVATRASVTAYEDNAAAVAALSAAAKESKGLKPVKAIR
FT                   RDLFRSPLGFQELNAFAAAVLDPPREGAEAQARALAQSKIPAAVMLSCNPATFARDAAI
FT                   LAEGGFELTRLAAFDQFRYSAHVEVAALFRRPRTKKGRLSPALR"
FT   gene            complement(400175..400975)
FT                   /locus_tag="Rvan_0342"
FT   CDS_pept        complement(400175..400975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0342"
FT                   /product="hemolysin A"
FT                   /note="TIGRFAM: hemolysin A; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; RNA-binding S4 domain protein;
FT                   KEGG: hemolysin A; SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69628"
FT                   /db_xref="GOA:E3I7L2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L2"
FT                   /inference="protein motif:TFAM:TIGR00478"
FT                   /protein_id="ADP69628.1"
FT                   /translation="MIAPNIVICNKLNVDVYETLGPRVKIRLDHLLVQRELAETRSKAQ
FT                   DMIRRGVIRVRGRTDMKPGFEVSDDEPVEVLEKMPYVARSALKLAAALDAFGLAPNART
FT                   CLDVGASTGGFTEVLLERGATRVYAVDVGRDQLHASLRQNVRVVSMEAQDARSLAPALF
FT                   DAPIEAVTCDVSFISLEKVLPAVLPLAAPGAWLVALVKPQFEVGRDGVGKGGIVKDENL
FT                   RRAAVERVMACIEAEGWRVIGAVASPIKGQDGNEETLVAASRER"
FT   gene            401176..401592
FT                   /locus_tag="Rvan_0343"
FT   CDS_pept        401176..401592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0343"
FT                   /product="nuclear protein SET"
FT                   /note="KEGG: mlo:mlr3116 hypothetical protein; PFAM:
FT                   nuclear protein SET; SMART: nuclear protein SET"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69629"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L3"
FT                   /inference="protein motif:PFAM:PF00856"
FT                   /protein_id="ADP69629.1"
FT                   /translation="MMLVRTYLSNSAIEGVGIYAAEPIKKGDVIWRLEPKFDVFFTEAD
FT                   IEELPTHMQDFIQRYSYPHMQKKGIWVLESDNGRFMNHSEAPNTDFTDAELGYAIRDIA
FT                   AGEEITCNYHEFDSSFQGWFPTLTKVNGDAHSHP"
FT   gene            401754..402362
FT                   /locus_tag="Rvan_0344"
FT   CDS_pept        401754..402362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69630"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L4"
FT                   /inference="similar to AA sequence:KEGG:Mchl_4188"
FT                   /protein_id="ADP69630.1"
FT                   /translation="MRSAAMKNWTRGFCFGLAGLSVLTVVAPNDAGAECYVQAPLRPVH
FT                   RTFIRRDVVEPGVYEVSRRPGLHGVIRQQVAVAGNVVWRETPPVYKTVTVRVRKRGGSI
FT                   WSERCVGGQAAVCRVRVPPQDILVEKQVLVRPGRRWAEQVAPDAVALTERRVLLRPYKN
FT                   YAHFQRPYVAFSRERVAVQPEGARWVPAPSQPQCCEPKC"
FT   sig_peptide     401754..401834
FT                   /locus_tag="Rvan_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.704) with cleavage site probability 0.390 at
FT                   residue 27"
FT   gene            complement(402644..404398)
FT                   /locus_tag="Rvan_0345"
FT   CDS_pept        complement(402644..404398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0345"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bra:BRADO4549 putative D-alanyl-D-alanine
FT                   carboxypeptidase (peptidase S11)(dd-carboxypeptidase);
FT                   PFAM: peptidase S11 D-alanyl-D-alanine carboxypeptidase 1;
FT                   Sporulation domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69631"
FT                   /db_xref="GOA:E3I7L5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L5"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ADP69631.1"
FT                   /translation="MAALFLLAVSSPAEARRRASHAQSYSTASSAMVVDFHTGRILISR
FT                   NATDPRFPASVTKVMTLYLLFDALRDGKLNMNTKLRVSAYAASQSPTKLGLDAGDTITV
FT                   SDVIGAIVTKSANDMAVVVAEALAGSEEEFARRMTQKARTIGMLNTTFRNASGLPNSEQ
FT                   RTTAQDLVILARSVITDHPERSRVFSTKYFQYDGEIYRNHNTMLFSYEGMEGMKTGFTS
FT                   ASGFNLLATARRGEKRLIAVVLGGSSARVRNAAMRNILDASWSKAMTLTAAKKAGALVS
FT                   SFAPKQFAQAAPEKPSAADRKSESRATAEPRQVASAEATAKDPAPAAAPQAGGTAHLRR
FT                   VSRLPAGALQLKRKPDATSNAILFSSLENGLAVRATREPDASSDDTSTDEPEEATGRAM
FT                   VDRGATASGAKQVAVTMTFPDPGEAQPKNMSVHNKTVRLPEVAPLAAAAVEADGETAEA
FT                   VATDRSPRLTGVHVTLASNAAPEPRTIATAEAGASREVVDQPGPYHVQVGAFPDHSQAQ
FT                   LRLESVRQTLGPAFCKSHPDFIMPVSLSSGATMFRVRLARFDNEAQAKSVCQKLKRSGI
FT                   ECMNVRAP"
FT   gene            404919..405305
FT                   /locus_tag="Rvan_0346"
FT   CDS_pept        404919..405305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0346"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: pla:Plav_2797 ATP-dependent Clp protease
FT                   adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69632"
FT                   /db_xref="GOA:E3I7L6"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L6"
FT                   /inference="protein motif:PFAM:PF02617"
FT                   /protein_id="ADP69632.1"
FT                   /translation="MWQTLETFRLPIGSRMVAAMAGNNGFKDDNGLKTGAVTKTRPKTK
FT                   RPSLYKVLLLNDDYTPMEFVVYVLERFFNKPHEEATLIMMHVHQKGVGICGVYTYEVAE
FT                   TKVTQVMNFARQHQHPLQCTMEKE"
FT   gene            405314..407674
FT                   /locus_tag="Rvan_0347"
FT   CDS_pept        405314..407674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0347"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit clpA; PFAM: ATPase AAA-2 domain protein; Clp domain
FT                   protein; AAA ATPase central domain protein; Clp
FT                   ATPase-like; KEGG: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69633"
FT                   /db_xref="GOA:E3I7L7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L7"
FT                   /inference="protein motif:TFAM:TIGR02639"
FT                   /protein_id="ADP69633.1"
FT                   /translation="MPSFSNSLEESLHRAIEYANERHHEYATLEHLLLSLLDDRDASSV
FT                   LRACNVDVERLRAKLTEFLDKELNNLVLDQDGEAQPTASFQRVIHRAVVHVQSSGREEV
FT                   TGANVLVAVFAERESNAAYFLQEQDMTRFDAVNFISHGISKRAGMSEPRGVRGVEDDAT
FT                   TVDGAEEKKRSTDALEAYCVNLNQKAKDGRIDPLIGRDKEIERTIQVLCRRSKNNPLYV
FT                   GDPGVGKTAIAEGLARKIVRGEVPQVLANATVFSLDMGTLLAGTRYRGDFEERLKAVMK
FT                   EIEAYPGAILFIDEIHTVIGAGATSGGAMDASNLLKPALQSGVLRCIGSTTYKEYRQHF
FT                   EKDRALVRRFQKIDVAEPTVEDAIEIMKGLKPYFEDFHNIKYTNQAIKAAVELSAKYIH
FT                   DRKLPDKAIDVIDETGASQMLLAPSKRKRTIGVKEVEATVATMARIPPKTVSKTDTELL
FT                   RNLEGDLRRVVFGQDQAIHALSAAIKLARAGLRDAEKPIGSYLFSGPTGVGKTEVARQL
FT                   ASLLGVQILRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQNPHCVLLLDEIE
FT                   KAHPDLFNVLLQVMDHGKLTDHNGKQVDFRNVVLIMTTNAGAADMAKPAIGFGSQQRVG
FT                   EDEEAIKRMFSPEFRNRLDAVIPFARLSREMIGRVVEKFIFQLEAQLADRNVIIELTPE
FT                   AMEWLADHGYDEMYGARPLARVIQESIKKPLAEELLFGKLEGGGTVRVVVEEKDGQKQL
FT                   AFEVIEAKPPVVKAEDAEASEGDGPALLPKGAA"
FT   gene            408604..409323
FT                   /locus_tag="Rvan_0348"
FT   CDS_pept        408604..409323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0348"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: azc:AZC_1599
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69634"
FT                   /db_xref="GOA:E3I7L8"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L8"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ADP69634.1"
FT                   /translation="MTRTEAGFRMAFRDAARAPAAVLCLSFIGFGVLCHGNGVSLAFAL
FT                   YTTIFMYALPGQVTLVDQIGRDMPLWTAALAVSLTGVRLLPMTIALVPYLRGGRETRPV
FT                   DYLASHFVSVTLWIESMRRVPFLPRGLRLPFYFGLTTMLVGVSTLGTVAGYLIADRLPP
FT                   IVAASLIFLTPVYFFMGLSANARAAADFAPILIGFGMAPFFMWLTPSLDLVLSGLVGGT
FT                   VSFLLFRRKLASRAEKA"
FT   gene            409334..409672
FT                   /locus_tag="Rvan_0349"
FT   CDS_pept        409334..409672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0349"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   rpb:RPB_2402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69635"
FT                   /db_xref="GOA:E3I7L9"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7L9"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ADP69635.1"
FT                   /translation="MHDSIWIWLSFAIMGTAASDIWRFAGVLLSRGVDPESAVILWVKD
FT                   VSTALVAALIARMLLSPTGALAGVGDAVRFIAFGTGLVAFWLSGRRLAVGLLAAEAAFF
FT                   AAHAILGQ"
FT   gene            409837..414633
FT                   /locus_tag="Rvan_0350"
FT   CDS_pept        409837..414633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0350"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /note="PFAM: NAD-glutamate dehydrogenase; KEGG:
FT                   NAD-glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69636"
FT                   /db_xref="GOA:E3I7M0"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M0"
FT                   /inference="protein motif:PFAM:PF05088"
FT                   /protein_id="ADP69636.1"
FT                   /translation="MAQKADRTGAGSSVLACPHPNATDDLASRFAAQLVAESGCSDLAS
FT                   GQAAAFTTLAAEAFANLCRRHSPAPEISIRSHTSHEGEHIVIDIANDDMPFLLDSVLGE
FT                   LRELGLIPFVVAHPIFEVERDGNGLLTALAPAAPEPNGHARESVIHLEIPRPGIAPSFE
FT                   TIDRALRRVIGDTALVVGDFHAMTNRLHAAIADIEQNPPPASPQTNAEGIDFLRWIAVD
FT                   NFIFLGVREFAYDAKGGELIPQTKRSLGLLRDPERIVLRVEPTRVLTPESRTYYLNAPP
FT                   VVVIKANAKSTVHRRVHMDAIAVKLHDAERRVTGQIVFAGLFTATAYNLPVNNVPILRR
FT                   TVKKVLQRSRHPAESHSGRALMNVLETFPREELFQISPERLSTISEEILKTELAPRPRV
FT                   LVRRDEFRRFVTVLVYVPREKHNTSVRERIEAMLAESFDGRFEQTTPYYPESAMVRLQV
FT                   EIWKAGGDLLDPDERELEAKVEDIITTWADRFSARVLAERGGDGQALIEKYRDAFPAGY
FT                   QERNDAERALKDIERFEKLNERHRTGIDLYRAGDAEPDAVRATLQQLDEPLTLSRRVPI
FT                   LENLGFDVISERTYLLTPKANGGARRFYLHDIDLRLREGDAATFCERREALEDGFLAVW
FT                   ADAVPNDRFNGLILAAGLDWRQAALIRAYAAYYRQTGATYSAAYVAETLVKHGVIAADL
FT                   FRLFEAMFDPAKGSDAEREAARLAIAERIFAALDAIPSMDDDRILRQLASLIGATLRTN
FT                   FYQRSADGMPPEAIAFKLRSRDIEWLPAPKPYAEIFVSSPRFEGVHLRGGSIARGGLRW
FT                   SNRPQDFRTEILGLAKAQQVKNAVIVPQGAKGGFVPRASAGANRDATYDEGVAAYEGFV
FT                   SSLLSLTDNLVKGEIVPPADTVRRDGDDPYLVVAADKGTATFSDFANEIATKRGFWLGD
FT                   AFASGGSAGYDHKKMGITARGAWEAVKRHFREMNVDIQTTPFTVAGVGDMSGDVFGNGM
FT                   LLSRKIRLVAAFDHRDIFIDPDPDTGTSFEERKRLFERPRSSWQDYDRAKISADGGVYS
FT                   RKEKSIALSDAAQKLLGVGAQATPQDVMAAILRADVDLLWFGGIGTYVRASTETDAQAG
FT                   DKANDAIRAAANELRAKVIGEGANLGVTQRGRIEFALAGGRINTDAIDNSAGVNTSDVE
FT                   VNIKIALSRAVAEGRIDTPERNAILAAMTDDVAAAVLRNNYLQTLALSVAESDGLAELG
FT                   FQQRLIQRLVKEGRLNRAVEALPTDAHLAERATQGKPLTRPELAVLLAYAKIVLEDDLV
FT                   KTKALDDPFLARELPAYFPPAMRERFAAEIDAHPLRRAIIATSLANDIVNRGGPTFVVR
FT                   LMDETGQSPEAVACAFAAVCAIYDLSAIHAGLDALDGRIDSVEQLRLYRFVRDLLRRQS
FT                   GFFLRQHRFRDGLEQGIAPYAQGIAALSAEMATLLPEKAVARLGEAEARLREIGLSPDF
FT                   ARRVAALEPLAQALDIVRVAGDMETPVEDAARVVFAIRDAFHLDDIAAASEALAGGDHF
FT                   NRLAVDASLAGIASAQRRLARSILAQSTRRPDFATWRARNEAPVSRVAEGLAEVLSGRG
FT                   LTLAKLTVAVAQFRDLSAP"
FT   gene            414719..415108
FT                   /locus_tag="Rvan_0351"
FT   CDS_pept        414719..415108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0351"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: gau:GAU_3816 putative endoribonuclease;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69637"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M1"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADP69637.1"
FT                   /translation="MTRRAIIDAPGLGKALGPYSRAVWAGNTLFLSGQLGTEPATNKLV
FT                   EGGAGPETDQILKGIAAVLKEAGLTLDNVVKSNVYLTDMTDFAAMNAVYETHFTAPYPS
FT                   RTTIGITALPGGAHVEIEVVAVKDV"
FT   gene            415450..415701
FT                   /locus_tag="Rvan_0352"
FT   CDS_pept        415450..415701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69638"
FT                   /db_xref="GOA:E3I7M2"
FT                   /db_xref="InterPro:IPR001893"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M2"
FT                   /inference="similar to AA sequence:KEGG:RPE_1961"
FT                   /protein_id="ADP69638.1"
FT                   /translation="MITKRIALFAAAAAMLMSADAAFAQRYGRGPVATVCAADINRHCN
FT                   RLHHGRGEVRACLQSNWRRLSHDCRSVLRNPGGGQRWR"
FT   sig_peptide     415450..415515
FT                   /locus_tag="Rvan_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.585 at
FT                   residue 22"
FT   gene            415814..416296
FT                   /locus_tag="Rvan_0353"
FT   CDS_pept        415814..416296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpd:RPD_2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69639"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M3"
FT                   /inference="similar to AA sequence:KEGG:RPD_2386"
FT                   /protein_id="ADP69639.1"
FT                   /translation="MSRTAICISATLFGFAAIAAPALAQKGTGEPSGVARQGLKLPVEA
FT                   MSGTIEAIKIGRCEKTTGRSAEGAHLIVQMPDAKINLHLGPTFALRDELKQLSVGQNIS
FT                   FEAFRTDRMPKGAYIAKSIRAGDKVFALRNDSLRPIWARGRGGGLPVARGGGICWW"
FT   sig_peptide     415814..415888
FT                   /locus_tag="Rvan_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.904 at
FT                   residue 25"
FT   gene            416337..416762
FT                   /locus_tag="Rvan_0354"
FT   CDS_pept        416337..416762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69640"
FT                   /db_xref="GOA:E3I7M4"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M4"
FT                   /inference="similar to AA sequence:KEGG:RPE_3974"
FT                   /protein_id="ADP69640.1"
FT                   /translation="MRKTVLAAVMLSVLAVSARADDNRIAIDLPPDIKARFLEQMRTHM
FT                   NALNDVIHLMAAGKVREAGSVASSEMATGKGKGIGRFMPPEFREMGFDYHRSAGDFARL
FT                   TAEISEPMDAAGWEKAVGGVAQITARCSACHATFRVK"
FT   sig_peptide     416337..416399
FT                   /locus_tag="Rvan_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            417044..419221
FT                   /locus_tag="Rvan_0355"
FT   CDS_pept        417044..419221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0355"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding domain 1 protein; KEGG: azc:AZC_0439
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69641"
FT                   /db_xref="GOA:E3I7M5"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADP69641.1"
FT                   /translation="MKVSFTSRLALIACLSAVVPQAMAQDADSRPPLADLDALAMEPQT
FT                   EAAPENAAPAPGSLDDIKAEVSPHAPRTAATHEGNPSVRNAAAKHETPPAAPVESTVEN
FT                   AIADPLAPKDDEDGPALLAPGAPTHPAVAAEAPAGDPVAPLVVERVANAGGKADARDDV
FT                   SAVKTFYTATKGKPVWTSAEGFTPAATKAIREIRAADSYGLDASAFELPASAGATPEAR
FT                   AEAEVKLSLAILKYARHARGGRIDPPSISPAMDRKPHVYEPKSVLEAIAAADDADAYLR
FT                   GLHPKSEQFKRLRQALIALGKTTDSGTSSIRIPAGKTFKPGDDDAQIALIRKRLNAGLD
FT                   APRDTIYDEALLVAVNRFQKERGLNVNGIVDKKLRAALNEGAGGSVDEKKMRLIVNMER
FT                   WRWMPDDLGEFYVWNSIPEQTTRVFDRGRVAFQERIVVGKPTSQTPSFSAKMQFVIFNP
FT                   EWGVPDGIKANEIAPKLRRAAPSGPSDDLFSFLGGRSGGGGGGGASSVLQRLGGLRVTY
FT                   NGRDVDPDSVDWSRVDARRYSFIQPAGPRNALGVVKFRFPNKHDVYMHDTPEKSLFGSA
FT                   TRAFSHGCMRTQNPVRFAEVILAYDNGTTPEQIRRQIESGQTTENKLTKTIPVHMVYFT
FT                   AAPDEKGDIRYFSDLYGLDARVASALKGENFRFEGDPVVAVAQESAPPQREAQDSTQRL
FT                   DQYGRPVRGADPYGQPQRGPRGREAWSPFDW"
FT   sig_peptide     417044..417118
FT                   /locus_tag="Rvan_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            419412..419741
FT                   /locus_tag="Rvan_0356"
FT   CDS_pept        419412..419741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0356"
FT                   /product="thioredoxin"
FT                   /note="KEGG: bid:Bind_2176 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69642"
FT                   /db_xref="GOA:E3I7M6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M6"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADP69642.1"
FT                   /translation="MATTAVSDASFEQDVKNAELPVLVDFWAEWCGPCRTVGPILEELS
FT                   EEFAGQLKVVKLDVESNPGIAQAYNIRGIPALLLFKNGEVAGQQIGALPKQQLRAWISG
FT                   AIASV"
FT   gene            420086..421678
FT                   /locus_tag="Rvan_0357"
FT   CDS_pept        420086..421678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0357"
FT                   /product="protease Do"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   bja:blr3130 serine protease DO-like precursor; SMART:
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69643"
FT                   /db_xref="GOA:E3I7M7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M7"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ADP69643.1"
FT                   /translation="MTDSSPEGRTNTAKKQSQISVILSRFGKKSTIYVSAAALALGAFV
FT                   GAASFEPNPARAFSQGENVSQGEGMRQKLPSFAPLVKQVKPAVVSIRVKSDAAAKAAFG
FT                   DDEGGPRGNPFEGSPLERYFGGPGGPRGGFGPWGRAPGGKGGPRQLVTAQGSGFFISPD
FT                   GYLVTNNHVAQDAVSLEVVMDDGKIYTAKVIGTDPRTDLALLKVDGRTDFPYTKFSHSG
FT                   AEIGDWVVAMGNPFGLGGTVTAGIVSARGRDIGEGPYDDFIQIDASVNKGNSGGPTFNE
FT                   SGEVIGVNTAIYSPSGGSVGIAFAIPAPTVERVVAALKDKGHVTRGWLGVQIQGLTPEL
FT                   ADSLGLKTTAGALVAAPQSGSPAEKAGIKTGDVITEVDGTEVKDGRDLAKKIADLAPGA
FT                   NAKLTVLRDGETKTVDLKIGQLPEKPTQRASLSDDGRTGLNDLGIAVAPAADVSPNDRQ
FT                   GLAVVGVEPGGKAAEAGLAEGDIILRVGDQTVNRPGDLKRALSDASKSGKKNALALVKR
FT                   NGDQRFVALPAVS"
FT   gene            421942..422916
FT                   /locus_tag="Rvan_0358"
FT   CDS_pept        421942..422916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0358"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: rpt:Rpal_0855 heat
FT                   shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69644"
FT                   /db_xref="GOA:E3I7M8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M8"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADP69644.1"
FT                   /translation="MNFFRTMLLLAALTALFMAIGFLIGGQTGMLIAFLIAAGMNVFAY
FT                   WNSDKMVLAQQGAEEVDERTAPELYSIVRQLAANANLPMPKVYIIHTDQPNAFATGRNP
FT                   QNAAVAASAGLLRIMSKEEVAGVLAHEMAHIKNRDTLIMTIAATIAGAISMLANFGMFF
FT                   GGNRDNNGGGIVSTLLAVIVAPLAAGIIQMAISRSREYVADKDGGEICQRPLWLASALQ
FT                   KIEQAAHQIPNEQAERNPASAQLYIINPLSGQGMDNLFSTHPNTANRVAALVEQARQMG
FT                   DTQEPTAAHMSPVQGFEAGSGPWQQRPRSGRRPFEVGPWNRSS"
FT   sig_peptide     421942..422019
FT                   /locus_tag="Rvan_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.371 at
FT                   residue 26"
FT   gene            423205..424482
FT                   /locus_tag="Rvan_0359"
FT   CDS_pept        423205..424482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0359"
FT                   /product="sun protein"
FT                   /note="KEGG: nwi:Nwi_0156 tRNA and rRNA
FT                   cytosine-C5-methylase; TIGRFAM: sun protein; PFAM: Fmu
FT                   (Sun) domain protein; NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69645"
FT                   /db_xref="GOA:E3I7M9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7M9"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ADP69645.1"
FT                   /translation="MARRLAVFLLKSVLHDHQSFDEAFAGSSARDAFAAMESRDRAFAR
FT                   AIATIALRRLGQVEDMLARFLEKPLAADAFEARAILIAGATQLAFMDVAPHAAIGLAVE
FT                   QAKASRFSRHLGGLINAVLRRVNENKAAILSEQDAAVLNTPAWLWERWVAAYGEATARE
FT                   ITGAHLEEPPLDLSVKADAATWAAKLEGEVLPWGSVRLSHKGRVEEIEGYAEGAWWVQD
FT                   AAAAIPALLLGDIAGKRVADLCAAPGGKTAQLAAAGAQVTSVDISASRLRRLGENAARL
FT                   GLSVEIVKANVGDWQPKDCFEAILLDAPCSATGTIRRNPDIAYLKTAEDIAALARVQKR
FT                   LLAHALTLLAPGGTLVFATCSLEPEEGEAQIAALLADRADVRLLPVDAAALNLPPEVVT
FT                   PNGCLRTLPFHAGGMDGFFAARLTRI"
FT   gene            complement(424509..425345)
FT                   /locus_tag="Rvan_0360"
FT   CDS_pept        complement(424509..425345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0360"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="KEGG: rpe:RPE_2601 2-dehydro-3-deoxyphosphooctonate
FT                   aldolase; TIGRFAM: 2-dehydro-3-deoxyphosphooctonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69646"
FT                   /db_xref="GOA:E3I7N0"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N0"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ADP69646.1"
FT                   /translation="MTLQSPNSVVDIRGVRLGNALPLALFAGPCQLESRAHALEMASAL
FT                   KEIAGRLGIGLVYKTSFDKANRTSANAKRGLGLDAALPIFAEIRESLGLPIVTDVHEAS
FT                   QCARVAEAVDVLQIPAFLCRQTDLLIAAAETGRVVKVKKGQFLAPWDMKNVVAKVLAAG
FT                   NPNVLVTERGASFGYNTLVTDMRALPILAETGAPVVFDATHSVQQPGGQGTATGGDRRF
FT                   VPVLARAAVAVGVAAVFIETHQDPDHAPSDGPNMVPLGELEALLRNLQAFDRLAKA"
FT   gene            complement(425417..427045)
FT                   /locus_tag="Rvan_0361"
FT   CDS_pept        complement(425417..427045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0361"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: pla:Plav_3156 CTP
FT                   synthetase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69647"
FT                   /db_xref="GOA:E3I7N1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N1"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADP69647.1"
FT                   /translation="MARYIFITGGVVSSLGKGLASAALGALLKARGYSVRLRKLDPYLN
FT                   VDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTGVSARRDDNITTGRIYQNVLSAERR
FT                   GDYLGGTVQVVPHVTNAIKDFVLSGNDDADFVLVEIGGTVGDIEGLPFFEAIRQLGNEL
FT                   PRREAIFIHLTLLPYIKAAGELKTKPTQHSVKELRSIGIQPDILLCRSELPVPKSDRAK
FT                   IALFCNVRESAVIQALDVPNIYDVPLAYHDEGLDREVLAAFGITDAPEPNLDVWRTISH
FT                   RIDHPDGEVSIAIVGKYTNLKDAYKSLTEALSHGGIENGVRVKIHWLDSELFEKADVAP
FT                   YLENIHGIIVPGGFGERGTEGKIEAVQFARTKRVPYLGICFGMQMAVIEAARHVAGISG
FT                   ASSTEFGPAVEPVVGLMTEWRAGEKAVQRHAESDKGGTMRLGAYDAVLAEGSKVAEIYG
FT                   KTRISERHRHRYEVNITYRDKLERAGLRFSGLSPDKSLPEIIEIPDHPWFIGVQFHPEL
FT                   KSRPFDPHPLFSSFIAAAVAQSRLV"
FT   gene            complement(427170..427529)
FT                   /locus_tag="Rvan_0362"
FT   CDS_pept        complement(427170..427529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0362"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: preprotein translocase, SecG subunit; TIGRFAM:
FT                   preprotein translocase, SecG subunit; PFAM: Preprotein
FT                   translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69648"
FT                   /db_xref="GOA:E3I7N2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N2"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADP69648.1"
FT                   /translation="MANVLLVLHIVVAVTMVVIILLQRSEGGALGMGGGGGGGGFVSGR
FT                   GAANVMTRTTAILAAIFFLTSITLGILGQRKTPTSAIGTPTSTSAPTTAPSQAPADAPA
FT                   LPKLNIPKPAAPAQQ"
FT   gene            427837..428469
FT                   /locus_tag="Rvan_0363"
FT   CDS_pept        427837..428469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0363"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG: isochorismatase; PFAM: isochorismatase
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69649"
FT                   /db_xref="GOA:E3I7N3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N3"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ADP69649.1"
FT                   /translation="MILENKAGWVLEPGRCALLIHDMQRHYLDALPDAATRADLVGKVA
FT                   GLRALCAEWGVPVFASMVPEAHGLQERGLMSELWGRGPRGDGAMLDQALLGNDSRIRLI
FT                   TKRSYSAFYGTDLEVMLRRLGRDSLVITGLYTSIGCFSTALEAFARDIRAFVVADATAD
FT                   MSAADHAAGLRNAARLCARVVDSGDVRAALAPHSLRPVDRRAAIDVC"
FT   gene            complement(428512..429021)
FT                   /locus_tag="Rvan_0364"
FT   CDS_pept        complement(428512..429021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0364"
FT                   /product="histone methyltransferase"
FT                   /note="KEGG: cre:CHLREDRAFT_37866 histone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69650"
FT                   /db_xref="GOA:E3I7N4"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N4"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_37866"
FT                   /protein_id="ADP69650.1"
FT                   /translation="MTRDEKSAGKASKGALVAAAALAVIAAMTSGRADAAQLDKAACAK
FT                   LTQDLQALKALDVDRLMEHGPNWAVANLSAPDLNLVRQYIELDEQMKFRCMAPSSLVQL
FT                   KNLEEEDEDGAKPQAGPDSAPPSAAGADQPVKPKPKANATTQAQKPIAQKPKPPAPAQA
FT                   GVVGAQ"
FT   sig_peptide     complement(428914..429021)
FT                   /locus_tag="Rvan_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 36"
FT   gene            complement(429103..429885)
FT                   /locus_tag="Rvan_0365"
FT   CDS_pept        complement(429103..429885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0365"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="TIGRFAM: triosephosphate isomerase; KEGG:
FT                   ara:Arad_8178 triosephosphate isomerase; PFAM:
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69651"
FT                   /db_xref="GOA:E3I7N5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N5"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ADP69651.1"
FT                   /translation="MSGPKLYVAGNWKMNGLRPDLTQIQAIRDGVASVENAPDVTVFPP
FT                   ATLLHAASQIVEGSLVEIGAQDCHVGEKGPFTGDLSALMLKDSGATTVILGHSERRAEH
FT                   GETSREVRAKAATALRAGIKIVVCIGETRGEHVRGLTASVCRRQLADSLPDESTPETTI
FT                   VAYEPVWAIGSGVSPTTEQITAVHEIVRGCLKDRFRETSGMRWRVLYGGSVSPANAAST
FT                   FDSPEVDGVLVGGASLKAATFLEIITAAARASERRSAR"
FT   gene            430062..431963
FT                   /locus_tag="Rvan_0366"
FT   CDS_pept        430062..431963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0366"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: mno:Mnod_5572 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69652"
FT                   /db_xref="GOA:E3I7N6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N6"
FT                   /inference="similar to AA sequence:KEGG:Mnod_5572"
FT                   /protein_id="ADP69652.1"
FT                   /translation="MHMLRKVAVFIMFAILIGAFAISMGGNYYGDRERRQSVATVGSAS
FT                   ISPEDFRRAYQRVLENVSQQAGRRISPAEAQAFGLPNRVLQGLIQDAALDLEAKELGVG
FT                   LSEEGVRRGITSLDVFQDKGVFSADKYHRFLQNIGYTAPFFEQEYRGDLIRRQLRGVFD
FT                   GSGVVPKALLEAYNKYGNEQRTLAYFTLTPEAAGAVPAPTEAELQAFYEDRKPQFMTPE
FT                   LRKVSALAISPQTVAKSLTIPDEDLKAEYAAKASVYSVPERRKLEIVPFKTRADADAAY
FT                   AKLKSGARDLLGVAKDAGFSQPEIDAGVVSRKELADKFGINDAIVKEAFSTEKGWTSRP
FT                   VDGPVSTVIMRVLEVVPGQERSFAEVKDQIRADLAKTRAQSEFQRLIKAFEEDRSTGIP
FT                   LADSAKKLNLPLEEVTIDRSAKDADGKPVTVSVVPAAQLADAAFKSDVGVENEAIRLQG
FT                   GGYAWFEVADVVKPRQKPLEEVKGEVEAAWRADQVRDRLASRARDLVARLDKGETIDAV
FT                   AKSVGATVKTSQPLKRNGKEDGVPPAAIAQAFTLPEGGAGSAGSENGTSRAVFQLAKIT
FT                   QPGPLAEEQAKGLEQQLAGAISDDNFSGFLNRITTASPISIDRKAFANVSGGAYDGE"
FT   gene            432036..433553
FT                   /locus_tag="Rvan_0367"
FT   CDS_pept        432036..433553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0367"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; KEGG:
FT                   xau:Xaut_4378 anthranilate synthase component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69653"
FT                   /db_xref="GOA:E3I7N7"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N7"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ADP69653.1"
FT                   /translation="MKVEPSFTEFTARYDSGAAQLVFTRLVADLETPVSAMLKLGVSRP
FT                   YSFLLESVEGGAVRGRYSIIGLDPDLLFRAQGDVAEINSDPLADATAFERTGEGTLQAL
FT                   RSLLAASHIEIPDVLPPMSAGVFGYLGYDTVRLVERLPSDKPDPIGVPDALLMRPTVMV
FT                   IFDAVKDEMTIVAAARPRPGLSAKAAYSRAIDRLTEIQDTLEQKSAHASSADGVSDAIP
FT                   AATSNMPAQAYMDMVARSKEYIAAGDIFQVVLSQRFAAPFELPPFALYRALRRVNPSPF
FT                   LYFLNFGDFAVTGSSPEILVRVRDGEVTIRPIAGTRPRGATPEDDKRLAADLLADTKER
FT                   AEHLMLLDLGRNDVGRVAEIGTVHVTGSFFLEYYSQVMHIVSNVIGRLDGKYDSIDALM
FT                   AGFPAGTVSGAPKVRAMQIIDELETDKRGVYAGCIGYFAANGEMDTCIALRTAIVKNGT
FT                   MYVQAGAGIVADSVPASEQAECENKAKALFRAAEEAVRFAGQAGRGQ"
FT   gene            433576..434142
FT                   /locus_tag="Rvan_0368"
FT   CDS_pept        433576..434142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0368"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: swi:Swit_3559
FT                   putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69654"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N8"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADP69654.1"
FT                   /translation="MKTVTLFRHAKSGDKDNPNLDDFDRPLSDRGLKAAPKMGAALRDR
FT                   GVRPELILCSPSVRTRQTLTLASAAAWDNPPAECFETRIYEAGERTLLKLLRDCPEEAD
FT                   HVMLVGHNPGLQDLAVTFAQPGSAERHAIKDKLPTAAIVSFEFDAEAWNDLEPGEGRVR
FT                   LFITPNTLPPIGQANTAPPYGQGQE"
FT   gene            434142..434774
FT                   /locus_tag="Rvan_0369"
FT   CDS_pept        434142..434774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0369"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: xau:Xaut_4377 glutamine amidotransferase of
FT                   anthranilate synthase; TIGRFAM: glutamine amidotransferase
FT                   of anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69655"
FT                   /db_xref="GOA:E3I7N9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7N9"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADP69655.1"
FT                   /translation="MIIIIDNYDSFTYNLVHYFGDLGVETLVYRNDEKTVAQVFAEKPE
FT                   AIVMSPGPCTPNEAGICLELVRENKGHIPLFGVCLGHQTIGQAFGGNVIRAPILMHGKM
FT                   SNIYHQGTSLFRGLPDGFEATRYHSLIVESDTLPACLTATARTSDGLIMALEHKDEPTF
FT                   GVQFHPESIASQHGHAILANFLTLAGVRFAPRKPGLVPDAASSSVAA"
FT   gene            434783..435883
FT                   /locus_tag="Rvan_0370"
FT   CDS_pept        434783..435883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0370"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   KEGG: rpb:RPB_2797 anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase family 3; Glycosyl transferase,
FT                   family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69656"
FT                   /db_xref="GOA:E3I7P0"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P0"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ADP69656.1"
FT                   /translation="MTSPVNAPIASDLHAGFRFALEKAAVGTTLSEAEARAAFLAIMHG
FT                   SVSEIELAAFVAALKARGETVDEIAGAVAAMRSLMVPVEAPEGALDVVGTGGDAKGTFN
FT                   ISTATAFVLAGAGVPVAKHGNRAVSSKSGAADVLEKLGVTLKMPVERHKRCFERAGLTF
FT                   LWAPTHHPAMRHAAPVRAALKLRTIFNLLGPLTNPASAKRMLIGAYSEDWLQPMAEVLR
FT                   RNGAHHVWAVHGADGMDELSTTGASRVVELKDGAFTTFDVHPGDAGLPEARLDHLQAGT
FT                   PEEAAIAMRALLRGERGPFRDIVLLNGAAAFIVAGRAASLREGAALAAASIDEGHAEKA
FT                   LDGLIAASADTPDAANDDRPNAAVTG"
FT   gene            435887..436708
FT                   /locus_tag="Rvan_0371"
FT   CDS_pept        435887..436708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0371"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: pla:Plav_3173 indole-3-glycerol-phosphate
FT                   synthase; PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69657"
FT                   /db_xref="GOA:E3I7P1"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P1"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADP69657.1"
FT                   /translation="MSILDRIVAYKKEEVAAAKAQVSLAELEERAAAAPRVRDFFDALS
FT                   RRVAVVEPALIAEVKKASPSRGLIRPDFDPAAIARAYEAGGANCLSVLTDGPSFQGTPA
FT                   YLVAAREACSLPVLRKDFMVDPYQVTEARAMGADCILVIMACTTDALAEELIAAASTHN
FT                   MDVLVEVHNEDELARALALDSWLIGINNRDLNSFETHLETTERLARLIPPGRIIVSESG
FT                   IFAPADIARLMREGAGAFLVGESLMRHDDVEAATRALLGGSARGERQAATA"
FT   gene            436705..437175
FT                   /locus_tag="Rvan_0372"
FT   CDS_pept        436705..437175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0372"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: avi:Avi_2568 molybdenum cofactor biosynthesis
FT                   protein C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein C; PFAM: molybdopterin cofactor biosynthesis
FT                   protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69658"
FT                   /db_xref="GOA:E3I7P2"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P2"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADP69658.1"
FT                   /translation="MSGLSHIDGKGEAAMVDVAGKAETERTAVAEGWLVTARETLALIE
FT                   DGAIAKGDVLAAARIAGIMAAKRTAELIPLCHPLSLTKVSVGFDLRPERPGVRVEALAQ
FT                   ATGKTGVEMEALTAVSVACLTLYDMLKAADKTMVIDGVRLLKKTGGRSSSGS"
FT   gene            complement(437221..438336)
FT                   /locus_tag="Rvan_0373"
FT   CDS_pept        complement(437221..438336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0373"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG: msl:Msil_1116
FT                   cell wall hydrolase SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69659"
FT                   /db_xref="GOA:E3I7P3"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P3"
FT                   /inference="protein motif:PFAM:PF07486"
FT                   /protein_id="ADP69659.1"
FT                   /translation="MRSSRPMTGYQGQSRALVSRPQQQFEVIRKPAFAVEAPRPVPLTL
FT                   KARRSFVKLAGYTLLAGIFAVGGYAWRDPDVRRAIDYRVTMLTTTGVSQVAPTLVETAE
FT                   VAEPLPPQAAHLFYDSQKGPRADKFAYALKAAGSDTIARRMKADPLRLDTAKAASDPAQ
FT                   TAALASASLFMTAFAPREEAPAAMEAPPPPVESRDTQWAGLLKNASLSPEQPKTLFGGL
FT                   TEDEFRARELRCMATAIYFEARDEPVKGQIAVAQVVMNRIRSPFYPKTICGVVYQGERL
FT                   RTGCQFSFTCTGKRNTVKERAEWATSVKLAKQVIAGEVWLDDVGYATHYHATYVHPSWR
FT                   HELIKITQIGGHIFYRMKPGTVQLALLSEGL"
FT   gene            complement(438468..439430)
FT                   /locus_tag="Rvan_0374"
FT   CDS_pept        complement(438468..439430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0374"
FT                   /product="ArgK protein"
FT                   /note="PFAM: ArgK protein; KEGG: mag:amb1534 periplasmic
FT                   protein kinase ArgK"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69660"
FT                   /db_xref="GOA:E3I7P4"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P4"
FT                   /inference="protein motif:PFAM:PF03308"
FT                   /protein_id="ADP69660.1"
FT                   /translation="MTATAPSLFPTLDAIREGGKGKVAAALSAIEANPGPAADLLDRAY
FT                   EEPKGIALGITGPPGAGKSTMINALIAGWRKAGQTVAVLAVDPSSRASGGALLGDRVRM
FT                   RSDPEDNGVFIRSVAARNRLGGLADIAYPAAILLRAVYDRVIIESVGVGQSETDITSVS
FT                   DSVVLCIQPASGDSLQFMKAGIAEIPDIAVVTKADIGAAATRALSDLKGALSLSHRDAD
FT                   VWAPECLSVSVTSGAGLSPLFEAFARHEAWLREGDRLARLRAVKARDWVETEIASEFGR
FT                   KGLALAECEFFNDWNNQPFTTIRRAAAEFRVLRTPSHGA"
FT   gene            complement(439551..442451)
FT                   /locus_tag="Rvan_0375"
FT   CDS_pept        complement(439551..442451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0375"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="TIGRFAM: pyruvate, phosphate dikinase; KEGG:
FT                   pyruvate, phosphate dikinase; PFAM: pyruvate phosphate
FT                   dikinase PEP/pyruvate-binding; PEP-utilising protein mobile
FT                   region; PEP-utilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69661"
FT                   /db_xref="GOA:E3I7P5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P5"
FT                   /inference="protein motif:TFAM:TIGR01828"
FT                   /protein_id="ADP69661.1"
FT                   /translation="MASFHPLQLALDMTVKILETNLRLAESFATIMNVQRNRGETAAAG
FT                   SRERQSGDGSGAAAGENRSNEMSGAQKFVYRFGAGKADGSAEMRELLGGKGANLAEMSN
FT                   LGLPVPPGFTITTEVCNGYYANGKKMPEGLVDQVEESVRYIGQTVGAMLGDATNPLLVS
FT                   VRSGSRASMPGMMDTILNLGLNDETVEGLAIRSGDRRFAYDSYRRFIQMYSNVVLDVKH
FT                   ENFEEILEYYKHQNGYDLDTDITADDWRTLIEQYKAVVQRKLGKPFPQNIEEQLWGAIS
FT                   AVFDSWNNARAIKYRELNHIPESWGTAVNVQAMVFGNRGDTSATGVAFTRNPSTGDGRL
FT                   YGEFLVNAQGEDVVAGIRTPQNITEVARVEAGSDKPSLETVMPEAFKEFVAICHTLENH
FT                   YRDMQDIEFTIQEGKLWMLQCRNGKRTTPAALRIAVDMANEGLISREDAISRIEAAQLD
FT                   QLLHPTIDPKAKRNILTIGLPASPGAASGEIVFSPDDAEKLKALGKSVILVRNETSPED
FT                   IHGMHAAAGILTARGGMTSHAAVVARGMGRPCVSGASALRINAELKTVTASGVTLKEGD
FT                   IITIDGSTGQVIQGEVAMRQPELTGDFAKLMEWADVVRRMKVRTNADTPRDAEQARKFG
FT                   AEGIGLCRTEHMFFDTDRIMAMREMIVATDTEGRRTALAKILPMQRQDFIELFEIMQGL
FT                   PVTIRLLDPPLHEFLPHGHTEIVELAQSLDIDPATLRARVNQLTEQNPMLGHRGCRLAI
FT                   TYPEIAEMQAAAIFEAAVEAGKRTGKPVVPEIMVPLIATKKELDIIKDIIVRVANDVQL
FT                   ATATKIDYQVGTMIELPRAALRAGEIAETAEFFSFGTNDLTQTTYGISRDDSGAFLGDY
FT                   LKAGIYSADPFVSIDTVGVGELVKLASERGRATRDKLKLGICGEHGGDPASIAFCETIG
FT                   LDYVSCSPFRVPVARLAAAQAAIASKKASNRKLEDR"
FT   gene            443208..443507
FT                   /locus_tag="Rvan_0376"
FT   CDS_pept        443208..443507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK12716 GK12716 gene product from
FT                   transcript GK12716-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69662"
FT                   /db_xref="GOA:E3I7P6"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P6"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK12716"
FT                   /protein_id="ADP69662.1"
FT                   /translation="MSYDDTLSNLLHAMRHGDKLVEQLLHGAHGSPFDPVSQVGLLDRA
FT                   TVSDRRFWTGAAIGAAAVLVAAAVRNKRTVTIMEDDPKAPLSDGEGRRRSNGRY"
FT   gene            443532..443942
FT                   /locus_tag="Rvan_0377"
FT   CDS_pept        443532..443942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: alv:Alvin_1680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69663"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P7"
FT                   /inference="similar to AA sequence:KEGG:Alvin_1680"
FT                   /protein_id="ADP69663.1"
FT                   /translation="MSHKHHLSGEAADAALRFGAFGALISGGIVAGQSISAAQQGDKSV
FT                   PQAVTDTLAAATKAGIAAAVGGAAAAAVGGHGFSRVASFLAGAAAAAWVMSPPRRPTSI
FT                   SDAAQNRDAPSPKKSDDIILASSTQGGNPKAV"
FT   gene            444021..444569
FT                   /locus_tag="Rvan_0378"
FT   CDS_pept        444021..444569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69664"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P8"
FT                   /inference="similar to AA sequence:KEGG:RPC_3619"
FT                   /protein_id="ADP69664.1"
FT                   /translation="MSDHNNENKTYNAQGPNPAQAPQGWYPGYPAPGYGAPYGHPGWGP
FT                   APQGQPQEQAAQPQAPAWYGPAPAYGPHPWYGHHHHPHFAPYGYGYGPQAAPQQEAPAQ
FT                   QKTNGGFFSSGFDIHNDALVKGVVIGAGLTYLLTNETVQKNLIGAAVKLWSTLQGGVEE
FT                   VKERFRDAEAEIHTGDNHQ"
FT   gene            444643..446775
FT                   /locus_tag="Rvan_0379"
FT   CDS_pept        444643..446775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0379"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: rru:Rru_A2796 heavy metal translocatin P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69665"
FT                   /db_xref="GOA:E3I7P9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7P9"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADP69665.1"
FT                   /translation="MTIRIVHETPTRLRFRLTDAATMGPRVAASVESLPGVTSVRVNAP
FT                   AKTLVVHHDGDRRTRTGILRAVNHPAPPDAVPVASEDEGPDLGHVFVSGGILLASFILP
FT                   PPLRALISAANVAPVLVRGARKLANRGVTVEVLDAIAITLPAFRRDWRTANFTRFLLDL
FT                   GGHIEASTSARSDTLLRNLLKARPEAVMIETDDGALRSIPYDEVTEGARVVVNTGDRIP
FT                   VDGVVLSGNAWVNQSAVTGESMPIPREEGDEVLSGSVVTEGRLVIVAERVGDTTTTARI
FT                   SRYILDGLTDPSGIQSESHRLADRRVFITLASGASVFAATRDWRRLESVFLVDYSCAVK
FT                   FGTPIAVKSAMYRAAKEGCLIKSGRSLETVGSVDTVVFDKTGTLTHNTLEVTDIHRPTD
FT                   SDLDDAALLALVASLAEHTSHPVAAAVVDVARRRHLAHISHEEVDFLVGHGIGSHVKGQ
FT                   TIRIGSRHYLEEHEGVSFASAEAIIERLAGAGKSMLFVAAEGRLIGVIGLRDRLREEAL
FT                   PVLRQLRENGVKSIIMITGDHEAKAKQIGQILELDRVYHDQKPEDKASIIEALKAEGRV
FT                   VAFVGDGVNDGPALMAAHVGIAMPRAADIARATADILLLDDRLDGLAKLRGLSGETLKL
FT                   IRSNFRASVGINSAIMALAVLGKLSPIATAFLHNGTTIGILLRALASNKGREKPANARL
FT                   APLRKLPAPSRHSTMN"
FT   gene            complement(446919..447875)
FT                   /locus_tag="Rvan_0380"
FT   CDS_pept        complement(446919..447875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0380"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: ppg:PputGB1_1966 aliphatic sulfonate ABC
FT                   transporter periplasmic ligand-binding protein; TIGRFAM:
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69666"
FT                   /db_xref="GOA:E3I7Q0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q0"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ADP69666.1"
FT                   /translation="MHFLSSLLLAASCVVFGWQAPAAAEDKPDTVRIGFQKSSTLITVL
FT                   KTQGKLDAALQKIGVSVKWNEFTSGPPMLEALNIGAIDLTADVADTVPIFAQAAGAKMI
FT                   YVAQEAPSPTAQAILIPATSELKSPAELKGKRVALTKGTGGHYLLLATLAKAGLTFKDI
FT                   QPVYLGQADCRAAFERGSVDAWVTWDPYLSAGEIQAGARVLADGKDVALYQRYYLAATA
FT                   FATARPDVLAVIFDELHAAGKWVKDNPQAAAELLKPIWGLDTKIIEQANGRRSYDVRLP
FT                   STNNLVDQQVIADTFFKEQLLPKPVDVKSADIWHRGS"
FT   sig_peptide     complement(447801..447875)
FT                   /locus_tag="Rvan_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(447880..448674)
FT                   /locus_tag="Rvan_0381"
FT   CDS_pept        complement(447880..448674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0381"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: azc:AZC_3162 ATPase; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69667"
FT                   /db_xref="GOA:E3I7Q1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69667.1"
FT                   /translation="MTLLPLSKPQADDSAATMTETTDEPEHGGIGLPLMLDSVARSFGS
FT                   LKVLKGVTLDIPRGLFVAIVGRSGGGKTTILRLVAGLDLPTSGEVVIDGEGVCGLQPSV
FT                   RLLFQDARLLPWQTVIGNVGIARGKDWKETARAALEDVGLAGRENDWPAVLSGGQRQRV
FT                   ALARALVSRPGVLLLDEPFGALDALTRLEMHKLTERLWQENRFTTILITHDVAEAVALA
FT                   DRVLVLREGHIALDIPIDLPRPRREHIDPKSAEIKARILKEV"
FT   gene            complement(448671..449465)
FT                   /locus_tag="Rvan_0382"
FT   CDS_pept        complement(448671..449465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0382"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_3161 putative
FT                   alkanesulfonate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69668"
FT                   /db_xref="GOA:E3I7Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP69668.1"
FT                   /translation="MRQGYLSRIGATLAPWALPVLLVVAWEIACNAGIVSQRVLPAPSQ
FT                   VAAAFWAAIRDGTLFEHVGISAQRALQGLMIGGGAGFFLGVLCGVLRPAEVLIDSSLQM
FT                   LRNVPHLAMIPLVIIWFGIDEEAKIFLVAIGVMFPMYLNTYHGIRTVDKGLIEMAKVYG
FT                   LGPFALFRRVILPGAMSSVMVGLRYALGIMWLTLIVAETISASSGIGYMTMNAREFLQT
FT                   DVVVLGILIYALLGKLADVLTRALERRLLSWHPAYQVKGRTA"
FT   gene            complement(449698..450501)
FT                   /locus_tag="Rvan_0383"
FT   CDS_pept        complement(449698..450501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0383"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: rpe:RPE_4909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69669"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q3"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADP69669.1"
FT                   /translation="MGTWKPLAGTLTAGILVAGSLLAPQGLAGTTASLDADLKEDRHPS
FT                   RTKMVQAAPTEFTVSDVVGQSGQTIALGIKPQNMGSPEDLFAITGLPPEVKLSSGSPQD
FT                   DIWLVRRKELTSLAILAPEAFSRRFQIAVTRVRTNEKPPLTLTASVTISAKPAGSGVFT
FT                   SAGQPRPRAAYERSAGENALFDKARERFKTGDIAGARAIFEVLALKGDPDAAIAIGETY
FT                   DPIVLGQLYVKGLQPDEAKAVAWYRKADELGDQRARTRLNALNQN"
FT   sig_peptide     complement(450415..450501)
FT                   /locus_tag="Rvan_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.949 at
FT                   residue 29"
FT   gene            complement(450550..451719)
FT                   /locus_tag="Rvan_0384"
FT   CDS_pept        complement(450550..451719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69670"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q4"
FT                   /inference="similar to AA sequence:KEGG:M446_5709"
FT                   /protein_id="ADP69670.1"
FT                   /translation="MSYFKKLATRCVYLAVLFGCVISIVPATAESPFSAYQERKKQANE
FT                   SVVTIMGSGTASPYTRLAEDIQNVVDEPNVPGGLRVLPILGRGGAQNAIDVLLLKGVDM
FT                   GVVEADDISQARVKDPAVFANVEQRIHYITKLANSEFQVLARREIKTFADLEGRKVNFF
FT                   KKLSSTEIACNAVFKAAQINVVPTYYDQEEAGARLRSGDIDAMVRYAGAPHNAFSGFKG
FT                   DDGFHFLSIDADSVGAERYSELLKTYSPALLKNEYYPQLIANDRPVPTIAGSMLLVVYN
FT                   WPVNSERYTRVAKFVAKFFDNIAKFQGPGRHPKWKEINIAYEVPGWTRFKAAQQWLDGH
FT                   KEADASTGGRVKTDFDTFLKTRQVAGTAISKEEREALFQQFMAWYSKKK"
FT   sig_peptide     complement(451630..451719)
FT                   /locus_tag="Rvan_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.951 at
FT                   residue 30"
FT   gene            451903..452181
FT                   /locus_tag="Rvan_0385"
FT   CDS_pept        451903..452181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:F46F11.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69671"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q5"
FT                   /inference="similar to AA sequence:KEGG:F46F11.1"
FT                   /protein_id="ADP69671.1"
FT                   /translation="MLSLSVSMQRIAENALVHENLAAAYNKHAASLGSEGVPGESYVCF
FT                   SVKGWRQKKNSTRYQRDTARAGVGNGGLDPRPMSRSRRRPSDIRSSA"
FT   gene            452567..453007
FT                   /locus_tag="Rvan_0386"
FT   CDS_pept        452567..453007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AOT6; amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69672"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q6"
FT                   /inference="similar to AA sequence:KEGG:Snov_3222"
FT                   /protein_id="ADP69672.1"
FT                   /translation="MVTMAFRHKIAFWGRVLASASVLTIGAGANAATLSYVEGAVSVNR
FT                   GNGYAPAGAGTFLAPGDRIRVSAGSADIAYENGCVAKVGAGQTTVVPSTPPSCGESSVQ
FT                   PTAETVDTVGIGIGVGLFAGGVGVGAILANTSSDGGTISFSP"
FT   sig_peptide     452567..452662
FT                   /locus_tag="Rvan_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 32"
FT   gene            complement(453318..454754)
FT                   /locus_tag="Rvan_0387"
FT   CDS_pept        complement(453318..454754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69673"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q7"
FT                   /inference="similar to AA sequence:KEGG:Snov_3227"
FT                   /protein_id="ADP69673.1"
FT                   /translation="MKRPHHRKQLRSALFARGKGFVSHVSSNPMRSVISITAGLILVWL
FT                   VVSKSLPYVLATSAPDTALALNPNNPVALLAKAEDIREQLLMLTGSNESGASAGDTASK
FT                   GDTIAHLPEAQDGSFQQPRSERDALRRKIGRLAVRALANDPLNAKAYRLLAETTDDPDL
FT                   VRILMREAVKRSRHETIAQFWLLNDSAYQKDFGSALGYADILLRTRSDVSPYVFAYLTA
FT                   IAEDPAGFSLVVQELAEGPGWRPAFFAALPRNAKQTDTPLKLMTALRGSAQPIGNTEIA
FT                   PYLNALIAKNLIDAAYNAWLQFLPKDQLDTLGLITHANFEQDPSGLAFDWQISRGVNAI
FT                   SEFVPVGSEGERALHVAFGVGRVKFPEVRQTVLLPPGRYRLEGKLRGWITAKRGLRWQL
FT                   TCASGSRRVLGETDMLMGRSQQWRIFALEADVPQTEDCRGQILRFFHDSRSASEELISG
FT                   EAWIAGLRLERVPDASAVLQ"
FT   gene            complement(454751..455341)
FT                   /locus_tag="Rvan_0388"
FT   CDS_pept        complement(454751..455341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0388"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69674"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q8"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADP69674.1"
FT                   /translation="MRSHEALSAALGMLSYPHLVRQARRSALPPGVTFLLEVAVGETRA
FT                   VREAEALTGCSEMVLRKAAGFFIEQILLNRDGDNYRTLGASRETSNGEIRRHMALIMRW
FT                   LHPDLFPNSDGFDRSLYVGRVTGAWETIKTVERRAAYDTSLAGGRSQSSNVPRLTHGPG
FT                   AVVRNARRKQIIRPRRKDTHFWRIVFLLLGSRK"
FT   gene            complement(455344..457635)
FT                   /locus_tag="Rvan_0389"
FT   CDS_pept        complement(455344..457635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0389"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; KEGG:
FT                   capsular exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69675"
FT                   /db_xref="GOA:E3I7Q9"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7Q9"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ADP69675.1"
FT                   /translation="MRDSQKDLGDERRALVPSQSAAIAQLKGENFGPQGYGQAQGEEES
FT                   DLAVTLRQYLYMVLKRKWLILGTALVFTVLGSVFTLLKTPLYSASVRIQIEREPAKIVE
FT                   GGTTSPEEAGSTDFLRTQYELIKSRAMAERVVSMQRLYDDEGLFKPRDVSALGLLGAAL
FT                   FSSSKKELPLPTARQGWAVGIVLSNVAVLPVANSRLVDVRYSDPSAVRAQQIANGYADA
FT                   YIASNLDKRFEANSYAKTFLDDQIKQLKIRMEEAERALLVFAEQEKMIEVSDRASITES
FT                   NLAAANSALGQLISERIKNEQLWRQLESSTAINLPQLLSNPVIEVLRGQRKALETVYQE
FT                   KLENFKPSFPTMVQISNKIKEIDRQLAAEVKTIRNSLKAAYETSLAQEGEMKGRIETLR
FT                   GEVLDLQKKGIQYNILKREVETNRGLYNSLLQRSKEVNIAGGVGTNNIFIVDRALAPNA
FT                   PSEPNFPRALLISLALGLGAGVGISFLLEMLDDRVRTPEEIEQLSALSTLGIIPRLEFA
FT                   EGVDQALKDPRSAIAEAYRSLATTLQFSTESGLPRSIAVTSAGPGEGKSTTSVAIARHF
FT                   AQMGHKVLLIDADLRNPSLHKKLCLNNVVGLTNYLTGSSLPPEVLQKTDHPNLAFMASG
FT                   PLPPNAADLLSGTRLYSLVSLGGDVFDLIVFDAPPLLGLADAQLLANASAGTIFVIAAG
FT                   EKGKGMIRSALRRLQLARITLLGAVLTKFDSKAVGYNYGYGYGYEYGQSAYTYGNSTDA
FT                   KPRLAKPGLS"
FT   gene            complement(457652..458443)
FT                   /locus_tag="Rvan_0390"
FT   CDS_pept        complement(457652..458443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0390"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69676"
FT                   /db_xref="GOA:E3I7R0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R0"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADP69676.1"
FT                   /translation="MSALIRLLLPAVAAAFITACGVSSGGDMTDPKLESGAVSDSSPAQ
FT                   KPAAPSSKEDSAQAPDNKETLRKVALSMSAVSDPASNTYKIGPLDVVDITVFNVPELSK
FT                   TVQVSEAGTINFPLIGEFQAGGKTGREIERELSLKLGDKYLQNPQITVFIKNYNSQRVT
FT                   LEGAIKKPGVYPITGGLSLLQAVAQAQGFEDKADETVLIFRQVNGQRQVAKYDVSRIRD
FT                   GIAEDPALEAGDVIVAPSSSVKEGIGAVFKALPLFTLVSLL"
FT   sig_peptide     complement(458366..458443)
FT                   /locus_tag="Rvan_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.919 at
FT                   residue 26"
FT   gene            complement(458682..460265)
FT                   /locus_tag="Rvan_0391"
FT   CDS_pept        complement(458682..460265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0391"
FT                   /product="transposase IS66"
FT                   /note="KEGG: rlg:Rleg_4905 transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69677"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:E3I0P8"
FT                   /inference="similar to AA sequence:KEGG:Rleg_4905"
FT                   /protein_id="ADP69677.1"
FT                   /translation="MILAERAARLSAEAVAARARAATSSTDALIAHLRLEIEKLRRVLY
FT                   GSRSEHKARLLEQMELQLEELETAAAEDELLAETATARTQGTPSSTRKHPSRKPFPAHL
FT                   PRERVVLPAPTCCPSCGSTKLSKLGEDVTETLEVVPRRWKVIQTVREKFSCRCCEAIAQ
FT                   PPAPFHATPRGFAGPGLLAMILFEKFGQHQPLNRQSERYAREGVELSVSTLADQVGSCM
FT                   AALQPLQALIEAHVLSAERLFGDDTTVPILAKGKTVTGRIWTYVRDDRPFGGTAPPAAL
FT                   YYASRDRRQEHPESHLRDFAGILQADAYSGYNGLYDPAREKGAIVSALCWAHARRQFFE
FT                   LADIAANAKRGKQAPAISPIALEAVKRIDALFDIERSINGLPASERLRVRQKQSAPLLA
FT                   DLKTSLGEERSRLSRSASVARPIDYLLKRWDRFAAFLGDGRICLSNNSAERALRGFALG
FT                   RKSWLFAGSDRGADRAAFMMTMIMTAKLNGIDPMAWLADVLARIAGQPQSRLHELLPWE
FT                   WKQPGLQLAA"
FT   gene            complement(460313..460708)
FT                   /locus_tag="Rvan_0392"
FT   CDS_pept        complement(460313..460708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0392"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: xau:Xaut_4819
FT                   IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69678"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R2"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ADP69678.1"
FT                   /translation="MIPVPTGVRVWLATGHTDMRRGFPSLSLQVQEVLQRDPLSGHLFC
FT                   FRGRRGDLLKVIWHDGQGACLLRSVWRKAGSCGRARLTARSRFRPRSLAICSPGSIGAI
FT                   RKKPGDRLRLADGLPLKTLANHDSLVG"
FT   gene            complement(460705..461118)
FT                   /locus_tag="Rvan_0393"
FT   CDS_pept        complement(460705..461118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0393"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rpe:RPE_3518 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69679"
FT                   /db_xref="GOA:E3I0P6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E3I0P6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADP69679.1"
FT                   /translation="MPMSGDTFARRYSVVADTRRRWSEDEKQAIIAEALQPGVNVSAVA
FT                   RRHGIKPSLLFRWRKLAKNDEKPEPAPAFLPVSLTAPGKSRDTIYDHSASDAPAADNRI
FT                   EIELLNGRRVRVGPGADMGALKRILDIADGRRP"
FT   gene            461935..463431
FT                   /locus_tag="Rvan_0394"
FT   CDS_pept        461935..463431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0394"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69680"
FT                   /db_xref="GOA:E3I7R4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R4"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADP69680.1"
FT                   /translation="MLYLLCGATLLASLVLGGGTHSGFLGDVVVQLLSIPLLILALWAA
FT                   FSDEPARKEKGRIALALCGGLTLVVVLQVLPFPFDTWSGGARLFSEGAETPFTLPSSWN
FT                   PLSIAPQATWAAAVSLLVPLAIFCSVLQLDLTQRMVLCWGVFGFGVVSLALGFIQVAAG
FT                   TESSLRFFEITNPTEAVGFFANRNHFAALLNVTLVLSALWLNATMESSLKSGGSRTRSI
FT                   LWLAAAGTLVVAVLAGLMMARSRAGVFIAAGVLAGVAAMMILHRLSEHTSEEPRHTWRG
FT                   RRFSLAVAMFAALFAVHFGLAGFLTRFESNMADDARIPLTKTTLETALKGLPFGTGLGS
FT                   FVPVYATVEKSADATAGFANRAHNDLAEILLETGIIGAALLVAFLGWFGRKVMTAWGRS
FT                   PRDDDPRQAALARAATLIVALLLAHSLVDYPLRTTALSVTFAFFSALLVSPLSVPRVEL
FT                   PKSPSGGGRVRQRHTEAPVGGAWSPGVPWPESWQNRTTGT"
FT   gene            463632..464597
FT                   /locus_tag="Rvan_0395"
FT   CDS_pept        463632..464597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0395"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: nwi:Nwi_2917
FT                   integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69681"
FT                   /db_xref="GOA:E3I7R5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP69681.1"
FT                   /translation="MGQILHGSATTTEAVRRAIQHSQESLRALAKRYGINTKTVSKWKK
FT                   RSSVADVPTGPKEPKSTVLSVEEEAIIVAFRKHTLLPLDDCLYALQATIPHLTRSSLHR
FT                   CLQRHGISRLPDVEGDKPAKKKFKSYPIGYFHVDIAEVQTAEGKLYLYVAIDRTSKFAF
FT                   VQLVKKTGRTSASAFLVALIEAVPYKIHTVLTDNGIQFTFPPRYADGPTARYMTHMFDM
FT                   RCSENGIEHRLTKVKHPWTNGQVERMNRTIKEATVKRYHYDRHEQLETHLSDFINAYNF
FT                   ARRLKTLKGLTPYEFICKCWTNEPERFKIDPIHQMPGLNT"
FT   gene            complement(464594..465679)
FT                   /locus_tag="Rvan_0396"
FT   CDS_pept        complement(464594..465679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0396"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   met:M446_5589 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69682"
FT                   /db_xref="GOA:E3I7R6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R6"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP69682.1"
FT                   /translation="MAQTVCILLSSEDRSRLAAVIGDRNSPQKHAQRAKIVLHSAERRS
FT                   VFDVARSSGVSRPAVWRWQRRYAEKGVDGLLRDQTRKPGKPPLSAKSVAKVLALPCSEP
FT                   PGNATHWTGRAVAKAAGVSLRTVQRIWGAHRLQPHRLRTFKKSNDPAFAEKVEDVVGLY
FT                   MSPPCHAVVLSIDEKSQIQALDRTQPGLPLKPGKCATMTHDYKRNGTTTLFAALNVLDG
FT                   TVLGRCMKRHRHQEFIKFLNAVERKVPAGKIIHVILDNYGTHKHPKVDAWLADHPRWVF
FT                   HFTPTSASWLNAVENFFSAITRRRIRRGVFKSVADLEDAIKRYIADHNRNAKPFVWTKT
FT                   ADEIFDKLNRLNLHLLNESVH"
FT   gene            466254..466520
FT                   /locus_tag="Rvan_0397"
FT   CDS_pept        466254..466520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0397"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: ara:Arad_12478
FT                   transposase number 2 for insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69683"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R7"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ADP69683.1"
FT                   /translation="MIVPPTNVRVLIATKAVNFRRGIMGLAVIVEAEFKADPFSGVIYV
FT                   FRSKRGDRIKVLFRDGTGICLLIKRLESKFRSPRIEDGVMRQL"
FT   gene            466791..468293
FT                   /locus_tag="Rvan_0398"
FT   CDS_pept        466791..468293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0398"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: cpb:Cphamn1_0384
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69684"
FT                   /db_xref="GOA:E3I7R8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R8"
FT                   /inference="protein motif:PFAM:PF02397"
FT                   /protein_id="ADP69684.1"
FT                   /translation="MPRLGLLILDVSLAGVGSLLALALRENFDLTRDRLLEFLPYFTAT
FT                   VAVAFLVFAIGGITRAIWRFSSQPEYLKITATLILVIIGAVLITFAYNRLDGVARSLPL
FT                   IQCLVCVALLIGARVLHKIAHDGRQIRKASAGFLRHTDAEPVSTLLVVGISKLAETYLQ
FT                   AITELAPGRIVIAGVVGRTDRHVGRLVATHPVLGELRDIDDILNDLEVHGIAIDKIVVA
FT                   TSFDALTAVDRATLLTLERSRNITVQFLAEHLGLDLKPQATPYRSNCRSELSFEIPPLE
FT                   LREIGKRRYWKVKRAIDAIVAFAALVIFSPFIVIVAFVVAATVGFPVIFWQQRPGLGGT
FT                   PFRLYKFRTMKAAHTFDGRRLSDDERLSSIGTLMRRVRMDEWPQLFNIMRGDMSIIGPR
FT                   PLLPCDQSEAYRARLLVRPGLTGWAQVVGGRTISPEDKAALDVWYVRNASLRLDLEIAA
FT                   RTIPMVLFGERICIPAIERAWRDLSAGGVLKGTLAYKTENAL"
FT   gene            468576..469853
FT                   /locus_tag="Rvan_0399"
FT   CDS_pept        468576..469853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0399"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="KEGG: tkm:TK90_2543 nucleotide sugar dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69685"
FT                   /db_xref="GOA:E3I7R9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R9"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADP69685.1"
FT                   /translation="MDLSDKTIGVIGLGYVGLPLAVEFGKIRSVVGFDVSAARVADLRE
FT                   GIDRTREVEPHELAAARYLTYTTSLEELRSCGVFIVAVPTPIDAAKRPDITLLKRAAES
FT                   VGKVISRGGVAIFESTVYPGCTVNDCVPIIAKHSGLTFNRDFFVGYSPERINPGDKLHR
FT                   LTSIMKVSSGSTPGAAEAIDRLYASIITAGTYKAASIEVAEAAKVIENTQRDLNIALMN
FT                   ELALIFHKLGLDTGEVLAAAATKWNFLPFKPGLVGGHCIGVDPYYLTHRAQEIGYHPEV
FT                   VLAGRRINDGMGGHVADRVARLLMKRGLPVVGSRILVMGLTFKENCPDLRNSRVIDLIR
FT                   ELKGFNATVEVWDPRADPAEAHKEFGITLESGEPAASRYDAVILAVGHSEFAEMGPARV
FT                   RALGRPEAVLFDVKGLFPKAASDGRL"
FT   gene            470170..471105
FT                   /locus_tag="Rvan_0400"
FT   CDS_pept        470170..471105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0400"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ttr:Tter_0233
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69686"
FT                   /db_xref="GOA:E3I7S0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7S0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP69686.1"
FT                   /translation="MKAYSFVDVQRCNMCGANMNDARVLGTRLSTSQGYKPRTKTGIAI
FT                   TVCRCGGCGLIFAAPMPMPRSLDDHYGIPPETYWKDQYFTPAPDYFRKQIEAAKTLLGP
FT                   REHLTALDIGAGIGKAMRAMRNAGFDVWGIEPSATFHNKAIELGGLPAERLQCASVENA
FT                   TFAPRFFDFITFGAVLEHLYDPSGSIAKALTWLKDDGIIHIEVPSSNYLMSKLLNFYFR
FT                   AVGTNYVTNISPMHSPYHLYEFTPTSFKANGARIGYTVAQHHIEVASIRLPSVVQPLMR
FT                   YVMDRQGSGMQLVVYLRAKSGTRSLEEAVG"
FT   gene            471102..472127
FT                   /locus_tag="Rvan_0401"
FT   CDS_pept        471102..472127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0401"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mlo:mlr7549 nucleotide sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69687"
FT                   /db_xref="GOA:E3I7S1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7S1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP69687.1"
FT                   /translation="MKILVTGTAGFIGFHVARTLLARGADVVGFDVVNAYYDPSLKERR
FT                   LELLAEASRAPESGSFTFIRANLADQAAVNSAFAAHRFDRAIHLAAQAGVRHSLTHPHD
FT                   YVQSNIVAFTNILEACRHNDTPHLTYASTSSVYGANTAMPFSEHVGVDHPLQFYAATKR
FT                   ANELMAHAYSHLFRLPTTGLRFFTVYGPWGRPDMALFLFTKAILAGEPIKLFNHGHHTR
FT                   DFTYVEDIAEGVIRASDSIAEPNPDWSSDRPDPATSNAPFRIFNIGNNQPVRLMEYVAA
FT                   LEEALGRTAQVELLPLQPGDVPDTFADVSRLERAVGYKPATPVNEGVSRFVAWYRDYYG
FT                   V"
FT   gene            472305..473231
FT                   /locus_tag="Rvan_0402"
FT   CDS_pept        472305..473231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0402"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   tel:tlr0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69688"
FT                   /db_xref="GOA:E3I7S2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7S2"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADP69688.1"
FT                   /translation="MLDNNRAALRAVLKRTLPRPMTQSIAVTANYGRRLVAWLRVLRSV
FT                   RGRTSADRRVLRRSAMRAPFDALADIGEWREPMLLTDAEIGVSGLGAFAIRGGSDDLGH
FT                   VLLATHADIFRVIGAHLKPGDVAIDAGANIGVVTVFMARLVGPHGHTIAVEMMPDTAAR
FT                   LRHNVALNGLEAVEVVEQALSDCAGKKVHAQVADGLFGQASIANVTNPQRALRRVEVET
FT                   TTLDALTKGVETIAIMKMDLEGAEPQALAGAGEMLQRTRAVVFESWARDGGRTSSILTA
FT                   AGFAITAIDGLNFLATRVEMPTRASGA"
FT   gene            473386..475395
FT                   /locus_tag="Rvan_0403"
FT   CDS_pept        473386..475395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0403"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); KEGG: bmj:BMULJ_04765
FT                   glutamine-hydrolysing asparagine synthase; PFAM: asparagine
FT                   synthase; glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69689"
FT                   /db_xref="GOA:E3I7S3"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7S3"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADP69689.1"
FT                   /translation="MCGIAGIWWPEGQRQGEAEVVAAAMAARLHHRGPDARGVWADGAA
FT                   GIALGHARLSILDLSPAGAQPMVSASGRHVVVFNGEIYNHLDLRRELEAAGAAPVWRGH
FT                   SDTETLLALCDRHGIEAALRSATGMFALAVWDRAERTLTLARDRMGEKPLYFGRADRAL
FT                   VFASELKALRAAPGFEAEIDPASVAAYLRHSCVPEPHCIYRGVRKVEPGALVRLSHPAE
FT                   AAFAEPRSYWSLGATIAAAEPLGGDYRAMCNEVEACLAEVVRSQMLSDVPLGCFLSGGI
FT                   DSSLTAALMTRAAKGPVRTYAIGFEDARFNEAPHARRVAEHLGTAHTEFTLTEVDALSV
FT                   ISELPAIYDEPFADPSQIPTLLLARLTRQHVTVALSGDGGDEVFGGYNRYTFGPRMLEW
FT                   GQLLPAPLRRAAGRSIQALQRMGTSESSWLRPAARGLGLPMTTVDKLSRFGRAFADAGD
FT                   TEALYRGLVSTCNAPASLMASPAAEAASRSLGAVARDLTPAEWMMATDALTYLPGDILV
FT                   KVDRAAMSASLETRAPFLDRRVVELAWRLPISARIEDGKGKRILRDILNRYVPRQLMER
FT                   PKQGFAIPLDAWLRGPLRAWAEDLITPAVLRETGVLDAGAVGPLWDAHQGGQDNAGWTL
FT                   WAILMLQSWLRTSDLKMQPQRREEIVASTVFTRA"
FT   gene            475400..476446
FT                   /locus_tag="Rvan_0404"
FT   CDS_pept        475400..476446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69690"
FT                   /db_xref="GOA:E3I7S4"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7S4"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2340"
FT                   /protein_id="ADP69690.1"
FT                   /translation="MIYISSYAALLLAGFLSFKSASLRRALFPIVALFLFAFVAFRYEV
FT                   GCDWSGYRTNYDLAQYLTVEEAVSGPEPGYWLLLTQLHSLGFEYPYLNVLMASLFFWGL
FT                   TRLAVREPNPLAILILAFPVLVINLPMSGIRQGAAVGMICLALNAFRARRLITYVALVV
FT                   FASFFHTSALAFLALAPFVKFRVTRATLILSAILVLPSVAFLLNDKVAFYSDRYVDTGV
FT                   DAAGAVYRTGMLAVVGGYFLLVLRQAYLERFPADYKLALIGAWTMLGTLALLPISSVIS
FT                   DRFGYYVAPIQLMIMARTPYLIKGRSRLVLSAAPYAALGVVLIVWTSSSALFNQCYLPY
FT                   QTWLDWPL"
FT   gene            476546..477556
FT                   /locus_tag="Rvan_0405"
FT   CDS_pept        476546..477556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A1555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69691"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7S5"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1555"
FT                   /protein_id="ADP69691.1"
FT                   /translation="MIDYEIYNPSHWEDLRDLFKRVWGASRSVEYDQKHWNNTIIGTAP
FT                   GIVALEGGQIVGFYTVWPVPLTDGAKVVTGGQPIDSMVDRQFQGRGLLRELGRRCYQEC
FT                   ARHSIVVMYGAPNRAALAGNLGGLNWSHVSEIVDYVRPVLRQARRSGFLANLMEQDQAI
FT                   KGLTVSARYGALDAVAVFYANVAAHEDAKKTWRLAQSIEWVRYRYGSTPEVRYVTLISG
FT                   EGDAIRGAAVCGIRFKDDRNESVIKLTISELVGRDNAACRELIGGIVSLAAACGAPYVQ
FT                   AKSSGAGLGSVLLSAGFLPYRRTPLISRTLDASCHRANPLAKSGWALFGGAFDTV"
FT   gene            477582..478526
FT                   /locus_tag="Rvan_0406"
FT   CDS_pept        477582..478526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69692"
FT                   /db_xref="GOA:E3I867"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3I867"
FT                   /inference="similar to AA sequence:KEGG:NIDE2698"
FT                   /protein_id="ADP69692.1"
FT                   /translation="MAGSFLISFDCEGNWGIADRRERIESRFITRQRLSQSYLALLKLL
FT                   DVYDMPATFAFVMAFILRDSERADWQPRLTDVTCDGRNWMENFRRAESSGDLDGWFCPE
FT                   ALDMVMADRRHEIGCHGLRHVPFTGEGVTEEVIRIELACAREIASSRGIDLRTFVFPRN
FT                   EVSRPDLLAEYGYRGFRNAHPSLGRLGRIGNLLRECDVWERAQPEEAPVSGLVSIPGGC
FT                   FINWQKGARRLVPRALCRARWKSIIADAADNDRIAGVFLHPHNLIDGPETLLFLEDVLE
FT                   LLAEYREKRALRVVTQAEYCAERAIAHCMPAFN"
FT   gene            478615..479739
FT                   /locus_tag="Rvan_0407"
FT   CDS_pept        478615..479739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0407"
FT                   /product="glycosyl transferase group 1"
FT                   /note="KEGG: avn:Avin_30000 glycosyl transferase, group 1
FT                   family protein; manually curated; PFAM: glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69693"
FT                   /db_xref="GOA:E3I868"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3I868"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69693.1"
FT                   /translation="MSRIRVLHTLCRIHSGGVEQRRILLAQALGQDRYEHAVICQEADG
FT                   PIPGVLRDAGWTIHEIGLAHSILDPAWHARAHAIARAFQPDIAHGAVYEGEALACSIGL
FT                   RIPRVKVVMEETSDPVDRRWTGNALMRAMCMRADACIGVSPKVTGYLRETLRIPQRKIH
FT                   LINNAVPSVPPPSLARMAEMRARLGISEGDVIIGSVGRVDGNKRFSDIIRALPMIRSSQ
FT                   PRARLLIVGDGPDRVMLERLTEELDVTGAVIFAGYQGAPRDYYHLMDVFVLASAHEAFG
FT                   LVLVEAMLSGVPVVATEVGGIPFVLAEGKAGVLVPAKQHAELANAVIRLLADQSSAQAF
FT                   SSAGLERALSAFAPERYVAEVAQLYADLVRQERA"
FT   gene            479938..480918
FT                   /locus_tag="Rvan_0408"
FT   CDS_pept        479938..480918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abo:ABO_0921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69694"
FT                   /db_xref="UniProtKB/TrEMBL:E3I869"
FT                   /inference="similar to AA sequence:KEGG:ABO_0921"
FT                   /protein_id="ADP69694.1"
FT                   /translation="MVNRRFGAIGPLITAVWGAKHIKSVVRDWQIDTLMPRSLMPALST
FT                   LAMRDRKGLRVIFDADGFAADERVDFSGLSPHSLNYRIMRDIEAQMVRVSDAVLTRTEA
FT                   AIPILRARAGAGADSSKYYVVTNGRRISPLPRDPQSRSERDGPAICYAGSIGDQYCPDT
FT                   MLAVACAIRASHPDLKFKVFSADGENMKNAIAASRLNDSEWISIERVAPQDVPSQLARC
FT                   DVGFSFRKPTFSTQGIAPIKLGDYLLAGLPIIGSAGVGNTQPLIEAGVFFPSDGSNKDE
FT                   IVDWVSGTVMKNRETIRETCRNIGATWFSVSDSVDRYLLSFKALQ"
FT   gene            complement(481098..484042)
FT                   /pseudo
FT                   /locus_tag="Rvan_0409"
FT   gene            481461..481874
FT                   /locus_tag="Rvan_0410"
FT   CDS_pept        481461..481874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0410"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rpe:RPE_3518 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69695"
FT                   /db_xref="GOA:E3I0P6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E3I0P6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADP69695.1"
FT                   /translation="MPMSGDTFARRYSVVADTRRRWSEDEKQAIIAEALQPGVNVSAVA
FT                   RRHGIKPSLLFRWRKLAKNDEKPEPAPAFLPVSLTAPGKSRDTIYDHSASDAPAADNRI
FT                   EIELLNGRRVRVGPGADMGALKRILDIADGRRP"
FT   gene            481871..482233
FT                   /locus_tag="Rvan_0411"
FT   CDS_pept        481871..482233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0411"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: xau:Xaut_4609
FT                   IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69696"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:E3I871"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ADP69696.1"
FT                   /translation="MIPVPTGVRVWLATGHTDMRRGFPSLSLQVQEVLQRDPLSGHLFC
FT                   FRGRRGDLLKVIWHDGQGACLFTKRLEKGRFLWPSPADGAISISPAQLGYLLSGIDWRN
FT                   PQKNLETDFGWLTVCL"
FT   gene            482316..483899
FT                   /locus_tag="Rvan_0412"
FT   CDS_pept        482316..483899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0412"
FT                   /product="transposase IS66"
FT                   /note="KEGG: rlg:Rleg_4905 transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69697"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:E3I0P8"
FT                   /inference="similar to AA sequence:KEGG:Rleg_4905"
FT                   /protein_id="ADP69697.1"
FT                   /translation="MILAERAARLSAEAVAARARAATSSTDALIAHLRLEIEKLRRVLY
FT                   GSRSEHKARLLEQMELQLEELETAAAEDELLAETATARTQGTPSSTRKHPSRKPFPAHL
FT                   PRERVVLPAPTCCPSCGSTKLSKLGEDVTETLEVVPRRWKVIQTVREKFSCRCCEAIAQ
FT                   PPAPFHATPRGFAGPGLLAMILFEKFGQHQPLNRQSERYAREGVELSVSTLADQVGSCM
FT                   AALQPLQALIEAHVLSAERLFGDDTTVPILAKGKTVTGRIWTYVRDDRPFGGTAPPAAL
FT                   YYASRDRRQEHPESHLRDFAGILQADAYSGYNGLYDPAREKGAIVSALCWAHARRQFFE
FT                   LADIAANAKRGKQAPAISPIALEAVKRIDALFDIERSINGLPASERLRVRQKQSAPLLA
FT                   DLKTSLGEERSRLSRSASVARPIDYLLKRWDRFAAFLGDGRICLSNNSAERALRGFALG
FT                   RKSWLFAGSDRGADRAAFMMTMIMTAKLNGIDPMAWLADVLARIAGQPQSRLHELLPWE
FT                   WKQPGLQLAA"
FT   gene            complement(484322..486331)
FT                   /locus_tag="Rvan_0413"
FT   CDS_pept        complement(484322..486331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0413"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); KEGG: tel:tll0236 asparagine
FT                   synthetase; PFAM: asparagine synthase; glutamine
FT                   amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69698"
FT                   /db_xref="GOA:E3I873"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:E3I873"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADP69698.1"
FT                   /translation="MCGLTGILSAAPPSNDVRGTIARMTAALHHRGPDAEGLWAEDGIA
FT                   LGHRRLSILDLSEAGAQPMRSACGRFVIAFNGEIYNHLDLRRDLEAAGVAPDWRGHSDT
FT                   ETLLAGIAHWGLDETLRRAAGMFAIALWDRKERRLSLARDRIGEKPLYWGWAGGALVFG
FT                   SELKALRQHPGFPRDVCRQALALYLRFAYVPAPRSIHPGVYKLEPGCILTVDDTPPAAP
FT                   PQDPLRPGDRHGSLSIRRYWSLNEAIEAGGRNRFTDEVAALGALDTALRAAVGRQMLAD
FT                   VPLGAFLSGGIDSSLIVALMQVQSSRPVKTFTVGFENPAFDEAPFAAAVARHLGTDHTE
FT                   LVVTENEAREVIPQLPDLYDEPFADSSQIPSHLVCRAARAQVTVALSGDAGDELFGGYN
FT                   RYFWGPRVWRRLDWMPFGLRRSLGHAIAAVPVPVWDRAGAIVSRSVSRPGDKAHRLAAR
FT                   LREVETQDDLYRSLVSEWPGQRLVRGFSADLGGVLDDPLLPSVLEDDPVGRMMAQDMRT
FT                   YLPDDILCKVDRAAMGVSLETRVPFLDPEVMSLSARLPPDMRIRDGQGKWALRQILYRH
FT                   VPRELIERPKTGFGIPVGEWLRGPLRSWAEDLLSEDALARDDLIDPAPVRQAWAEHLSG
FT                   RRDWTYRLWIVLMFMAWRAVQMSNIDRVRVETPA"
FT   gene            complement(486319..487557)
FT                   /locus_tag="Rvan_0414"
FT   CDS_pept        complement(486319..487557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tlr0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69699"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3I874"
FT                   /inference="similar to AA sequence:KEGG:tlr0243"
FT                   /protein_id="ADP69699.1"
FT                   /translation="MTPTLYMTRNGLLEPLGQSQVFAYLRGLSSDYRITLITYEKDEDR
FT                   ADAARMGAARAECDRLGIRWLPQRFAPRPKIIAPGLSMLRMIWLVRREVEGQGARLIHA
FT                   RSYIPAAVAMIVGRLTGVPFIFDMRALWPEELITAGRLRRGSLLHRAIVAAERACLRRA
FT                   DAVVSLTHAAHDHLKQIYPSDMAGQTVAVIPTCADLDRFVPAEGRPDRWVIGCLGTVLS
FT                   GWFRLDWLAAFLAFAAARDPNAIFELTTRDDPARVRAGLDPDGRLGDRLRIAAVAPEDV
FT                   HLVLQGQTASVMFYAGGQVSELGRSPTRMAEILGCGLPVVANDGVGDVARIIRDRRVGV
FT                   LLDGLELAQMQAAWDGLLTLLSDPETGARCRQAAEEVFSLQAGTRAYAALYATLTGAAN
FT                   AVLAEEMMTPCAD"
FT   gene            complement(487557..488642)
FT                   /locus_tag="Rvan_0415"
FT   CDS_pept        complement(487557..488642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0415"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tel:tlr0242 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69700"
FT                   /db_xref="GOA:E3I875"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3I875"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69700.1"
FT                   /translation="MISILLPDLRGGGAERVSVDLARAFAALGHPVEFVLMRAEGDFLS
FT                   EAQRGFPVVDLDIRKTGQVPVPLARYLRARRPDALIANMWPLTSAAVAGRMLSMQRTRL
FT                   LLVEHITLSNQYASWGWSHNMMMRASLLTTYRLADRVAAVSEGAARHTAGLAGLGRERV
FT                   AVLHNPIPPRAVPLLQATTLAERLWNCPPGLRILTVGSLKEQKNHPLLLRAFAAMPRPD
FT                   ARLMILGQGQNETMLRGLAAELGIADRVIFAGFHADPSAFYATANLFVLSSDHEGFGNV
FT                   IVEALSFGLPVVSTDCPSGPAEILDNGSFGRLVPVGDANALARAMEAALDAPVDRDALR
FT                   RRAADFAPGIAARKYLDLMGL"
FT   gene            complement(488639..489619)
FT                   /locus_tag="Rvan_0416"
FT   CDS_pept        complement(488639..489619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0416"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tel:tlr1346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69701"
FT                   /db_xref="GOA:E3I876"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I876"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69701.1"
FT                   /translation="MGEIMEENTERPLITFAVVAYNQAQFVREAINGAFSQTYEPLEII
FT                   LSDDCSTDQTFEIMQEMAAEYEGPHKIRLRRNLKNLGLAGHINKVIAASSGEIVSWAAG
FT                   DDIALPNRTEIFVEKLLADPGNVGVHSNVLEINLVGQPIRERLHTSLESTTSLDKVIQR
FT                   GQSVITQSHAFRKSVFDFFGPFRADLTQEGIAMAFRESSLGKVAFVDQCLTHYRIGCGV
FT                   STYSGADINKRRSSEPIKFTNWYLSAFQQMLDDSKSLPYKLSSKQINIIKKNIAFYNNL
FT                   LEINQEQRIITPLVRNFFMKPRDTKSLRAALRLFLPVSLYRRIAS"
FT   gene            complement(489577..490728)
FT                   /locus_tag="Rvan_0417"
FT   CDS_pept        complement(489577..490728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0417"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69702"
FT                   /db_xref="GOA:E3I877"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3I877"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP69702.1"
FT                   /translation="MDDRLTKSSCGNASLTEGMADRPLVTFALFAYNQEKYIREAVEGA
FT                   FSQTYEPLEIILSDDCSSDRTFEIMQEMAAAYVGPHSVYLRRGEINLGTAQHLSAVAQM
FT                   ARGELLIVAAGDDISLPSRTQAIVNSWLEHDKAVSCIHSCALELNDIGQRRDILLPRAS
FT                   SIILKNELERWMKIDLLPFIAPTCAYSKKVFERFGPFCGGSIIEDGPMALRCLLTGPII
FT                   YVPEPLVAIRMSINSSGRCNNILDSSRWNRFIRSQIISYITKVQDLSVSDLPAKPSRRL
FT                   DRKYRNKIRALSAFIRPNKPTPGLLWKTKFIYIYFFHYAIDAKMKHRLSELVHALGYAD
FT                   SPIYRLTVKIAKSFGRRRDRGIPHRSFSATWVKLWKRIPSVRS"
FT   gene            complement(490721..492214)
FT                   /locus_tag="Rvan_0418"
FT   CDS_pept        complement(490721..492214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0418"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   tel:tlr1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69703"
FT                   /db_xref="GOA:E3I878"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:E3I878"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADP69703.1"
FT                   /translation="MSKSSYRTMLRSSSIIGGASVVNILASLVKMKIAAVLLGPAGVGL
FT                   VGLYQSLMQTAGSVAGLGLTNSGTRQIAAASADGGAAEVGRVRRALFWGTLAQAILGAA
FT                   LFWLASGWIATRFVADPERAAQVAWLSLGVGLSVAAGAQSALLIGLRRIGDIARVQVGS
FT                   GSGGAVLGVAALWLWGEDGLIAMVLAAPVVTFLLGHLYVSRLERPSGPSDPLPLLAREW
FT                   SAMARLGFAFMMSGLIAMAGFLAVRVLVQRELGAEALGQFQAAWAIGMTYLGFVLGAMG
FT                   TDYYPRLTAAIGDRAAAVRLVNEQTEVALLLCGPVIVAMLGCAPWVIRLLYTAEFGPAV
FT                   EILRWQLLGDIFKVMSWPLGFIILAAGAGKTFIVTESLGICVFVLGVYFGLPLIGVTAT
FT                   GVAFLALYVVHLPLVWWLGRRQIGFCWTRAVRVQAIAVIGAAVAVDSAARWSEPLGAVL
FT                   GMVLALGMAFWTVMRLSEKTGAGGRLGRMAALGERVRNG"
FT   gene            complement(492211..492771)
FT                   /locus_tag="Rvan_0419"
FT   CDS_pept        complement(492211..492771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0419"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: rfr:Rfer_0688 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69704"
FT                   /db_xref="GOA:E3I879"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:E3I879"
FT                   /inference="similar to AA sequence:KEGG:Rfer_0688"
FT                   /protein_id="ADP69704.1"
FT                   /translation="MTLLGQLQKLRILVYEIVSTNKLSGQGLRIFQPVHALGSGKITIG
FT                   RNVTIGVFPSPGYFSGACHIEVRSETAEICIGDGTYLNNDFTAIAEAKKIEIGHRCLIG
FT                   PRVTIFDSDFHVLRVSDRTNATAIVQRSVKIGDDVFIGAGAIVLKGVSIGDGAVIGAGA
FT                   VVVSDIPPNVIAAGNPATLVRSL"
FT   gene            complement(492806..493888)
FT                   /locus_tag="Rvan_0420"
FT   CDS_pept        complement(492806..493888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0420"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: tel:tlr1344 putative aminotransferase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69705"
FT                   /db_xref="GOA:E3I880"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3I880"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ADP69705.1"
FT                   /translation="MIPFLDLGAAYRELKAEIDAAIHRVLDSGWYILGPEVEAFEAEWA
FT                   GFCGADHAVGVANGLDALILALRALDIGPGDEVIVPSNTYIATWLAVTAVGARPVPVEP
FT                   DPATHNIDPARIAAAITPATKALLPVHLYGQPADLDPILALARQRGIAVIEDAAQAHGA
FT                   RYKGRRIGAHGDVVCWSFYPGKNLGALGDGGAITTNSADLADRIRVLRNYGSRLKYRNE
FT                   VQGANSRLDPIQAAVLRAKLPHLDAWTDRRRAIAAAYAEGLRDSGLILPHVPDWADPVW
FT                   HLYVVRSPDRAGLQKRLAEAGVGTLIHYPIPPHMQAAYAGLGLAPDALPLARQLAEEVL
FT                   SLPMGPQLALADAVRVMSNV"
FT   gene            complement(493900..495909)
FT                   /locus_tag="Rvan_0421"
FT   CDS_pept        complement(493900..495909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0421"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: smd:Smed_1772
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69706"
FT                   /db_xref="GOA:E3I881"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E3I881"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADP69706.1"
FT                   /translation="MKYRTEIDGLRAVALLPVILSHAGIAGFSGGFVGVDIFFVISGYL
FT                   ITAILLADLAAGRFSMAKFYERRARRILPALSVVMLVCVPFAWAWMLPEELVAFGKSLI
FT                   ATALFGSNILFWRETDYFSAAAELKPLLHTWSLAIEEQYYLIFPGMLALLWRWRRALLL
FT                   PALLVVSMTSLIVAEWGSDHAPTANFYLMPSRVWELLIGAIVAQYHSRGGTTERRNLAE
FT                   LAGFVGLALIAYSVVSFDAMTPMPSLWTLIPVVGAALALGFARQGTLAARLLCWRPLVA
FT                   IGLISYSAYLWHQPLLAFARIGNISPPEGLLLAVLLLATFILAWLSWRFVEQPFRRAVP
FT                   YSPGGRRVVLAALTCIGTACLVGAVLVDGSGFSGRKSPGGQTFASIDLDPLAPNFGLHP
FT                   DCDAGRFTTAPACRLSDQPELALWGDSFAMHLAQALRDSPSARPFAQLTLSQCGPIPGL
FT                   ALNDTLTSWQSCIDFNDSALAWILAQKTVKTVVISSTFEQSVRNLFTRDGSFITETAAR
FT                   QAALAARIEALAAQLAVAGKQLVIVSPPPRTGHDLGLCHIRTRLMSRTTASCDFPQVDH
FT                   YRFSTLPRDLLHSVEGAVPVIWLDDFLCSDGVCHTTVQDVPAYRDHGHLSAAGSSALGR
FT                   LHDLAALVIEASHGQVRGPTDPVMAKAAFRAMPN"
FT   gene            complement(495998..496138)
FT                   /locus_tag="Rvan_0422"
FT   CDS_pept        complement(495998..496138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0422"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   tel:tlr1344 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69707"
FT                   /db_xref="GOA:E3I882"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="UniProtKB/TrEMBL:E3I882"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADP69707.1"
FT                   /translation="MTIPFLDLGAVYRELKAEIDAAIHRVLDSGWYILGPEVEAFEADR
FT                   Y"
FT   gene            complement(496138..496893)
FT                   /locus_tag="Rvan_0423"
FT   CDS_pept        complement(496138..496893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0423"
FT                   /product="WxcM-like domain-containing protein"
FT                   /note="PFAM: WxcM-like domain-containing protein;
FT                   transferase hexapeptide repeat containing protein; KEGG:
FT                   rfr:Rfer_0690 WxcM-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69708"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3I883"
FT                   /inference="protein motif:PFAM:PF05523"
FT                   /protein_id="ADP69708.1"
FT                   /translation="MTERPVDCIISENAQIAEGVTFGPRVVLAGDGIVLRQNVRLDAAC
FT                   VIGADVTIGQGAWVKAGAVVLRSVPPNAIVEGNPAQVVGYLDGGSQRRPDPKHIDIRAF
FT                   SHLPRPSKVDLGVGESALFLMRRITDARGALTVGEVPTEVPFSPARYFVVFDVPTLELR
FT                   GEHAHRRCQQFLICLHGTCRVLLDDGQSRCEVTLDRPDMGVFMPDMIWGTQYRYSPDAA
FT                   LLVFASRTYEADDYLRTYDDFLAELEKRG"
FT   gene            complement(496890..497444)
FT                   /locus_tag="Rvan_0424"
FT   CDS_pept        complement(496890..497444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_1782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69709"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3I884"
FT                   /inference="similar to AA sequence:KEGG:Sdel_1782"
FT                   /protein_id="ADP69709.1"
FT                   /translation="MVHTDLTRIEGPNIVLRLIWPEDADYVHALRTDQAYSQHLSEVRG
FT                   TAEDQRRWIEDYKAREGDLRELYYVIERRDGVRCGLVRLYDIGKDSFTWGSWILDRNKT
FT                   RKAALESAVLSFGVGFEGLDLPTANVDVRVENDHAQAFYRRLGMTEIRRDARDIYFAYA
FT                   RDRFLTDRPRYMAILEGEREE"
FT   gene            complement(497612..498694)
FT                   /locus_tag="Rvan_0425"
FT   CDS_pept        complement(497612..498694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0425"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: family 2
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69710"
FT                   /db_xref="GOA:E3I885"
FT                   /db_xref="UniProtKB/TrEMBL:E3I885"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69710.1"
FT                   /translation="MKIGLLTKYGDMAASTRQRFQQYRPFLQESGFELAPRPLLDDAYL
FT                   RKLYAGGRRDRGHVAVRYLDRLRWLLFKPDVDVIWLHCELFPFLPGLLEGLVRWPNKPI
FT                   VFDYDDAIFHNYDLHSSKLIRALSGRKLHRTIGTVELALCGNAYLAAYARPLCPRTEIV
FT                   PTVVDTTVYLPREDGQSADGPVRIGWIGTPSTWNEYMLGLLPTLTQAAALAGGKLAAMG
FT                   ADPKTEAQPLLDLFEWSEAAEVPFLQAVDIGIMPLTDTPWARGKCGYKLIQYMACGLPV
FT                   VASPVGVNAEIVEHGVNGFLVTTEAEWSDALATLLRDPALRQRMGAAGRRKVEEHYSLQ
FT                   VWGPRVAALLLDVAEKSRAC"
FT   gene            complement(498691..499515)
FT                   /locus_tag="Rvan_0426"
FT   CDS_pept        complement(498691..499515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0426"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hch:HCH_04637
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benz oquinol
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69711"
FT                   /db_xref="GOA:E3I886"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3I886"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP69711.1"
FT                   /translation="MKTVSSFGDEWSRFDQEALGDAEHASLFDTYFRIFPWESLPDGAR
FT                   GFDMGCGSGRWAMLVAPKVGTLTCIDPSPAALDVARRKLAHRRNAVFVNAGVADRPLPP
FT                   DSQDFGYSLGVLHHIPNTAEALRDCVRMLKPGAPFLVYLYYRFDNRPLWYVLVWRASDL
FT                   LRRAICILPAQAKSAVTDVIAAMVYLPLARLSWLGERLGLKVDRWLLSSYRNTSFYTMR
FT                   TDSRDRFGTPLEQRFTRGEITAMMQAAGLEEIRFSESFPFWCAVGHKGRVAA"
FT   gene            complement(500148..500394)
FT                   /pseudo
FT                   /locus_tag="Rvan_0427"
FT   gene            complement(500623..501141)
FT                   /locus_tag="Rvan_0428"
FT   CDS_pept        complement(500623..501141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0428"
FT                   /product="NusG antitermination factor"
FT                   /note="manually curated; PFAM: NGN domain-containing
FT                   protein; KEGG: rsq:Rsph17025_4091 hypothetical protein;
FT                   SMART: NGN domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69712"
FT                   /db_xref="GOA:E3I887"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E3I887"
FT                   /inference="protein motif:PFAM:PF02357"
FT                   /protein_id="ADP69712.1"
FT                   /translation="MGVMLLPVNSKWVVLTTHPHRENFAVENLARQDFTAYCPMTVKHV
FT                   RHARRAYDAPRPLFPGYVFVEHQSAFQYLRPILGTYGVRSILRIGDSPAVLPVGFIESL
FT                   KAREMDGVISKPEAPLKAGQTVTISGGPFDGLVGQILEFRERDRVLLLLDLLNQQTRVQ
FT                   VEAKMLIAK"
FT   gene            complement(501211..502425)
FT                   /locus_tag="Rvan_0429"
FT   CDS_pept        complement(501211..502425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0429"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   net:Neut_2112 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69713"
FT                   /db_xref="GOA:E3I888"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3I888"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69713.1"
FT                   /translation="MTTSRPRIIISINTAWNIANFRAGLIAALVAEGYDVVAIAPPDGH
FT                   VPRLEAMGCQFIPLPIDSKGTNPAKDASLFLRYLSILRRERPVAYLGYTVKPNVYGSLA
FT                   AQRLAIPVINNVSGLGTAFIRNTWLTKIVKRLYGTALANSHCVFFQNDDDRGLFVSAGL
FT                   VAAEQTRLVPGSGIDLTRFAPVEGEPGMNSNSCRFLLIARLVFDKGVREYVDAARIVQA
FT                   ARPDASFQMMGFLDVENRTAVSRTDVDRWVAEGVIDFLGQADDVRPHIAAADCVVLPSY
FT                   REGTPRTLLEAAALGKPIVATDVPGCREVVDDGENGLLCRVRDANDLAAKMIEIIDMGY
FT                   ARRLAMGHAGRVKMERQFDERLVTDAYLAALRECVGRTPRISVSRVRLISGTDSWRSAA
FT                   SSSNK"
FT   gene            complement(502628..502808)
FT                   /pseudo
FT                   /locus_tag="Rvan_0430"
FT   gene            complement(502918..504117)
FT                   /locus_tag="Rvan_0431"
FT   CDS_pept        complement(502918..504117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbp:Sbal223_1477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69714"
FT                   /db_xref="UniProtKB/TrEMBL:E3I889"
FT                   /inference="similar to AA sequence:KEGG:Sbal223_1477"
FT                   /protein_id="ADP69714.1"
FT                   /translation="MKLIEQFLRFGIAVTVACRENDILKNTDGLRIFSHNGYPDLISRA
FT                   NQLIASNAKRVIFVSLHPSAAVAAELLARMVLRRRRETLVVHHFHWVSHSRAFFFSRSG
FT                   IIRKLMRELFFILPKRSTHFMNDAALNAHQAFWRICLRGYPVLRIVGREPTTTYSSENN
FT                   AEATRTCNKRAALRIVSVGRFVAFKSYNMNAAMVIRQLRDDGIDATWDIWGYGPEESAI
FT                   VSTTQRYGVMDYVRLCGPLPHAMFDQTVSSYDVFVGMGTAVLEAAKTGMPVCVAVENQG
FT                   DACYGHLHEAPTDSVGDRVDGFPERKLHDVLRSVAALTSQERARIGQKDNLAARLREST
FT                   LDEFADAILRAEKMTTLSIFENVVLWVGKCYLQANHLRHQKRTFPSVTRLTNIFKSRRL
FT                   "
FT   gene            504277..505251
FT                   /locus_tag="Rvan_0432"
FT   CDS_pept        504277..505251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0432"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: nwi:Nwi_2917
FT                   integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69715"
FT                   /db_xref="GOA:E3I890"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E3I890"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP69715.1"
FT                   /translation="MGQILHGSATTTEAVRRAIQHSQESLRALAKRYGINTKTVSKWKK
FT                   RSSVADVPTGPKEPKSTVLSVEEEAIIVAFRKHTLLPLDDCLYALQATIPHLTRSSLHR
FT                   CLQRHGISRLPDVEGDKPARKKFKSYPIGYFHVDIAEVQTAEGKLYLYVAIDRTSKFAF
FT                   VQLVKKTGRTSASAFLVALIEAVPYKIHTVLTDNGIQFTFPPRYADGPTARYMTHMFDM
FT                   RCSENGIEHRLTKVKHPWTNGQVERMNRTIKEATVKRYHYDRHEQLETHLSDFINAYNF
FT                   ARRLKTLKGLTPYEFICKCWTNEPERFKIDPIHQMPGLNILGR"
FT   gene            complement(505260..506096)
FT                   /locus_tag="Rvan_0433"
FT   CDS_pept        complement(505260..506096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_2877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69716"
FT                   /db_xref="UniProtKB/TrEMBL:E3I891"
FT                   /inference="similar to AA sequence:KEGG:HNE_2877"
FT                   /protein_id="ADP69716.1"
FT                   /translation="MTVSQYKRHRKYARFLFDRARYLSQISTRRNVLSFSHGFPSSGHV
FT                   MVKICDALNIRISNTLLSPGSATIFFPLTDDIYPRQPDHFINGRCTNIDKDVVADYQLQ
FT                   AFGYGYTVDPLNVTGHYVRKSIRNAAHDGCILYEPEIPKHGFFYQKLICTEVGDEVEEI
FT                   RVLVIGTVLDICYLKRHPLSERFAIPSNSVQILPTRSLLSQEEVDAICRMCAMIGMEYG
FT                   EIDVMRDRNNGLAYVIDMNRTPGGPPIAFTRSERDGVVKRLAEAFTSEFGKRILDI"
FT   gene            complement(506120..506377)
FT                   /locus_tag="Rvan_0434"
FT   CDS_pept        complement(506120..506377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0434"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   tkm:TK90_2543 nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69717"
FT                   /db_xref="GOA:E3I892"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I892"
FT                   /inference="protein motif:PFAM:PF03721"
FT                   /protein_id="ADP69717.1"
FT                   /translation="MDLSDKTIGVIGLGYVGLPLAVEFGKIRSVVGFDVSAARVADLRE
FT                   GIDRTREVEPHELAAARYLTYTTSLEELRSCGVFIVAESR"
FT   gene            complement(506660..508162)
FT                   /locus_tag="Rvan_0435"
FT   CDS_pept        complement(506660..508162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0435"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: cpb:Cphamn1_0384
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69718"
FT                   /db_xref="GOA:E3I7R8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:E3I7R8"
FT                   /inference="protein motif:PFAM:PF02397"
FT                   /protein_id="ADP69718.1"
FT                   /translation="MPRLGLLILDVSLAGVGSLLALALRENFDLTRDRLLEFLPYFTAT
FT                   VAVAFLVFAIGGITRAIWRFSSQPEYLKITATLILVIIGAVLITFAYNRLDGVARSLPL
FT                   IQCLVCVALLIGARVLHKIAHDGRQIRKASAGFLRHTDAEPVSTLLVVGISKLAETYLQ
FT                   AITELAPGRIVIAGVVGRTDRHVGRLVATHPVLGELRDIDDILNDLEVHGIAIDKIVVA
FT                   TSFDALTAVDRATLLTLERSRNITVQFLAEHLGLDLKPQATPYRSNCRSELSFEIPPLE
FT                   LREIGKRRYWKVKRAIDAIVAFAALVIFSPFIVIVAFVVAATVGFPVIFWQQRPGLGGT
FT                   PFRLYKFRTMKAAHTFDGRRLSDDERLSSIGTLMRRVRMDEWPQLFNIMRGDMSIIGPR
FT                   PLLPCDQSEAYRARLLVRPGLTGWAQVVGGRTISPEDKAALDVWYVRNASLRLDLEIAA
FT                   RTIPMVLFGERICIPAIERAWRDLSAGGVLKGTLAYKTENAL"
FT   gene            complement(508589..508853)
FT                   /pseudo
FT                   /locus_tag="Rvan_0436"
FT   gene            508954..509091
FT                   /locus_tag="Rvan_0437"
FT   CDS_pept        508954..509091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69719"
FT                   /db_xref="UniProtKB/TrEMBL:E3I894"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69719.1"
FT                   /translation="MLADLERPDLAQRFLEAYADGQDAWNFRTAVTLLKLVGADYPNTF
FT                   "
FT   gene            509105..509212
FT                   /locus_tag="Rvan_0438"
FT   CDS_pept        509105..509212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69720"
FT                   /db_xref="UniProtKB/TrEMBL:E3I895"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69720.1"
FT                   /translation="MKARGKKVRVKKANNIFTFSQREAAIITELRENSI"
FT   gene            complement(509620..511833)
FT                   /locus_tag="Rvan_0439"
FT   CDS_pept        complement(509620..511833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0439"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; KEGG: swi:Swit_3970 phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69721"
FT                   /db_xref="GOA:E3I896"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:E3I896"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADP69721.1"
FT                   /translation="MPATDTSVIATEELAAAHRMGAEEFRLACEKLGRAPNLTELGIIS
FT                   VMWSEHCSYKSSRVWLKKLPTTGPHVICGPGENAGVIDIGDGQAIIFKMESHNHPSFIE
FT                   PYQGAATGVGGIMRDVFTMGARPIALLNALRFGEPDHSKTRHLVAGVVAGIGDYGNCMG
FT                   VPTVGGETNFDARYNGNILVNAMCVGLADANRIFYSAAAGAGNPVVYVGSKTGRDGIHG
FT                   ATMASAEFDDNSQEQRPTVQVGDPFAEKLLLEACLELMAEDAILAIQDMGAAGLTSSSV
FT                   EMAAKGGSGIELNLDLVPQREEGMTAYEMMLSESQERMLMVLRPGSEPLAERIFRKWEL
FT                   DFAVIGTTTDTGHLVLRHKGALVADLPTGILADEAPMYNRPIAPKPVPAVVAAEDVPAP
FT                   NSLGDALTALIGSPHLASRRWIWEQYDHMVMDDTVVRPGSDAAVVRIHGTNKAVALTTD
FT                   VTPRYCYADPFEGGKQAVAETWRNITAAGGKPLAITDCMNFGNPERPEIMAEFARAIEG
FT                   MGEACRALEYPVVSGNVSLYNETNGEGILPTPAIGGVGLIADVSRVATVALKPGDDVVV
FT                   LIGAETGHLGQSLYQDYATGRVEGAPPPVDLAAEKKAGDFVRRLIEAGVTGTVHDISDG
FT                   GTLVALAEMAIAGKRGLTYAPADGLAPHAAAFGEEQGRYLVGVSRDAATRVLDEAKAGG
FT                   IPARIVGEVGGDVIAIDGEKPVPVGELRRAHEDWFPTFMGGKR"
FT   gene            complement(512083..512493)
FT                   /locus_tag="Rvan_0440"
FT   CDS_pept        complement(512083..512493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spu:594198 hypothetical LOC594198"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69722"
FT                   /db_xref="UniProtKB/TrEMBL:E3I897"
FT                   /inference="similar to AA sequence:KEGG:594198"
FT                   /protein_id="ADP69722.1"
FT                   /translation="MSFDDEVDEVKREMQTAKLDPEARRETAAKLVERLKEQIASKRLD
FT                   FVLAEAEGDPIVQIKYKPDSETLANVYIHEDGSITFQAAGASEDADDDDDDSGYFPSYV
FT                   EYMDEEEFLEDAYDMLKVGVAEYELDREQRAV"
FT   gene            complement(512711..513391)
FT                   /locus_tag="Rvan_0441"
FT   CDS_pept        complement(512711..513391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0441"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: sal:Sala_0591 phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69723"
FT                   /db_xref="GOA:E3I898"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3I898"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADP69723.1"
FT                   /translation="MKAAVIVFPGSNCDRDAAVTLEAVTGVKPAMVWHGDEALPKVDLI
FT                   VLPGGFSYGDYLRSGAMAAQSPIVRAVKAEAERGVAVLGICNGFQILTETGLLPGALMR
FT                   NSGLNFICRDVDLTVERADTAFTNAYTQGERVTIPIAHKDGSYFADDETLDRIEGEGQV
FT                   VFRYATAGGGSGNPNGSRRDIAGLIDRSGRIMGLMPHPERAADAALGGIDGRRLFESLT
FT                   RTLN"
FT   gene            complement(513388..513627)
FT                   /locus_tag="Rvan_0442"
FT   CDS_pept        complement(513388..513627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0442"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: azl:AZL_006350
FT                   phosphoribosylformylglycinamidine synthase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69724"
FT                   /db_xref="GOA:E3I899"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:E3I899"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADP69724.1"
FT                   /translation="MKARITVTLKNGVLDPQGRAIANALHSLGFGGVEDVRQGKLIEVE
FT                   LKATDETSAKTELDAMCRQLLANPVIENYRVELL"
FT   gene            complement(513800..514576)
FT                   /locus_tag="Rvan_0443"
FT   CDS_pept        complement(513800..514576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0443"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: bid:Bind_3122
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69725"
FT                   /db_xref="GOA:E3I8A0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A0"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADP69725.1"
FT                   /translation="MNNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAQKHERFE
FT                   GKGVLNNRISEYIFSRLNEIGVPTHFIRRLNMREQLIREVEIIPLEVVVRNVVAGSLGT
FT                   RLGLEEGMQLPRSIIEFYYKADKLNDPMVTEEHITAFGWAAPQEIDEMMALALRINDFL
FT                   SGLFLGIGIRLVDFKVEFGRIYDPDGQVRIVLADEISPDCCRLWDIETKDRLDKDRFRR
FT                   DMGGLLEAYSEVARRLGILVDNPAPKPSGPVLVQSK"
FT   gene            514860..515183
FT                   /locus_tag="Rvan_0444"
FT   CDS_pept        514860..515183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0444"
FT                   /product="protein of unknown function DUF1476"
FT                   /note="PFAM: protein of unknown function DUF1476; KEGG:
FT                   bbt:BBta_5410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69726"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A1"
FT                   /inference="protein motif:PFAM:PF07345"
FT                   /protein_id="ADP69726.1"
FT                   /translation="MTTFDDRENAFEAKFARDENLRFTATARRNRYLGVWAAEKLGLSG
FT                   PDADAYVKDVIRSDFLEPGDEDVIAKVLTDFKAKGVPVEDKELRRKLLELTGQALAEIE
FT                   AGK"
FT   gene            complement(515248..516321)
FT                   /locus_tag="Rvan_0445"
FT   CDS_pept        complement(515248..516321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0445"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pla:Plav_2522 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69727"
FT                   /db_xref="GOA:E3I8A2"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A2"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP69727.1"
FT                   /translation="MALDMIVGSGVDGAPAEIETDALIIGAGPVGLFAVFELGLVDIKA
FT                   HVIDILDKPGGQCAELYPEKPIYDIPAHPTITGQALTDRLLEQARPFEPTFHFGQRVES
FT                   LRKTDGGFEVETDLGTRFRAKVVVVAAGGGSFTPKRPPLAGIEGFEGASVFYAVRKIDA
FT                   FRDKAVLIVGGGDSALDWTLNLQPIAKSVTLIHRRDEFRAAPDSVNKLRELLADGSVRF
FT                   IQGQLTKLNGDSGALRSVTIRGPVGGLDLEYDVEAERLLPFFGLTMKLGPIANWGLNLN
FT                   ENQIAVDTARFETSEPGIFAIGDINTYPGKLKLILSGFHEAALMAQAAQKIVYPGKRSV
FT                   FQYTTSSSSLQRKLGVI"
FT   gene            complement(516335..516655)
FT                   /locus_tag="Rvan_0446"
FT   CDS_pept        complement(516335..516655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0446"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: xau:Xaut_4124 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69728"
FT                   /db_xref="GOA:E3I8A3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A3"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADP69728.1"
FT                   /translation="MIKVTFIEHNGTVHMVDGEPGQTLMETAVKHAVPGIVAECGGACS
FT                   CATCHVYVDDTWKEKTGAPSEMEEDMLDFAFDVRASSRLSCQIRLKPELDGLVVRIPEF
FT                   QN"
FT   gene            517103..520207
FT                   /locus_tag="Rvan_0447"
FT   CDS_pept        517103..520207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69729"
FT                   /db_xref="GOA:E3I8A4"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A4"
FT                   /inference="similar to AA sequence:KEGG:RPE_1474"
FT                   /protein_id="ADP69729.1"
FT                   /translation="MSQKQAISQTPIDLKPEDEAKEKVSGGNAPEKNSAVQGSDARPPA
FT                   NRDGQQPGPRGGQPRRMQADSEDNTVHISSNAPARSGGAKRVAARPANDDMPSIGGLIY
FT                   ALQQRPSRSPFLIALVASGVWFALGMLVSWAVFQKSFDGAETTADMIANPAVFGVVATV
FT                   VIPIALFWFLAILVWRAQELRLMSSAMTEVAVRLAEPDRMAEQSVASLGQTVRRQVAAM
FT                   NDAISRALGRAGELEALVHNEVAALERSYTENENRIRNLINELASEREALANNSERVSE
FT                   ALRGIGTQVTREITAASEKATQSLGHASNTMSEAFATRGQKITAAVTAAGVAIDEKLAE
FT                   RGARITDQLTKHGAQAAEALRISSLEVTRAIQETSDRTAAAISAKGNSLVTSVIGMSER
FT                   VGREIPVLLEKLGTEQTRLSGIIDGATRNLAALETALAEKTQSLDATLTDKTSVLQTVL
FT                   SEHSRSIDTTLAERIQGLETILSRRTHNFEVNLSERAKQLDQALAARTQALETSVGKHS
FT                   TNIRETLDKHSGSMEHMLARQASSIERAVTSSSVNIQRAVEELAVRSNSGSEALTNQAR
FT                   VLKEVSANLVSQLGGLTKRFEDQGNALATASRTFEMSNAKVDTMMEHRQVAFTKLMETL
FT                   STRATELDRMMNSYSNMLEQSLSQAELRARKVTELLAKDSAEKSQVAIREIERLRVDAQ
FT                   EHTQKAVSELQANFTSLSDQVSSQLTALSSKFSDTTRVVRDNTRRATVDLETAQNELQR
FT                   HAKGLPETAKQSAGAMRRALQDQLSALDALSDLANRHAYSSAVSTPDRREPVQQQQLPP
FT                   QQQQDPSFGAQRQGYDFGQPPSEKALWPEQPPARQALPDPVPVPPQPQPQPVQTVYQEP
FT                   PAAERRGSWSLGDLLARASEDDGSFFDKDEQAGLPGSFAPRPAAAPQAADFSSDFTMGD
FT                   IAACIDERRVMEVWQRLKRGETEILKQRGFYNRQAQGVVDRVLRRYETDKTFRSIVERY
FT                   LGDFEKMLQDLSRSDPRGGSVQSRLASEEGRIYFVLSHISGRLGG"
FT   gene            520551..522503
FT                   /locus_tag="Rvan_0448"
FT   CDS_pept        520551..522503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69730"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A5"
FT                   /inference="similar to AA sequence:KEGG:sce4619"
FT                   /protein_id="ADP69730.1"
FT                   /translation="MAEASELPLKRVVLSSSGLAQFTHAGEVAPGAALSLPVRVDQVDD
FT                   VLKSLTLFAAPGTLGAVSLPGKTPLAELFRDLPFDQSALASQAALLNALVGAEVEIEGS
FT                   VNAAGRIFRVEDEAAQLPNNGGVVNRHRLTLLTPKGMVQAILEDLTALRFADPATRAQV
FT                   DKALTGLAGNRAKDLRTLSISLTGDAKAAAFSYVVAAPVWKTAYRLVLPKDGGKARLQG
FT                   WGVLENLTGGDWKDVELTLVSGNPVALKQQLYTAVFVDRPEIPVSAGVRIVPKKDEAEA
FT                   RKSLRSGAPAYRAAPAPMAAMEKADGEADLYVPQTMGSAAQAPEAEEAATQVLYRFPGK
FT                   VTLASGSTLMVPFVDADVSASRTFIYQRDTNERHPLAAVRLTNDGASALPGGIITAFES
FT                   GSDGAANFAGDAQLPLLPKGATRFVTFALDGRTDIRRIDHGVTRARLGKAVGGTLTLTT
FT                   KSRWAIDYEITPPATEDREVIIDEPRADGWKPLADTKDIEETATRLRQKVSAPAGKTTR
FT                   TTLSRERVDFQTVVLTSLSPDEIVATLSGLENASPALKDTVAKLGVVVDTLAKLNSRKD
FT                   EIDGERKKIADDQDRIRKNLASVGQGTDLGRRYLDLLKTQEDRLAAFSTEERKIEGDIA
FT                   AANRKAEDIAQALVL"
FT   gene            522731..523177
FT                   /locus_tag="Rvan_0449"
FT   CDS_pept        522731..523177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr1130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69731"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A6"
FT                   /inference="similar to AA sequence:KEGG:blr1130"
FT                   /protein_id="ADP69731.1"
FT                   /translation="MKCILPRTMPYPKIAATVLGALAVAVVFCAGCSKATAETIDVYDD
FT                   HGGSVVAYDQRWAGLARRGVNVRIIGPCQSACTVLLRHIPRSRICVTPAASFGFHLAKR
FT                   QRGTDILRAGYAPDIMGWINRHGGLTPDFIWMSAPDTYRFFRKC"
FT   sig_peptide     522731..522844
FT                   /locus_tag="Rvan_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.957 at
FT                   residue 38"
FT   gene            complement(523411..524127)
FT                   /locus_tag="Rvan_0450"
FT   CDS_pept        complement(523411..524127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0450"
FT                   /product="Nitrile hydratase"
FT                   /EC_number="4.2.1.84"
FT                   /note="KEGG: rxy:Rxyl_2315 nitrile hydratase, alpha
FT                   subunit; PFAM: Nitrile hydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69732"
FT                   /db_xref="GOA:E3I8A7"
FT                   /db_xref="InterPro:IPR004232"
FT                   /db_xref="InterPro:IPR036648"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A7"
FT                   /inference="protein motif:PRIAM:4.2.1.84"
FT                   /protein_id="ADP69732.1"
FT                   /translation="MINFLGIVGLRRVGGSAGPEHGSTSRAIATTSTVAPLGYYEALEA
FT                   ALSELLIAKGLIKAVDIQRAVEALDAGSPAYGARLIARAWVDPGFKARLFENANLAARE
FT                   FDCDAGPGRLIVVENTPHLHNLVVSSLGVSFPRALLGRAPAWYESAAYRSRAVREPRQV
FT                   LAEFGADIPSYVEVRVHDAAADHVYLVLPMRPAGSEAFLEEDLAALVTRESMIGVQVPR
FT                   LPGLLPNDGAASQVEA"
FT   gene            complement(524069..524566)
FT                   /locus_tag="Rvan_0451"
FT   CDS_pept        complement(524069..524566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2314 putative ScnA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69733"
FT                   /db_xref="GOA:E3I8A8"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="InterPro:IPR024690"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A8"
FT                   /inference="similar to AA sequence:KEGG:Rxyl_2314"
FT                   /protein_id="ADP69733.1"
FT                   /translation="MSQTTMSQTIMSQTIITDNEVPSDASAEAETPAVLVPVAPSMLPV
FT                   IKGNEPRFGTGDTVHVRRVIGPAYTRTPRYVMGAKGTISRALGEFLNPDDIAYGRFTPK
FT                   KMLYRVRFRQVDLWPDYKGPPNDTLEIELFEHWLTLNPKDKTDDQLPWYRRVAPGRRKR
FT                   RA"
FT   gene            complement(524563..524874)
FT                   /locus_tag="Rvan_0452"
FT   CDS_pept        complement(524563..524874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsh:Dshi_1847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69734"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="InterPro:IPR042262"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8A9"
FT                   /inference="similar to AA sequence:KEGG:Dshi_1847"
FT                   /protein_id="ADP69734.1"
FT                   /translation="MQEAPRKQNDIGGSPAGAIEFTGRESLPWQDRVEALLTLVQHPAR
FT                   GLFTPDDMRRRIDNAAAEGATYHERAVVALANALLERGVISGDQLADALEAVSKQGRP"
FT   gene            complement(525009..525365)
FT                   /locus_tag="Rvan_0453"
FT   CDS_pept        complement(525009..525365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0453"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: rpb:RPB_3873 putative
FT                   6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69735"
FT                   /db_xref="GOA:E3I8B0"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B0"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADP69735.1"
FT                   /translation="MKVTQSFRFEAAHRLPFVKDTHPCRRVHGHSYRVELQLEGPVDPE
FT                   TGFVVDFFDIEAAFGPLLKRLDHYYLNEVEGLENPTAENIAAWIWDRVKDALPQLTAVR
FT                   VYETPECWAEYNGA"
FT   gene            complement(525594..526208)
FT                   /locus_tag="Rvan_0454"
FT   CDS_pept        complement(525594..526208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0454"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   xau:Xaut_2478 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69736"
FT                   /db_xref="GOA:E3I8B1"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B1"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADP69736.1"
FT                   /translation="MTSTTDGDFTQASDPLPLFDAWFKEAERSEPNDPNAMTVATADPS
FT                   GMPNARMVLLKSVDERGFVFYTNFESTKGRELLLNPQAALLFHWKSLRRQVRVRGTVEQ
FT                   VSAEEADAYYASRPLGSRIGAWASKQSRPLESRAALGEAVKHFGKLFAGIEPKRPPYWS
FT                   GFRVVPLEIEFWQDRQYRLHDRIVFRREGRGAAWTKTQLFP"
FT   gene            526393..527217
FT                   /locus_tag="Rvan_0455"
FT   CDS_pept        526393..527217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0455"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: pla:Plav_0786 short-chain
FT                   dehydrogenase/reductase SDR; manually curated; PFAM:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69737"
FT                   /db_xref="GOA:E3I8B2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP69737.1"
FT                   /translation="MVQTAPLMSGKRGLIMGIANNRSIAWGIAKAAADQGAELAFTYQG
FT                   DALKKRVEPLAAEVGVKHVLPCDVTDDASVDAVFETLKADWGSLDFVVHAVAYSNKEEL
FT                   DGRYVDTTADNFSKTLLISCYSFTAIAKRAEKLMTNGGSLLTLTYYGAEKVMPHYNVMG
FT                   VAKAALEASVRYLAEDLGRQKIRVNAISAGPIKTLAASGIADFRYILKWNEYNSPLRRT
FT                   VSIEDVGGAGLYLLSDLSKGVTGEVHHVDAGYHVVGMKAEDAPDIAVIQSNS"
FT   gene            527275..528501
FT                   /locus_tag="Rvan_0456"
FT   CDS_pept        527275..528501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_147777 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69738"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B3"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_147777"
FT                   /protein_id="ADP69738.1"
FT                   /translation="MEPFKALTLVAASAVISLVTAGAAGFYAGYSAGRSNLAEIKTYLA
FT                   DAPVSVASGSGGAPVSLKPVTDEIRALSARIEALAAEQPKPVATPAADASASSKPVIDE
FT                   IRALSRQLDGVKADVSKVHAVAAPASPALERAVASAPDYSDALTDIREQVRGLALKMDK
FT                   QEPKAPKALVDEIRSLSTAVQAQDSGTKRVVDEVRTGFASLQNAEPKTPKALVEEVRAI
FT                   SATISAQAAKPQVSVVDQIKILQASIESLKARLASGQSGGATADGADLAQIRQLLLAAT
FT                   EQFGKCQTQLASYSAPASAPVAQTVSAPAAAAISVSPSTRQEPAAVVFYDNVMLKKDQE
FT                   KQYDEIGVRLALQAIGPKQVKVAVNRQGFGLAFGERKVFRSQDVECEINLMETNLNEAQ
FT                   ARVSLSCKR"
FT   sig_peptide     527275..527346
FT                   /locus_tag="Rvan_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.640 at
FT                   residue 24"
FT   gene            528511..529089
FT                   /locus_tag="Rvan_0457"
FT   CDS_pept        528511..529089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0457"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rle:RL1010
FT                   putative phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69739"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADP69739.1"
FT                   /translation="MPLIYFIRHGQTDYNAARRVQGWLDIPINATGRVQALRNGGVLNE
FT                   LISDKMRLDFISSPLLRTRQTMEIMRAAMGLPTAGYQTDDRLKEISFGEWEGMNREEID
FT                   AIAMDLHASVEADRWNKAPPGGQSFRDYTAQVLSWLAEIKRDTVVVAHGGTSRVVRAHF
FT                   MKLGPVDMHKLDVPQDKVLLIEGGALHWL"
FT   gene            529240..530328
FT                   /locus_tag="Rvan_0458"
FT   CDS_pept        529240..530328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0458"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="TIGRFAM: chorismate synthase; KEGG: rpd:RPD_1314
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69740"
FT                   /db_xref="GOA:E3I8B5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B5"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADP69740.1"
FT                   /translation="MSYNTFGHMFRVTTWGESHGPAIGCVIDGCPPGIPLTEADIQPFL
FT                   DKRRPGQSRFTTQRQEEDRVRILSGVFPNEAGVQVTTGTPVALEIQNTDQRSKDYSDIK
FT                   DKFRPGHADFTYVEKYGIRDYRGGGRSSARETAMRVAAGAVARKVVPGIAIRGALVQVG
FT                   AEQIDRARWDWAEVERNPFFAPDAGIVERWTAYLDGVRKAGSSCGAVVEVVAEGAPAGL
FT                   GAPLYGKLDQDIAAAFMSINAVKGVEIGEGFASAALSGEDNADEMRIGPDGQPVFLSNH
FT                   AGGILGGISTGQPIVARFAVKPTSSILTPRRTIDTQGHDAEILTKGRHDPCVGIRAVPV
FT                   GEAMMAIVLADHWLRHRAQTGR"
FT   gene            530788..531315
FT                   /locus_tag="Rvan_0459"
FT   CDS_pept        530788..531315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69741"
FT                   /db_xref="GOA:E3I8B6"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B6"
FT                   /inference="similar to AA sequence:KEGG:Plav_0784"
FT                   /protein_id="ADP69741.1"
FT                   /translation="MARRPDLPDYLQDGFILPYSRTEVPRFHVLAFISAATFAAWLTWG
FT                   YELLSITAILAGCSAYYFFPFTESRPRLGANQYGLFIDGLGLIAWRSIGELTFVSFSVR
FT                   TLDMEELHIKLREPLGRALIADWRRLPIWRLLMRLPWKMGHDGIIRINLQPFEPPGEEI
FT                   AKTMERMWKFYR"
FT   gene            complement(531330..533327)
FT                   /locus_tag="Rvan_0460"
FT   CDS_pept        complement(531330..533327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0460"
FT                   /product="Male sterility domain protein"
FT                   /note="PFAM: Male sterility domain; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: app:CAP2UW1_3348 male
FT                   sterility domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69742"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B7"
FT                   /inference="protein motif:PFAM:PF07993"
FT                   /protein_id="ADP69742.1"
FT                   /translation="MIYFVTGASGFIGKRLVKALLSRADATVYFLMRSPDPARADVLRK
FT                   YWGVTAKRAIAVQGDLLKPDLGVSAKNAHALKGKVDHVFHLAAVYDLDADAEIETRTNI
FT                   EGTRNAVRFAETIGARHFHHMSSIAAAGLYEGTFREDMFEEARGLDHPYYASKHESEGV
FT                   VRRECSVPWRVYRPGIVVGDSKSGEMDKIDGPYYFFGLIKKIRGAVPPWMPLVGLEGGR
FT                   INIVPVDFVVAALDHIAHQPGLDGRAFHLTDPHPHRVGDVMNIFAHAGHAPDISMRINV
FT                   GLLRLVPPGLKAGLSSMPVLRRLQAALRKELALPKDVFTFLNYPTRFDSSETQAILEPA
FT                   GIMVPRLDDYAAAIWDYWERKLDPDLMTAKTLRKKLAGKVVLITGGSSGIGKATAMKLA
FT                   GAGATVLIVARDPLKLEAAREEAAAKGLTLHTYAADVTHADQCDALVKQVLGEHGGVDV
FT                   LINNAGRSIRRAVADSYDRMHDFERTMQVNYFGAVRLTLGLLPSMVERGDAHIINISSI
FT                   GVLTSAPRFSAYIASKAALEAWTRAAAAEYFEKGVHFTVVNFPLVRTPMISPTKIYDHA
FT                   SVLTPDQAAEMLAEAILHRPARVATGLGVFGGLVGATAPRLGLLVNSVLFQLFPDTATK
FT                   GNGAAADRAPEQHLTAEQVAFSTLFPGVHV"
FT   gene            533496..533972
FT                   /locus_tag="Rvan_0461"
FT   CDS_pept        533496..533972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0461"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="KEGG: app:CAP2UW1_3347 poly(hydroxyalkanoate)
FT                   granule-associated protein; TIGRFAM: poly(hydroxyalkanoate)
FT                   granule-associated protein; PFAM: poly granule associated
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69743"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B8"
FT                   /inference="protein motif:TFAM:TIGR01837"
FT                   /protein_id="ADP69743.1"
FT                   /translation="MGKKLNELAGEGSDTHLVQTIRDSASNIWLAGLGAFAKAQEEGGK
FT                   LFEALVKEGEAVQNRTSKQAQEAISDVKTKATGTWDKLEQVFVDRVARALHSLDVPTKN
FT                   DIDALSKRVHELTKVAEKLSAKLDEEAESSGKTKTVAEDAEKSATKKASTRAHS"
FT   gene            533979..535199
FT                   /locus_tag="Rvan_0462"
FT   CDS_pept        533979..535199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0462"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: aha:AHA_2273 patatin family
FT                   phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69744"
FT                   /db_xref="GOA:E3I8B9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8B9"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADP69744.1"
FT                   /translation="MVGRTRNVRAEPLRTGVALAGGGPLGGIYEVGALIALDEALCGLR
FT                   LTECDVYVGVSAGAFFAAGLANGMTPREMHELFIETDRADDPFEPEVLMKPAFGEYAKR
FT                   IAMLPPLFASAIANYVRGPNRRSVLESFLRLSQALPGGLFDSKPIRDYLQRLAAAPGHT
FT                   DDFRDLKRKLYIVATDLDRSELVTFGAEGFDHVRISSAVEASAALPGFFPPVLIDGRYY
FT                   VDGALQKTLHASAALRDGVRLLFAINPLVPFKADDPHPDVDIKSLAEGGFVTVMSQTIR
FT                   SLIYSRMKVGMDRYRHEYPEADIVLFEPRRDDAMIFFTNVFSYADRRRLCEHAYQQTRA
FT                   DLRARASRLKPILARHGLSLNEAVLRDTSLTLLPPEDSSRRLGTALQELSDALARLEPA
FT                   LRAADGP"
FT   gene            535212..535910
FT                   /locus_tag="Rvan_0463"
FT   CDS_pept        535212..535910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0463"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   app:CAP2UW1_3345 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69745"
FT                   /db_xref="GOA:E3I8C0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP69745.1"
FT                   /translation="MEHKPKRQTRARIRNAALLLFNRFGEPNVTLSAIAADVGISHGNL
FT                   HYHYPSKDRIVDELVQDFLVEIEATFALPGGRTVEADDLWLFLHLTFETILRHRFLYRD
FT                   LIELLSRHRLIEKQIRRVIEEQTRTAEALLSGLAATGALVVDAAETRALAERMAFVATW
FT                   WLCHAFVLNPRAEPDGDTLARGVARCLSLAAPYLREEERAHFDKLSGHYIKKGGNKNDG
FT                   EENKVEAVRR"
FT   gene            535870..536709
FT                   /locus_tag="Rvan_0464"
FT   CDS_pept        535870..536709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_3344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C1"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_3344"
FT                   /protein_id="ADP69746.1"
FT                   /translation="MMAKKTKWKRYEGETFEYSSQLLKKNWAWLHRGDREPFPDAAFVK
FT                   AHAALAPDADAGDTAAILQDAWRAYHRGDFEDAFLLGGSLGLIGANVANKAVNIQATYL
FT                   EHDHDAKLALFLDVVHRAENLQKAAPDLANGWYLYAQALGRYSQGISVAKALAEGHGGK
FT                   IKAALERALEIEPKHADAHIALGAFHANVVNKVGGMAARLTFGATKDAALEHYEAALKL
FT                   APDYAVAHIECANGLAMLFGKAKLGEATQHYEQAAGFAPVDAMEWLDVELAKAEVAD"
FT   gene            536892..538085
FT                   /locus_tag="Rvan_0465"
FT   CDS_pept        536892..538085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0465"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="TIGRFAM: lipid-A-disaccharide synthase; KEGG:
FT                   mch:Mchl_5143 lipid-A-disaccharide synthase; PFAM: glycosyl
FT                   transferase family 19"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69747"
FT                   /db_xref="GOA:E3I8C2"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C2"
FT                   /inference="protein motif:TFAM:TIGR00215"
FT                   /protein_id="ADP69747.1"
FT                   /translation="MAEARRIFIVAGEHSGDVLGAKLMEALKAQAGEGAFEFAGVGGDK
FT                   MHEAGLASIFPMSDVAVMGPAAILARLPKLVRRVWRAVDAALAYNPHAVIIVDSPEFTH
FT                   PIAKRIRRQRPDIPIVDYVSPSVWAWRPGRAKKMRPYVDRLLALLPFEPAAHERLGGPP
FT                   CSYVGHPLIERAPWIDSLDTSRFRARLGIAPGRPVLLVLPGSRTSEVSRLMQPFGETVL
FT                   ALGQKIGPFSMLLPAVPHVRGMIEKAIADWPNKPHLLEGDEDKFTAFRLADAALAASGT
FT                   VTLELGVAGTPMVVAYRVDPFAARLRFLLKVHSVVLANLVLGENAFPELLQEDCTALKL
FT                   ADALAPLLSGDTPERQAQLAALAKIRERMFLAQGTPSAKAAEVVLSVLDGAPARAAA"
FT   gene            538106..539167
FT                   /locus_tag="Rvan_0466"
FT   CDS_pept        538106..539167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0466"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   hne:HNE_0029 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69748"
FT                   /db_xref="GOA:E3I8C3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69748.1"
FT                   /translation="MRILQIMTSKANGGAETYACDVIMKLHEAGVDQCVVMREDQSRFG
FT                   ELKAAGVRLAPEVLRFPFAPAQRFLIRRLIGREKPDVVQTWMRRAASLASKGAQPVIGW
FT                   FGGYYDPAHFTACERIVGVTRDIRDHMVKSGVAPERAHYIPTFPTITPLPAADRAALDT
FT                   PADAKVLLTLSRLHQKKGLDTFLHAVAGLPGVYAWLAGDGPLEAELKALAADLGLTDRV
FT                   RFLGWRTDRSALLRAADVCVLPSRYEPFGNVILEAWAAKTPFVAAKSAGPAAHVADGIN
FT                   GLLVPIDDAEALRAALARVLGDDALSAALVANGYETYERDFTPDAVTAQWLAFYDAVLA
FT                   RDTAALTRLSAAA"
FT   gene            complement(539242..539316)
FT                   /locus_tag="Rvan_R0004"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(539242..539316)
FT                   /locus_tag="Rvan_R0004"
FT                   /product="tRNA-Val"
FT   gene            complement(539421..540725)
FT                   /locus_tag="Rvan_0467"
FT   CDS_pept        complement(539421..540725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0467"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="KEGG: bbt:BBta_1556 manganese/divalent cation
FT                   transport protein; TIGRFAM: Mn2+/Fe2+ transporter, NRAMP
FT                   family; PFAM: natural resistance-associated macrophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69749"
FT                   /db_xref="GOA:E3I8C4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C4"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ADP69749.1"
FT                   /translation="MASDASFPVDNVPAAGGMSHAALRDAIAGRRGRIVTGWMFTGPAV
FT                   VASIAYIDPGNFATNIQAGAKYGYTLLWVVLSANLIAMLFQALSAKLGIVTGRNLAELA
FT                   RERFPWPLALVMWIVSEIAAIATDLAEFLGGAIGFSLLFGMSLLTGMAATAVITYGILM
FT                   FNGERFRRIELVVGLFVAVIGVCYVVELFIAPVNWGGAMAGLVTPQIADADALLIAVGI
FT                   VGATVMPHAIYLHSALTQSRGVLNSDAERERVLRFSNREVIIALALAGVVNMAMVIMAA
FT                   AAFNAGNPEVAEIETAYHMLTPLLGGAAATAFLISLLASGVSSSVVGTMAGQVIMQGFF
FT                   RRRIPIWLRRLVTMVPAFAIVAMGVGATQALVMSQVVLSLALPFPMIALIVLSSDRALM
FT                   GRFANGRLTKIAALVGAAVILVLNAVLLYHTAFGG"
FT   gene            540965..541414
FT                   /locus_tag="Rvan_0468"
FT   CDS_pept        540965..541414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0468"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="KEGG: mno:Mnod_3626 iron (metal) dependent
FT                   repressor, DtxR family; PFAM: iron dependent repressor;
FT                   SMART: iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69750"
FT                   /db_xref="GOA:E3I8C5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C5"
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /protein_id="ADP69750.1"
FT                   /translation="MTSQNTDSNSLIDADLQSASFRETRRAHRLEIVEDYVELIDDLIA
FT                   ARGEARQVDIAERLGVAQPTVAKMLKRLIEEGFVVQQPYRGVFLTALGKNLASEARERH
FT                   RVVEAFLLALGISPETARRDAEGIEHHVSDETLEVFREFTARRTP"
FT   gene            541822..542661
FT                   /locus_tag="Rvan_0469"
FT   CDS_pept        541822..542661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0469"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="KEGG: protein-tyrosine-phosphatase; PFAM: PHP domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69751"
FT                   /db_xref="GOA:E3I8C6"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C6"
FT                   /inference="protein motif:PRIAM:3.1.3.48"
FT                   /protein_id="ADP69751.1"
FT                   /translation="MFDLHSHLLPGIDDGSPNMRVSFEMARAYVDQGVLCVACTPHILP
FT                   GLYHNTGPQIREAAAALQTSLDEAGIPLHIATGADNHIIPDFVEGLRRGHLLALDDTAY
FT                   VLVEPPHHVALARLEDLFFSILVAGYVPILTHPERLTWIEGKYDVIERLSARGVWMQIT
FT                   AGSLLGRFGRRPRYWAQRMLEEGRVHILATDAHNNDSRPPDLLKGREAAAKIVGEKEAH
FT                   HLVVTRPLGVLKNLHAGSLPEPEGITSEEVHEVERSVQASGTGDGRSLRERVRRLLA"
FT   gene            542681..543379
FT                   /locus_tag="Rvan_0470"
FT   CDS_pept        542681..543379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0470"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69752"
FT                   /db_xref="GOA:E3I8C7"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C7"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADP69752.1"
FT                   /translation="MSIAGTPPAEETAAPKANAASGGATVKEPEAAAAIKQAALTYSAM
FT                   SDPKSKSYKVGPLDVLEITVFKVADLSKTVQVSEAGTINYPLVGEMQAGGRSAREIEQD
FT                   LTTLLGAKYLQKPQITVFVKEYNSQRVTVEGAVKKPGVVPMVGGLSLVQAVAQAGGSDE
FT                   AADSTAVVFRTTNDKRSAIRYDMAKIRDGGAEDPLLQSGDVVIVPTSSMKQGFNIFVKM
FT                   LPLATVVSFL"
FT   gene            543575..543784
FT                   /locus_tag="Rvan_0471"
FT   CDS_pept        543575..543784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69753"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP69753.1"
FT                   /translation="MRIGGDKLGVKWKTFAHWLRFEIKPIKQIVLAVALPSNELVGYQC
FT                   SVSRCNIGPAEPGPMLANLASTTN"
FT   gene            543930..544631
FT                   /locus_tag="Rvan_0472"
FT   CDS_pept        543930..544631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69754"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8C9"
FT                   /inference="similar to AA sequence:KEGG:Mpop_0501"
FT                   /protein_id="ADP69754.1"
FT                   /translation="MTSWMHKVALFAGAAALTLTVSVPASAEDAAPAPAPAEAAAPVPA
FT                   IAPELAERMAKEKEDRKTCKLEICKAFAEAKSGAPISCNVTKTWLGSDIQAGYLGDKLT
FT                   WPWGHALCSAHIDLDRDAIAEVASKPSGTLKLKKHDITCKLDNKNPAEGSAYDVKLSIE
FT                   PVVTFENGRATKAELNWGTIEAPLLAKTAIWSATAVDANFSVIANGVVKEINAFLGVKC
FT                   KEEGFNIAAAR"
FT   sig_peptide     543930..544013
FT                   /locus_tag="Rvan_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(544811..545821)
FT                   /locus_tag="Rvan_0473"
FT   CDS_pept        complement(544811..545821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0473"
FT                   /product="hydrolase"
FT                   /note="KEGG: azo:azo1513 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69755"
FT                   /db_xref="GOA:E3I8D0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D0"
FT                   /inference="similar to AA sequence:KEGG:azo1513"
FT                   /protein_id="ADP69755.1"
FT                   /translation="MSEKPRLCSFQSLGPNGFHEVAYTEWGDPQSPRLVFCVHGYTRNS
FT                   RDFDVLAESLAEECHVVCMDVAGRGRSEWLAKKNDYSFSLYLTDAAALLSRVTAPPPPP
FT                   TGLKRIFRRTQPKPKRHIDWIGTSMGGLIGMMLAARRNSPIRRLILNDVGPLVPWPALM
FT                   RMKKAQTGLGRSFSCLEDVEFHLRETCASFGPLTETQWRKVTTNSAIEQRDGSYVLAFD
FT                   PAIITHMRSGGVTGVAFGSEFLAGVDLWPTYEAIRCPTLVLRGAESDLLLGKIADDMMR
FT                   RGPRAKIVEFEGIGHAPWLMAEDQIAAVRDFLFASAAKAPAAEPVRREKVALHPA"
FT   gene            546498..547583
FT                   /locus_tag="Rvan_0474"
FT   CDS_pept        546498..547583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0474"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="KEGG: rru:Rru_A3334 putative ammonia monooxygenase;
FT                   TIGRFAM: membrane protein AbrB duplication; PFAM: ammonia
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69756"
FT                   /db_xref="GOA:E3I8D1"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D1"
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /protein_id="ADP69756.1"
FT                   /translation="MIPFPRRFETLPHARQWLMLALFSAAFAALLDLASIPAAVFLGPM
FT                   AAGVVLGVKGATIRVARVPYIGAQALMGLFIASAITPSILQSFAKEWPIILGVVFSIIV
FT                   ASSLLGWAMSRWRAMPGTTSIWGSWPGAAGAMVIMAGEFGADARLVAFMQYFRVACVAS
FT                   LASVVATFWAHSTGVPHPDIAWFPAMDERPFAVTLMLAGICAIVGRATHFPSGAMLLAL
FT                   VAGSALNLAGLVHIELPKWLMAVTYALLGWNVGLCFTPDILAHAFRALPKIVLSVALLI
FT                   AFSAVLAWLLTETLGIDALTAYLATSPGGMDSVAIIAASTNVDVPFVMALQTIRFLIII
FT                   MIGPPLARLVARHMEVSGRYG"
FT   sig_peptide     546498..546602
FT                   /locus_tag="Rvan_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.329 at
FT                   residue 35"
FT   gene            547576..548805
FT                   /locus_tag="Rvan_0475"
FT   CDS_pept        547576..548805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0475"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; KEGG: rpc:RPC_3087
FT                   HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69757"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D2"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADP69757.1"
FT                   /translation="MAETGKQAAIIGGGPAGLMAAEVLAGAGVAVTVYDAMPSVGRKFL
FT                   LAGRGGLNLTHSEELSQFLARYSAAEPHLRGAIEAFPPSALVAWCEALGQETFVGTSGR
FT                   VFPKAMKASPLLRAWLGRLRGLGVAFRQRHRWRGWDDAGALLFDTPDGPVTVRADAAIF
FT                   ALGGASWPRLGSDGGWVPIFEREGIDVAPLKPSNCGFAVGFSDIFLARFEGDPLKGVTF
FT                   SFEGRSVRGDATITKAGIEGGAIYALSAALREALEHEGAADLIIDLRPGIEAEALEAAL
FT                   SRPRGKQTLSAHLRKAAKLAPVAIGLLYEEAVRGGSPLADLDVAELVRLIKGVRVPLTA
FT                   PAPIERAISSAGGVPFTELDGFMLRKKSGVFVAGEMLDYEAPTGGYLLQAAFSTGTAAA
FT                   RGALAFLSRA"
FT   gene            548862..550193
FT                   /locus_tag="Rvan_0476"
FT   CDS_pept        548862..550193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0476"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   pfl:PFL_4433 L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69758"
FT                   /db_xref="GOA:E3I8D3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D3"
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /protein_id="ADP69758.1"
FT                   /translation="MKPIRTIFAMGLAAIALSACESQTATPVSEGMGPNPKLPPPKETA
FT                   LPTINIAVARGWGEGQKPKPAEGLQVAALARHLDHPRWIYVLPNGDVLVAESDAPPKEA
FT                   TGFRNWVQGKVMKMAGSNRGSADRITLLRGVGPNGEAQTREVFLENLFSPFGMALIGDT
FT                   FYVANANSIMKYPYQEGQTKITAAGEKLTDLPGELNHHWTKNIVASKDGTKLFVAIGSN
FT                   SNIGENGMELEKDRAMIWEVDVATGQHRVFASGLRNPVGMAFEPQTGVLWVAVNERDEL
FT                   GSELPPDYLTSVKEGGFYGWPYSYWGQHVDTRVQPQRPDLVEKAIVPDYALGSHTASLG
FT                   LTFAEGSKLPKPFANGAFIGQHGSWNRKPKSGYKVIFVPFENGKPNGMPIDVLTGFLSQ
FT                   NDEALGRPVGVTFDKDGALLVADDVGNVVWRVTGAGSAQSAKAE"
FT   sig_peptide     548862..548936
FT                   /locus_tag="Rvan_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.466 at
FT                   residue 25"
FT   gene            550342..550479
FT                   /locus_tag="Rvan_0477"
FT   CDS_pept        550342..550479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0477"
FT                   /product="ribosomal protein L34"
FT                   /note="manually curated; TIGRFAM: ribosomal protein L34;
FT                   KEGG: xfn:XfasM23_2226 50S ribosomal protein L34; PFAM:
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69759"
FT                   /db_xref="GOA:E3I8D4"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D4"
FT                   /inference="protein motif:TFAM:TIGR01030"
FT                   /protein_id="ADP69759.1"
FT                   /translation="MTKRTYQPSNLRRKRKHGFRARMSTKQGRTVLSRRRARGRTKLSA
FT                   "
FT   gene            550505..550903
FT                   /locus_tag="Rvan_0478"
FT   CDS_pept        550505..550903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0478"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; KEGG:
FT                   bbt:BBta_7325 ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69760"
FT                   /db_xref="GOA:E3I8D5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D5"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ADP69760.1"
FT                   /translation="METLKTRAEFKRVQKGRKWVTPAFIMQGLARADIESQGPRFGFTV
FT                   SGKSVAVEGEGGRKRGKAVDRNRARRRLKEAVRLTFAEAARPNLDYVIIGRAVALTRKF
FT                   EDLLADMRRAFHKVGQPARSDKENNPAP"
FT   gene            551034..553169
FT                   /locus_tag="Rvan_0479"
FT   CDS_pept        551034..553169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0479"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="KEGG: xau:Xaut_1921 putative inner membrane protein
FT                   translocase component YidC; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family; membrane protein insertase,
FT                   YidC/Oxa1 family domain containing; PFAM: 60 kDa inner
FT                   membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69761"
FT                   /db_xref="GOA:E3I8D6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D6"
FT                   /inference="protein motif:TFAM:TIGR03592"
FT                   /protein_id="ADP69761.1"
FT                   /translation="MDNNRNFIIAIALSLSVLLGWQFLYMKPASDKARQQAIEAQQQTA
FT                   GEQGTDPTVGGAAIPPRASSVIPVPTTPKFASREAALAATQRIAFDTSSLTGSINLKGG
FT                   SVDDVTLKEYRQTVDPNSPPVTLLSPAGSPEPYYAYTGWYSDQADISVPGPDTVWKQQG
FT                   TGALAPGKPVTLTWDNGKGLVFKRAITLDEHYMFTITDTVENKTGKPVTLRPRAEVARL
FT                   YEPTNLFGYSVLHEGLIGLFKDAGLKELTYSSAIKNFDPAADNGKGVSKEIISDKGGWL
FT                   GFTDQYWAAVLVPDQSKPLTARLFGTPQKDFFVEFSENPVTVATGASETFTNKLFAGAK
FT                   KVVLIEQYMADDKIDRFDKLVDWGWFPFLTQPLYFLLNWLYLHVGNFGIAILLTTVLVK
FT                   VLFFPLANKSYSAMNKLKMLQPEMKKIQERFKDDKQRQQHAMMTLYKKEKVNPAAGCLP
FT                   ILVQIPVFFALYKVLLVSIEMRHAPFYGWIHDLSAPDPTNIFTLFGLIPWTPPHFMMLG
FT                   ALPLIMGCSMWLQMRLNPTPPDPIQQKIFAWMPVLFTFMLAPFQAGLILYWTWNNILTF
FT                   AQQALIMKRQDKNMNLLEQIGLKKSNGAAKHRSHAHDVAHKPTAEPVRPGKAADVKTAS
FT                   VPATADSAAPVANAGEANEAVSTAEGAQAVIDKPQPTEPTTARPVAPVAAAPRGNLASK
FT                   KSVKQRGKSGRNRRPGR"
FT   gene            553176..553820
FT                   /locus_tag="Rvan_0480"
FT   CDS_pept        553176..553820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0480"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="KEGG: sal:Sala_0003 ribosome biogenesis GTP-binding
FT                   protein YsxC; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69762"
FT                   /db_xref="GOA:E3I8D7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D7"
FT                   /inference="protein motif:TFAM:TIGR03598"
FT                   /protein_id="ADP69762.1"
FT                   /translation="MTATDEENHARELAARAEALFKAPAEFVLGVTDVAALPEGNRPEV
FT                   AFAGRSNVGKSSLLNALLSRRNLARVSNTPGRTREVNYFSVGDALYVVDMPGYGYAKAP
FT                   KALVKGWTQLIHDYLRGRPQLKRVMLLIDSRHGLKPSDKEIMTLLDKAAVSYQGVLTKA
FT                   DKPKAGDLGQVVRETEAVMRTHPAAHPVVLTTSSVDGAGIEELRTAIAELC"
FT   gene            554221..555909
FT                   /locus_tag="Rvan_0481"
FT   CDS_pept        554221..555909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_13061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69763"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D8"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_13061"
FT                   /protein_id="ADP69763.1"
FT                   /translation="MARQKENKTAEPTALTVAFTLSLLVSVSTIAIVACLSQAHAQSTF
FT                   SDPSQGWASSNGSSTTYTKKSQIYNGQVIGTDTLGHTTVLQGSGVTSSNGSASASFTAN
FT                   GLSVSNGSNVTTVGPSSVTTGTVYADTFSGGSLSTTSVSTSSLSVSNGSNATTITPTSV
FT                   TTGTLKATTLDVDNFNATNLTSTNLTSTNINATGAITATSLTTTGAVNSGSMNTGTMNA
FT                   TTVNASTFNGGAFNGQSLTVTDGTHTSTVMPGSISTTGTLSSGAFTSSGITSTGDISAT
FT                   GVLSSGSISTGAIHATDITTNTITANTFNATNLGTSNLTVSNGTNTTTITPTSVTTASV
FT                   NTGTLTTDHIYIQHSGGTNYIDLNASGDSATFQGMKLTVKTADGSSYTKVVDGHVEVSD
FT                   SLITKDLKATGTTTLSNLKVGQGGTADMGGAVVHNVAGPVVGSDAANKAYVDSVWSDNT
FT                   ARVQELDGRIDAGLRSANRRIDETQEGVAIALALQQPIFAPGQNFAVRAGWGNFEGESA
FT                   FGLSGAGIIGRDWFGQGTVVALDGGFGFGASTGAMAGKAGFTFGW"
FT   sig_peptide     554221..554346
FT                   /locus_tag="Rvan_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.687) with cleavage site probability 0.577 at
FT                   residue 42"
FT   gene            556049..556681
FT                   /locus_tag="Rvan_0482"
FT   CDS_pept        556049..556681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr5448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69764"
FT                   /db_xref="UniProtKB/TrEMBL:E3I8D9"
FT                   /inference="similar to AA sequence:KEGG:blr5448"
FT                   /protein_id="ADP69764.1"
FT                   /translation="MKSTVFRVALLRAALCSVAIFSASEVLAEGKGAPLAKRAPEAAAK
FT                   SQPSATMDGVQIAMLIKSTVIALQHANQTGNYSVLRDLGTPLFRERFDQVKLSAIFSGL
FT                   RGRGVNLSPILVLSPTLTKQPELTDQRQLRLVGNFPTQPLQIKYELVYQQIDGVWRVDG
FT                   VSVEAVAVQTTEAGRAGGTPSLAAQTPAPVKPVASVKSGKKPVQRQY"
FT   sig_peptide     556049..556135
FT                   /locus_tag="Rvan_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.805 at
FT                   residue 29"
FT   gene            complement(556712..557665)
FT                   /locus_tag="Rvan_0483"
FT   CDS_pept        complement(556712..557665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0483"
FT                   /product="peptidase U6 penicillin-insensitive murein
FT                   endopeptidase"
FT                   /note="PFAM: peptidase U6 penicillin-insensitive murein
FT                   endopeptidase; KEGG: rle:RL0184 penicillin-insensitive
FT                   murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69765"
FT                   /db_xref="GOA:E3HYM4"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYM4"
FT                   /inference="protein motif:PFAM:PF03411"
FT                   /protein_id="ADP69765.1"
FT                   /translation="MAVDVKHKLSSAALCTLTIAALCFAAHAENASAPIAEPREAKKAF
FT                   GAIKVPPALPPQAIGRYDLGCVAGAQKIAMNGDGWQAMRLSRNRYWGHPALISYIETLA
FT                   RDVKRLDGLPGILVGDMAQPIGGPLLGGHASHQSGIDVDLWYNLMPARTLSAEDREKFA
FT                   ATNYVDQTTLTVDPARWTDAQTKLVKRAASYPEVSRIFVHPAIKKALCDSAGSDRVWLQ
FT                   KIRPWYKHDDHLHVRLSCPAGSNGCVSQPAIKADDGCGEELDAWFRKLRAPRPKPPKPP
FT                   KPQPKPKPMLVTDLPGECQALLDLAEAEKPTASGAR"
FT   sig_peptide     complement(557579..557665)
FT                   /locus_tag="Rvan_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(557655..558461)
FT                   /locus_tag="Rvan_0484"
FT   CDS_pept        complement(557655..558461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69766"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYM5"
FT                   /inference="similar to AA sequence:KEGG:Snov_2947"
FT                   /protein_id="ADP69766.1"
FT                   /translation="MRKYSLSLFCAVALAMAPVTASAQPAGQQQAQSPDELRLILMIRN
FT                   AIVALNQANITGNYSVLRELGTPTFQQTNNPAKLAEAFATLRNRKIDISPVMFFPPRLT
FT                   AQPNMLEGQVLRLTGFFATAPEHVNFDIAFQITGDQWMLAAIAVNVAPPGEGQQASTMN
FT                   EAPPQRAAESKPIRIDLTQPAGGAAPQQPQKKASPSPKKPKPDQAAAPQQPARPTPQQQ
FT                   AGPSLSSSVPAPSAPAPAPAEQTQVEVAPVPAPAPAPNTAWNPFGR"
FT   sig_peptide     complement(558390..558461)
FT                   /locus_tag="Rvan_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.908 at
FT                   residue 24"
FT   gene            complement(558709..560832)
FT                   /locus_tag="Rvan_0485"
FT   CDS_pept        complement(558709..560832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0485"
FT                   /product="acyltransferase, WS/DGAT/MGAT"
FT                   /note="KEGG: asa:ASA_2036 hypothetical protein; TIGRFAM:
FT                   acyltransferase, WS/DGAT/MGAT; PFAM: protein of unknown
FT                   function UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69767"
FT                   /db_xref="GOA:E3HYM6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYM6"
FT                   /inference="protein motif:TFAM:TIGR02946"
FT                   /protein_id="ADP69767.1"
FT                   /translation="MSKAERVSAVDTTWLRMDRPSNPMVIVGVLILEGPLDLNTLEATL
FT                   CERFLAIPRFRQHIETRSGEYWWVDDPWLDRERHIQRVRLPGKAGQAELQRYIASLASE
FT                   PLDKSRPLWQIRLVEDYEGGAALVLRIHHAIGDGMALVGVMLSITDGGDRSVWTATRER
FT                   QSGFRIPLPGLGLLKRGLGTGVDLWKEAAALAQNPTQAARLGAGVAGELAWLLMMPEDS
FT                   PTRFKGKASGNKRVAWTDPIPLPEVKAVSHALGCTLNDMLLASVAGALGEYLKAKGDET
FT                   DGVEIRAFIPVDMRQSHEAGQLGNRFGLVGVELPAGIENPLARLAEVQRRMQALKQSLE
FT                   PPVTLGLLEVIGHAPQMVQDRLFNMLMKRATAVMTNVPGPKEPLYLGGARVSQIMFWVP
FT                   QSGDIGMGVSILSFNDMVQFGLITDAAMVPDPEAIIAEFRPKFEQLLYYVLMGAWGDAD
FT                   ERGAPAVAETPKLKARRAKPRPSAKAPDAPPKAEGEVSPPVTRSRKAPKTAASPPVTPV
FT                   PKADDDQGANLPTGIASAKVPSGAASRRKRPETPATAEIALAAEATGAAPRARRSPRAF
FT                   KPDLSAAPEATPIAAAVRGRAKPRPDIEDARSRSAFGDASDAPGRAPARKGAKAVSREA
FT                   AVRSREGSVANLPANERGKAAGPKAAAAAATPPLVPPPTPRKPRQPARIRSGGETVASP
FT                   APKATARRKLPRS"
FT   gene            560960..561670
FT                   /locus_tag="Rvan_0486"
FT   CDS_pept        560960..561670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_2233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69768"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYM7"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_2233"
FT                   /protein_id="ADP69768.1"
FT                   /translation="MTTRNEIARRIESLLDASAELRARLAARPQGEAARDALRQWQAER
FT                   LQREHADIVANPLYSKTALFFLSDIYGPKDLSRHEEEVRRILPVMKAVLPEAGLDTVAD
FT                   AIEVNTISESLDTDMLEALGQDVFALDIDKWVAAYKKVGRRDDRERQIALIASLGRSLD
FT                   RLTRKPFIGTALSMMKKPAEIAGLSDLQSFLERGYDAFRSMKGSSAAFVRRVTERETEL
FT                   MNEWLPEERAAASN"
FT   gene            561806..561967
FT                   /locus_tag="Rvan_0487"
FT   CDS_pept        561806..561967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcc:717305 similar to paraneoplastic antigen
FT                   MA2"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69769"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYM8"
FT                   /inference="similar to AA sequence:KEGG:717305"
FT                   /protein_id="ADP69769.1"
FT                   /translation="MRAEVKPVFRRMAKEAGGVIRLDAINPLHATYRISPPGDGKVLAR
FT                   LTIKQTNY"
FT   gene            complement(562099..562662)
FT                   /locus_tag="Rvan_0488"
FT   CDS_pept        complement(562099..562662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0488"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: redox-sensitive transcriptional activator
FT                   SoxR; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; KEGG: oan:Oant_2950 MerR family
FT                   transcriptional regulator; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69770"
FT                   /db_xref="GOA:E3HYM9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYM9"
FT                   /inference="protein motif:TFAM:TIGR01950"
FT                   /protein_id="ADP69770.1"
FT                   /translation="MGVRALSRRNVASAKAVIEREAMETDDDIKITLSVGEVAKRAGVA
FT                   VSTLHFYESKGLIEGWRTDGNQRRYHRSVLRRVAIIRVAQRAGIPLQVVREALRDFPHD
FT                   RPPDVEDWKNFSTAWRDMLDERIAALTELREHLINCIGCGCLSLEECPLRNPGDELGHE
FT                   GAGPRRLASIVGEARSQEGQPEPE"
FT   gene            562759..562956
FT                   /locus_tag="Rvan_0489"
FT   CDS_pept        562759..562956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: isc:IscW_ISCW022546 nucleolar RNA-associated
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69771"
FT                   /db_xref="GOA:E3HYN0"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN0"
FT                   /inference="similar to AA sequence:KEGG:IscW_ISCW022546"
FT                   /protein_id="ADP69771.1"
FT                   /translation="MFTSFKAWLYRRQPDLGPALFIGFLALIAVLMWLETLRVSTFFCE
FT                   NDLCCSLWVAASDVREATHG"
FT   gene            562949..564043
FT                   /locus_tag="Rvan_0490"
FT   CDS_pept        562949..564043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0490"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: rpd:RPD_3140 secretion protein HlyD; TIGRFAM:
FT                   efflux transporter, RND family, MFP subunit; PFAM:
FT                   secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69772"
FT                   /db_xref="GOA:E3HYN1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN1"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADP69772.1"
FT                   /translation="MVDLQSRSFFAKSVSVHILALAILTTVFSGVYAWRSMRLQSSGPQ
FT                   ALPPIEVEAWTVEPKAVPQELDAIGSLSSVNEVTIAPEVAGRVIAIDFEAGVEVAAGAE
FT                   LLRLYDAPERADLETAKAKLEFARLQFDRAQELAPKGAESRQMLQQRAAELAQGEAAVR
FT                   LAEARLTQRTIRAPFAGRLGVRRVNLGQYVNAGEPLVTLTALDRLYVNFTLPQQELSKL
FT                   ANGGKVSVRTDAWPERDFEARINAIEPVVAAETRNISVQATLGNADGALRPGLYVTAKV
FT                   ILPPRARAILVPVTAVVTGPSGDTAYVVRGGKVEIVPVETGRRFGPHVVVERGLKGGDV
FT                   VITTGQLRLQPGAAITLATTMAKK"
FT   gene            564051..567083
FT                   /locus_tag="Rvan_0491"
FT   CDS_pept        564051..567083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0491"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rpd:RPD_3139 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69773"
FT                   /db_xref="GOA:E3HYN2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN2"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADP69773.1"
FT                   /translation="MRFTDLFIHRPILSVVVSLLILLAGINAFFSLPVRQYPNLQSATI
FT                   TVDTSFPGATQDVMQGFVTTPIAQAIATASGIEYLTSTTTMGQSQIKAKLVLNADSDRA
FT                   MTEVLSKVQQVKYRLPQGAFDPVVTKITDGASAVQYIAFVSDTLTIPQITDFVTRVGQP
FT                   LITSVKGVASADFAGAQALAMRVWIDPVKLAARNLTAGDIATALRANNVQAAPGQLESD
FT                   RSITSITATTDASSVGDFREMVIKTSASGLVRLRDVADVEIGSQNQKTLGWASGRRAVY
FT                   LKISPTPDGNPLEIVAATKALIPSMQSVAPPGLKVENQFDVAHFVHASIDEVLHTLVEA
FT                   VVIVVVVIFLFLGSLRAVVVPVVTIPLSLVGTAALMLAFGFSLNLLTLLAMVLAIGLVV
FT                   DDAIVVVENIHRHIAEGRSPIDAALAGAREIIGPVIAMTITLAAVYAPIGLMEGLTGSL
FT                   FREFAFTLAGSVVVSGVVALTLSPMMCSRLLSGEASESRFARLTERFLTTLASRYGSLL
FT                   ERTLTMRSVVLLVAGAMLAAIVVLFLGAKRELAPQEDQGYVFTAVRAPQYANLDYTASA
FT                   AAHVQRIFQSFPEYAANFFVVGTDGMNNAFGGIILKEWSERQRTSTDIQAQLYRTVRSV
FT                   HDASVTPFQPMALPASTGGLPFQMVLRSPAGYDGIYQEMEGLKAAARRSGLFVFVDSDL
FT                   AFDSPTARMRIDVAKAGEVGVTMQTIADTLAVLVGENYVNRFNYYGRSYDVIPQVRQPD
FT                   RVSPDALGRFYVRARSGAMMPLASLIKLDVMPQPNRLPQFNQMNAATLSAVLKPGVTMG
FT                   QAVAFMESLPRAPGVTIDWLGDSRQYVQEGNRLTVTFGFALIVIFLVLAAQYESFRDPL
FT                   VILVTVPLAVCGALVPLWLGYTTLNIYTQIGLVTLIGLISKHGILMVAFANDIQRREGA
FT                   GKREAILKAAMVRMRPILMTTAAMVTGLVPLLFATGAGAASRFAIGIVVVMGMLIGTLF
FT                   TLFVLPTFYVLLGSERMQRPS"
FT   gene            567825..568928
FT                   /locus_tag="Rvan_0492"
FT   CDS_pept        567825..568928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0492"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   avn:Avin_00450 ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69774"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN3"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP69774.1"
FT                   /translation="MTLADGPVPPVDQNGRAHFRLPLSSLPKRSPTMRYRLFSLLAALV
FT                   VLSSATASAGEVVDMSGRQVSLTDRPARVFAAMSTTTTLVLSVAPERLIGTYLGSNSKA
FT                   DRFLPAGALGKPLMEVAGVQTIDIEKVAQAKPDVAISLAVPGIGDRFRGDMARIGVPVF
FT                   EVKAERLEDYPAAFRSLSTLLGEAERAEAWAALLERRLAELKAARDAIPAAARRRVYYA
FT                   ESPNGMTTQCANAARAEVLALGGAINTVPCSGPTGMAFTTTIDPEMLLLLDPDIIVARF
FT                   PQARTAFMTDTRFQKLRAVREGRIFVIPDLPFNWFDRPPSHFRLLGAIWLMDCLYPDRT
FT                   KPDLAATTREFMRLFLARDLSADELAN"
FT   sig_peptide     567825..567989
FT                   /locus_tag="Rvan_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.611 at
FT                   residue 55"
FT   gene            568944..569954
FT                   /locus_tag="Rvan_0493"
FT   CDS_pept        568944..569954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avn:Avin_00460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69775"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN4"
FT                   /inference="similar to AA sequence:KEGG:Avin_00460"
FT                   /protein_id="ADP69775.1"
FT                   /translation="MLDALDEEPVFPEEDDARVRRRLDYLARPYPPLQREMRRSIHLLL
FT                   RDEHRRSGLEAAWYVARVGPAQPYDDIAEATDPDTIPALISDPGLGGIARQPFVERWLD
FT                   TGVFEQRQQVFARRDFTEAGFADPTGLFQVDGAGSWVILVDKTRLAGRPIPRSWEDLLH
FT                   PQWQGDILSSGQNGVVLALLLVNLAQDFGLDGMRAFARNVREVRGGAAMARYVGTDDPR
FT                   SAAICVLPNFWAHTVVRRDRSELVWPREGAYAPPILRLKKSETTPAANFIEAYITGREW
FT                   AARMESARCFSVRDDVPAEPPGGALRWIGWERARSLDFTYIRETLVAAYLKERTP"
FT   gene            569951..570655
FT                   /locus_tag="Rvan_0494"
FT   CDS_pept        569951..570655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0494"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; KEGG:
FT                   avn:Avin_00470 nickel incorporation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69776"
FT                   /db_xref="GOA:E3HYN5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN5"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADP69776.1"
FT                   /translation="MNLITVAGPPSAGKTSLILKAARHLREGGLKVGAVKFDCLSGRDG
FT                   DRYRAAGIPVLTGFSGNFCPDHFFVTNIERCVEWGRKQGLDFLVSESAGLCNRCAPHIR
FT                   GFLAVCVLDNLSGIDTPAKVGPMLKTADLVVVTKGDIVSQAEREVFAYRVRQVNSRADI
FT                   MFADGITGQGSLEIAMMWREAPSGTPLTGGRLRFSVPSSVCSYCFGQTRIGKEFQHGIV
FT                   REMPIEDLNDAR"
FT   gene            570642..571625
FT                   /locus_tag="Rvan_0495"
FT   CDS_pept        570642..571625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0495"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: avn:Avin_00480 ABC transporter, ATP binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69777"
FT                   /db_xref="GOA:E3HYN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69777.1"
FT                   /translation="MMPDEIEILDKTAEAFLAARGFPPVSEHRKLEAYWAALPWEFRDT
FT                   CGWTLETLRQGLRDYRAAEREGAASLSVERLDVLPGRSKSGEPESFSLTFRPGDVTAIV
FT                   GPTGSGKSRLLGDIECLAQGDTPSGRVVLVDGGKPDRKTRFTAEGRLVAQITQNMNFVM
FT                   DLEVETFLRLHAESRGSQTPDTAAADVLEAAVSMAGEAFTGKTPLTQLSGGQSRALMIA
FT                   GAALLSPKPIVLLDEIENAGVDRARALALFTDRGKIVLLSTHDPLTALSGSRRIVIRNG
FT                   GIAAILETTDEERGYAEVLLRREQRHNALRNAMRSGTPLAQAWQEL"
FT   gene            571880..572926
FT                   /locus_tag="Rvan_0496"
FT   CDS_pept        571880..572926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0496"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   avn:Avin_00450 ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69778"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN7"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP69778.1"
FT                   /translation="MCARPKKSAFFRAAALSLCLALAGLQATQTASAREIVDMSGQKLT
FT                   VPDDIRSVYAMTHAMPLLVALAPDLMAGFAMPVAPRPDVFRFLRPEMAKLPNLGGGPNV
FT                   NLEKLKDVGVQVALGWTSPSEQFPAKKYTRIDIPVVNIEVDKLALYPASFRFLGTLFHR
FT                   EARGEELARGLEETVAAAKAATQDIPDAEKPKIYYAESVDGLVSQCDTSDRSEVITLAG
FT                   GINALHCTGPVSMKDNYPIDIEKLLTVDPDVIVTRFPQTAKTIQADPRWAGLKAVKTGR
FT                   VYAVPGYPFNWFDRPPSFMRAMGARWLAAKLHPERCAFDLRGETKKFYTLFFGVTPTDA
FT                   DLDLLFAQ"
FT   sig_peptide     571880..571981
FT                   /locus_tag="Rvan_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.660 at
FT                   residue 34"
FT   gene            572923..574002
FT                   /locus_tag="Rvan_0497"
FT   CDS_pept        572923..574002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0497"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   nwi:Nwi_2075 ABC-type Fe3+-siderophore transport system
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69779"
FT                   /db_xref="GOA:E3HYN8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP69779.1"
FT                   /translation="MSEAGISTTRVRKAAPLLRAPAFAALGWTALLALVLAVAVIGALG
FT                   IGRYHVESGEIVTFLLATVGLADMPAERYATLQNVIVDIRLPRIAAAVLVGAALASSGA
FT                   AFQAVFRNPLVSPGLLGVLAGASFGAALGIVLDASWGGIQWLAFLMGLAAVAIGVGIAS
FT                   MFAGASLIMLVLGGMISSALFASLLSIVKYVADPMNHLPNIVYWLMGNLGQSDLGQVTL
FT                   LAWPMVAGIVTLSLLGRSLDVLSMGDDEARSLGLPVTTIRYGTIALATLVSALTVSMAG
FT                   MIGWVGLIIPHIARLALGASNTRLIPASALMGAIFLVATDALSRTVMDAEIPIGILTEL
FT                   LGIPVFLLVLGRSWRGWRE"
FT   gene            573995..574783
FT                   /locus_tag="Rvan_0498"
FT   CDS_pept        573995..574783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0498"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: oca:OCAR_4561 putative iron compound ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69780"
FT                   /db_xref="GOA:E3HYN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYN9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69780.1"
FT                   /translation="MNSARQLTAEGIVFRRGRRRVLDGATLAFSGGEIVSLLGSNGAGK
FT                   TTLLRIMLGLVAPDEGSVKLDGVPIAHLRRRELARRIAYVPQGHHAPFPYLVREVVALG
FT                   RFPTQGFFGRTVSADATAVEAILANLRIAHLADRTYTHLSGGERQLVMIARALAQDASL
FT                   LVMDEPLSGLDYGHQIELLRSLRDLAAQGFGILMTTHHPDQALMVSTRIATLIDGRIDS
FT                   DGAPRDVITPETIQRLYGVTLAPDEIHAQGLLASVSPNGK"
FT   gene            574949..577246
FT                   /locus_tag="Rvan_0499"
FT   CDS_pept        574949..577246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0499"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: oca:OCAR_4562 TonB-dependent siderophore
FT                   receptor; TIGRFAM: TonB-dependent siderophore receptor;
FT                   PFAM: TonB-dependent receptor plug; TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69781"
FT                   /db_xref="GOA:E3HYP0"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP0"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADP69781.1"
FT                   /translation="MQEIKGRARLLVTVSALALGFGLASSASAQDAQILPPVRVTTPAD
FT                   APKKVKRQAPQTASVDRSLGQDQGQGGQGGEARQGGDSGPSGFTPQTASIGPFANVKLL
FT                   DTPYSIDVVDQKVLDNQQVRSLDQALKYVPSAQLEPRGGIDVGRPQSRGFEGDTFANTR
FT                   LDGMNIFAVTAQPLEMIDHIEVVNGLTGAFYGPANPAGMFNFVAKRPTDYFLNEFTTGY
FT                   STNGGWLSHADVGGRVGPNGFFGYRLNFVNEEGSGYVSTSHLDRKLASGAFDFRFSNNT
FT                   VLEVNASYYNYQKSGYPGGFSVPNYFSNVPTSIQLPKLDPTQAGYGQEFTSSRYEVDTE
FT                   SAKIKHDFGNGWNLTAGVLHNRTDRFFSSVSNAISADGTKFTQSLSANPATPPARTDAF
FT                   SNTANLNGKLDTYGIGHEVVLGTTGYRTEAYSSPQTSALTKTLVTNRDIYDPLEVAPIY
FT                   IPGRPPMYKSSDGWQQSVIVGDTITLNRYFSAMAVGSYSWIGSHGYNASGVQTSETYTD
FT                   GFSPTAALMFKPLQNITTYVAYADSLQKGDTLTAGGVTRTLDPYRSEQYEAGVKAKLGG
FT                   IDARVAIFQIERPFAYVDGTVVNEAGNQRNQGVEFQAGGQVYENIHLLTGVTFLDPKLL
FT                   DAVDPNAEGKQIIGVPEVQANILVEYYVPWVENLVASANVHYVGERAVNNVNTSWADAF
FT                   TTVDLGARYETEVFGRKTTLRLNVNNVFDEKSWAAVMPGSIIGDPGTATKGANTAFLGS
FT                   PREVVFTGTVRF"
FT   sig_peptide     574949..575038
FT                   /locus_tag="Rvan_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.985 at
FT                   residue 30"
FT   gene            complement(577303..577515)
FT                   /locus_tag="Rvan_0500"
FT   CDS_pept        complement(577303..577515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_3106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69782"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP1"
FT                   /inference="similar to AA sequence:KEGG:Mnod_3106"
FT                   /protein_id="ADP69782.1"
FT                   /translation="MADTSVSDPHHHTQKMHAALTDLAKHMREDIDKVDEPKFRAMFET
FT                   SAEVLTGLAKAFSDYDQKQEKAFSN"
FT   gene            complement(577660..578208)
FT                   /locus_tag="Rvan_0501"
FT   CDS_pept        complement(577660..578208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0501"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: rpa:RPA1392
FT                   nitroreductase family proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69783"
FT                   /db_xref="GOA:E3HYP2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADP69783.1"
FT                   /translation="MDALKLLHERRSCSALTEPAPEGEALDAILKAALRVPDFQHLRPY
FT                   EFIVARGDGLARLGALMEVAAKASGKSEEIVKRAPKMPLRAPLVIVVVAKARESDVVHL
FT                   FEQQLTAGCAVMAMQMAAVAQGFGGIWRSGWAMFDRNLHHLLELGEKDQIVGFLYLGTP
FT                   KEEPAPAPVVDASAYVRML"
FT   gene            complement(578225..579253)
FT                   /locus_tag="Rvan_0502"
FT   CDS_pept        complement(578225..579253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0502"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rpa:RPA1391 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69784"
FT                   /db_xref="GOA:E3HYP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69784.1"
FT                   /translation="MKVDPLMLTLGDLTRTHPAFADLLAQTGGEGAKPSRTVASWLASL
FT                   TDERLSDIGMGREQLLSHIVALAEQVEALKAPSQVTVRSLTILGGRDKKGEAERLDLEL
FT                   RAGDVLCIVGPTGSGKSRLLADIECLAQGDTPSRRRVLVNGEAPDPSWRYASDRKLIAQ
FT                   LSQNMNFVVDLTVGEFVAMHADCRMVEDRDRIVDEVIACANELAGESFSAAVSLTQLSG
FT                   GQSRALMIADTALLSASPVVLIDEIENAGIDRKRSLDLLIASEKIVLISTHDPILALMG
FT                   TRRIAVRNGAVAGVIETGADERANLAVLERIDCELMALRHRLRSGERIDAPLAWAGLLA
FT                   KD"
FT   gene            complement(579243..579947)
FT                   /locus_tag="Rvan_0503"
FT   CDS_pept        complement(579243..579947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0503"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; KEGG:
FT                   rpa:RPA1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69785"
FT                   /db_xref="GOA:E3HYP4"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP4"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADP69785.1"
FT                   /translation="MRVITVAGPPSVGKTAVILKTAELLNRPGQRVGIVKFDSLSTSDD
FT                   KLYQRAGLPVTVGLAGNVCPDHFFVSNIDDCLGWGRDQALDMLIAESAGLCNRCSPHVQ
FT                   GTLAVCVVDALSGVHTPKKIGPMLKLSDIVVITKGDIVSQAEREVFAFNVRLANPRATI
FT                   LFFNGITGQGAGELAHRLEAAQSIERLEGRRLRFPMPSAVCPYCIGETVIGEDYQRGNV
FT                   RKMTFGCAGHEG"
FT   gene            complement(579938..581041)
FT                   /locus_tag="Rvan_0504"
FT   CDS_pept        complement(579938..581041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA1389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69786"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP5"
FT                   /inference="similar to AA sequence:KEGG:RPA1389"
FT                   /protein_id="ADP69786.1"
FT                   /translation="MGVLTSASTILEDMAPPSALFGHAAEAVGAPKVWDFLGNVPVPLR
FT                   HRIHDGVEARVIEHFAAGGRPLKCCFPHGRGGETPFDRLRFIRDLADYPNMIVSAEHGN
FT                   IFNRRFQAEFVERGAFASCQPDGVADVFADCGLVDPKGFIGVYAVAPFVLLIDRTQIGS
FT                   LPVPRRWADLMEPDYRGQVVFGGWKREDQRRYSAYNKFFLLAMAKEFGLDGVRRLVANV
FT                   PGLMHSAQMPRLAGTDASMGGIYVLPWSMADMCPRRDRTQVVWPEDGALAYPLWLTVKA
FT                   ARANAVAPLVDYFHGDALARTLNANRYPALAPGVAPRLPPGARFKWIGWDFVRHRSTGE
FT                   VIKAACRAFEAAQDAAAAARKEFLPCA"
FT   gene            complement(581194..581667)
FT                   /locus_tag="Rvan_0505"
FT   CDS_pept        complement(581194..581667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0505"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: rpa:RPA1371 putative vanadium
FT                   nitrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69787"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP6"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADP69787.1"
FT                   /translation="MLRIAFATSDRQTVNLHFGGAEALMLYDVAPGQADLVGFMEFPKA
FT                   EQEGETTRVGLTGTDKDKVIPKLDFVQECAAVYAASIGASSIRRLMALGVQPIIVDEGH
FT                   DIIDLLNEVSLAIVHGGLPWVDKAKARAEAAKTQPTLSGIEPARHDLITSIDD"
FT   gene            complement(581661..583040)
FT                   /locus_tag="Rvan_0506"
FT   CDS_pept        complement(581661..583040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0506"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase molybdenum-iron cofactor
FT                   biosynthesis protein NifN; KEGG: rpa:RPA1372 putative
FT                   nitrogenase cofactor synthesis protein; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69788"
FT                   /db_xref="GOA:E3HYP7"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP7"
FT                   /inference="protein motif:TFAM:TIGR01285"
FT                   /protein_id="ADP69788.1"
FT                   /translation="MAEIVLPTKALAVNPLKTSQPIGASLAILGLAEAMPLEHGARGCT
FT                   SFNKLFFMRHFRDPIALQTTAMDQLTTVLGADGNVVEALATICAKDKPEVIGLITTGLS
FT                   EVQGADVPSTIRAFRQRHPGYDGVAIVPISASDTLGNLETGFAAGVEAILDTLVPQAAS
FT                   NVARPRQVNVLPSAMLTPGDVEAVKDWIASFGLSAVVVPDIADSLDGHLTDDGYRTLTY
FT                   GGAARASIATMAESAATLVIGPSLDKAADALRERTGVTDWRFSGLMSVDECDAFSRALS
FT                   GIAGVPVPAGFQRKRAQLLDAMVDTQFQIGGAKIAIAADPDLLATLVRFYQAMGAEIVA
FT                   AVASARAQHLATLPLPQVVVGDLEDFEWLVRETGAEMIVTNSHGAEIAKRTKTTLFRAG
FT                   FPLYDSYGAHSRVWVGYGGARSTLFETANLLAAHYRELAPYRSIYWQGTPRDDETDRKA
FT                   C"
FT   gene            complement(583043..584428)
FT                   /locus_tag="Rvan_0507"
FT   CDS_pept        complement(583043..584428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0507"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase MoFe cofactor biosynthesis
FT                   protein NifE; KEGG: rpa:RPA1373 putative nitrogenase
FT                   cofactor synthesis protein; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69789"
FT                   /db_xref="GOA:E3HYP8"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP8"
FT                   /inference="protein motif:TFAM:TIGR01283"
FT                   /protein_id="ADP69789.1"
FT                   /translation="MNADEILALKTEPDCAHNNKEKSGCARPQPGSTQGGCCFDGARNA
FT                   LLPIADAAHIVHGPIGCAGSSWDNRGSRSSGADTFRMGMTTDLSDMDVILGRGEKRLFH
FT                   AIRQCVEAHRPPAIFVYTTCVPAMHGDDIVAVSKAASKRFDLPVIPVDCAGFYGNKNLG
FT                   NRIAGDVVYKRVIGTREPDPVPASAERPGIRTHDVNLIGEWNVGGEFWNVAPLFDELGL
FT                   RVLCTFSGDARFREVQTMHRAEANMVVCSKAMIHVARHLKEDHGTPFFEGSFYGVRDTS
FT                   NAFRDFARLIGDANLTDRTEAMIAREEARVTSALAPFRDRLSGKRVLVFAGGYKSWSLV
FT                   SAMQDLGMIVVATGTEKSTEEDKARIKALMGDDALMISDNDQNGLIRAFHDGAADLMVA
FT                   GDRYIYSSLKSRIPFLDIDHVRRIGYAGYEGAIELARNVERAVNSPVWRKAGMRPQVQR
FT                   RAA"
FT   gene            complement(584500..584745)
FT                   /locus_tag="Rvan_0508"
FT   CDS_pept        complement(584500..584745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_153969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69790"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYP9"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_153969"
FT                   /protein_id="ADP69790.1"
FT                   /translation="MPVTKGLSMPLYAAEQSELFGVKIIMIDMDAVGCWGWSRTVEAQL
FT                   QAGQRRAYNWESSRTFSNSSPAAPRWPDVPRRAAAA"
FT   gene            585035..586648
FT                   /locus_tag="Rvan_0509"
FT   CDS_pept        585035..586648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0509"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="KEGG: rpa:RPA1374 sigma-54 dependent, vanadium
FT                   nitrogenase transcriptional regulator, VnfA; PFAM: sigma-54
FT                   factor interaction domain-containing protein; GAF domain
FT                   protein; helix-turn-helix Fis-type; SMART: GAF domain
FT                   protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69791"
FT                   /db_xref="GOA:E3HYQ0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ0"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADP69791.1"
FT                   /translation="MPIQRSVSVELDDISDDFTHCFTGECRVNVLPILYQISEIINDSE
FT                   DLASSLSIILNVMQQRLKIVRAMVTLYDRQSETIFIHASFGLTDEQKAKGIYSPGEGIT
FT                   GKVVEAGKPIIIPKLRDNPGSANQTISGDGVNGNTSFFCVPIVHSKRVLGTISAERVYI
FT                   NRRLLKQDVELLATIASIIAPAVELYLLENVDKVRLEAENKRLNAELKERFKPSNIIGN
FT                   SKPMKDVYSLIHKVAFTKATVLILGESGVGKELVANAIHYNSITADGPFIKFNCAALPE
FT                   NIVESELFGHEKGSFTGAIAMRKGRFEMAHGGSIFLDEVGELSLSMQAKLLRVLQEKTF
FT                   ERVGGMKPVNVDVRIIAATNRNLLDMVDKGTFREDLYYRLNVFPITIPPLRDRSSDIIL
FT                   LADYFVTKYAAETGKDVTRISTPALNMLIAYHWPGNVRELENVIERSVILAEDGVIHGY
FT                   NLPPSLQTPETTPGAPSGMTIEAKLQAVEYEMIVEALKAHHGNMTEAARELGLTRRMLG
FT                   LRMEKYAINYKQFRRKEAAA"
FT   gene            586645..587025
FT                   /locus_tag="Rvan_0510"
FT   CDS_pept        586645..587025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69792"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ1"
FT                   /inference="similar to AA sequence:KEGG:RPA1375"
FT                   /protein_id="ADP69792.1"
FT                   /translation="MNTETLERLSPTQLYHRVLLDIATAAAASALGTSTNGAARATEES
FT                   YVPGRLRESLLAECDEGMRRRLSSLANSAVAALAMQGPDNLAQSARKHGIDLSAEEALQ
FT                   ISEHFEAKRNAVLSYQRGRELS"
FT   gene            complement(587072..587269)
FT                   /locus_tag="Rvan_0511"
FT   CDS_pept        complement(587072..587269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avn:Avin_02530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69793"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ2"
FT                   /inference="similar to AA sequence:KEGG:Avin_02530"
FT                   /protein_id="ADP69793.1"
FT                   /translation="MSVESAIAYITRMREDNDFHHLINAKSDDEEAAWALIREQGYDFT
FT                   LEEFQKARDTIYEEFGISPL"
FT   gene            complement(587336..587800)
FT                   /locus_tag="Rvan_0512"
FT   CDS_pept        complement(587336..587800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0512"
FT                   /product="lactoylglutathione lyase"
FT                   /note="KEGG: rpa:RPA1377 glyoxalase; TIGRFAM:
FT                   lactoylglutathione lyase; PFAM: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69794"
FT                   /db_xref="GOA:E3HYQ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ3"
FT                   /inference="protein motif:TFAM:TIGR00068"
FT                   /protein_id="ADP69794.1"
FT                   /translation="MSGTLAIDSTGFRLAHAMLRVSDLDAALDFYTGKLGMRVLQQRDH
FT                   KKNQFTQVYLGYAGGFDQMALELVFNWMQDEPYQRGQDFGHIAIEVKGIYGLCNRLKEA
FT                   GVPMPREPRSQKHGHTTIAFIEDPDGHRIELFEPVPAENAAEPAESVAAT"
FT   gene            complement(587797..588174)
FT                   /locus_tag="Rvan_0513"
FT   CDS_pept        complement(587797..588174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0513"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: rpa:RPA1377 glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69795"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ4"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADP69795.1"
FT                   /translation="MPENVLERTKSETSHAGVIRAAVSTRDGRKINLHFGATDTFFIYD
FT                   ASVEGAVLVEKRSISELALEGEDVRDTACRILADCKVLLLEKVGANPRAMLEAAGIEPI
FT                   EKYKGEQVETALAAVFAEKAS"
FT   gene            588542..589960
FT                   /locus_tag="Rvan_0514"
FT   CDS_pept        588542..589960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0514"
FT                   /product="nitrogenase vanadium-iron protein, alpha chain"
FT                   /note="KEGG: rpa:RPA1378 nitrogenase vanadium-iron protein
FT                   alpha chain; TIGRFAM: nitrogenase vanadium-iron protein,
FT                   alpha chain; nitrogenase alpha chain; nitrogenase component
FT                   I, alpha chain; PFAM: oxidoreductase/nitrogenase component
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69796"
FT                   /db_xref="GOA:E3HYQ5"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005974"
FT                   /db_xref="InterPro:IPR010142"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ5"
FT                   /inference="protein motif:TFAM:TIGR01860"
FT                   /protein_id="ADP69796.1"
FT                   /translation="MPMVLLKCDTDIPERQKHIYLKVDGEDTRDFLPVSNAPTIPGTLS
FT                   ERGCSFCGAKLVIGGVLKDTIQMIHGPVGCAYDTWHTKRYPSDNGHFQMKYVWSTDMKE
FT                   SHIVFGGDKRLEKAINEAFDEMPDVKRMIVYTTCPTALIGDDIRHTVKKVMGERPDVDI
FT                   FTVECPGFAGVSQSKGHHVLNIGWINDKVGQVEPEIKSEYTINFIGDYNIQGDTQLLQQ
FT                   YWDRLGIQVIAHFTGNANYDELRSMHRAQLNVVNCARSAGYIANELKKRYGIPRLDIDS
FT                   WGFNYMAEGIRKVCAFFGIEERGEALIAEEYAKWKPQLDWYKERLKGKKMAIWTGGPRL
FT                   WHWTKSVEDDMGMTVVAMSSKFGHQEDFEKVIARGAAGTYYVDDGNELEFFEILQHVHP
FT                   DVIFTGPRVGELVKKLHIPYINGHAYHNGPYMGFEGFVNMARDIYNATNNPLLSLAAKD
FT                   IRGAKKTAPVLEAA"
FT   gene            589963..590298
FT                   /locus_tag="Rvan_0515"
FT   CDS_pept        589963..590298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0515"
FT                   /product="V-containing nitrogenase, delta subunit"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: V-containing nitrogenase, delta subunit;
FT                   KEGG: rpa:RPA1379 vanadium dinitrogenase delta subunit;
FT                   PFAM: Vanadium/alternative nitrogenase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69797"
FT                   /db_xref="GOA:E3HYQ6"
FT                   /db_xref="InterPro:IPR004349"
FT                   /db_xref="InterPro:IPR014279"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ6"
FT                   /inference="protein motif:TFAM:TIGR02930"
FT                   /protein_id="ADP69797.1"
FT                   /translation="MEKIDQLFAYVQERCLWQFFSRSWDRQENIDGIIKTAAILLKGGK
FT                   PVLETPMDRLFYADAKIMVQDFRERFSWINEASADQIDSLLAELKDRLVEHTITKSLNG
FT                   ELTHTLY"
FT   gene            590393..591781
FT                   /locus_tag="Rvan_0516"
FT   CDS_pept        590393..591781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0516"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: rpa:RPA1380 nitrogenase vanadium-iron protein,
FT                   VnfK subunit; PFAM: oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69798"
FT                   /db_xref="GOA:E3HYQ7"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ7"
FT                   /inference="protein motif:PRIAM:1.18.6.1"
FT                   /protein_id="ADP69798.1"
FT                   /translation="MGCEVVSKDRVGVINPMYDCQPAGAQYAGIGIKDCIPLVHGGQGC
FT                   TMFVRLLFAQHFKENFDIASSSLHEDSAVFGGHDRIEDGIVVLAQRYPELRVIPLITTC
FT                   STEVIGDDCEGAVVRVQKKLKEMFPNRKFHIPVVHTPSFKSSQVGGYAECVLSVVKDIA
FT                   KTKTTPSGKLNFFPGWINPGDLVQLKHYVKEMGVDAHFFFDIEDFDSPMMPDKSISTHG
FT                   RTTVEDIADAPNALASISLARYESDPAAQHLQNAFGVPAAKLATPYGIANTDAMLEEIS
FT                   RITGKAIPDSLAHERGVAIDALQDLAHMFFADKKVAIYGHPDLVLGLADFCTEVELKPT
FT                   ILMLGDDNGRYKRDSRIKDLKDKVNWDMEVVCNADLWELEKRCKDPATKPDIILGHSKG
FT                   RYIAIDANIPMVRVGFPSFDRAGLYRHPLMGYRGAMLLGESIANALFTHMEYTKDREWL
FT                   LNTW"
FT   gene            591935..592828
FT                   /locus_tag="Rvan_0517"
FT   CDS_pept        591935..592828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69799"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ8"
FT                   /inference="similar to AA sequence:KEGG:RPA1381"
FT                   /protein_id="ADP69799.1"
FT                   /translation="MPLLDDIVAGLSDSCSPQLRLPEHRQIELSTARKLISFAPADADS
FT                   EAPMPLALGACRTFMMLDAFHEARLAGAEGVSYWQRYTDLPRKSLSDKIGAEIYRILRV
FT                   VRLLTFHRLGEISMKNGLLDIKGEVAREVLWLRISPAGLKLIESAAVWYMDAVRQPYPD
FT                   AYIDAMMAEYYADIIGEIKKYSDEKRSLNQFRKPFATFNRHFRLDCASFPLKIGTDALV
FT                   IEITELHRNASVYPVDFYLPYGEDLYIVPAEALENGKITLAELPKWQARSPDGTLPARY
FT                   RARLGYEVPVKNQPMT"
FT   gene            592859..593344
FT                   /locus_tag="Rvan_0518"
FT   CDS_pept        592859..593344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0518"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: rpa:RPA1382 nitrogen
FT                   fixation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69800"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYQ9"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADP69800.1"
FT                   /translation="MDAAHLRIAVTTNSLVQCDANFASAKQVVFYDVGRDGAEFVDVVS
FT                   FSKTGRKAPAGGKAANNGRCVMEDMGDDDGTGHDPLVERVEVLENCSVLFTLGMSDLAA
FT                   VRVHNKRVFPVKNSRIRDIDDVIVQMQKLMQGTPPLWMRRVMFDGKGRRLPLDEQEI"
FT   gene            complement(593423..594244)
FT                   /locus_tag="Rvan_0519"
FT   CDS_pept        complement(593423..594244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0519"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rpa:RPA1384 putative phosphate permease
FT                   component of ATP-dependent phosphate uptake system;
FT                   TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69801"
FT                   /db_xref="GOA:E3HYR0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR0"
FT                   /inference="protein motif:TFAM:TIGR01097"
FT                   /protein_id="ADP69801.1"
FT                   /translation="MTAEALRPEMAAILADSRRKLRAAILTGAALAVVILAAFLYAGAL
FT                   NPKRYADAIPTILKLASDAFPPDFSRWQSWGKPLLETLSMSVAGTVLGVCMALPLGALG
FT                   ARNVTRSNFINVPVRFVLNMLRSIPGLIWGVIYVAAVGFGPLPGVLALATHSTGMLGKF
FT                   YAETMEHVDPGPGNALKSHGVSKLGVLRFSVVPQILPQLVDVTLYRWEHNLRAATTLGV
FT                   VGAGGLGLEIITAFNLFEYREAMALIIVLLVLVTLITILGARLRRHFLGQM"
FT   gene            complement(594241..595131)
FT                   /locus_tag="Rvan_0520"
FT   CDS_pept        complement(594241..595131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0520"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: rpa:RPA1385 putative
FT                   phosphonate transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69802"
FT                   /db_xref="GOA:E3HYR1"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR1"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADP69802.1"
FT                   /translation="MLKTPALIAKLAMAAAMLIGGVMTAAAQSPRPEKLVVGLLPGESA
FT                   PTVMRLNEPLRAYLEKKLNIPVELVVGANYAATGEALRFGRLDIAYLGPVTYLLRARSA
FT                   KLEPFARPSHAVVGPTFQAVVIVPADSPAKTLADLKGGEIAFGDPASTSGTWVPRYQLL
FT                   AAGLVSGRDYQLRVLGAHDAVALAVVNKKVAAGGLSYPIYQRLLKEGKIDKDATRILEL
FT                   SPPIPEYMWTFREGLDPEFREEIRKAFTSVNDPEALKVFRAEAFIPAVDSDVDRVRTWM
FT                   DAIKNANPEAIPAPQ"
FT   sig_peptide     complement(595048..595131)
FT                   /locus_tag="Rvan_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.823 at
FT                   residue 28"
FT   gene            complement(595131..595940)
FT                   /locus_tag="Rvan_0521"
FT   CDS_pept        complement(595131..595940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0521"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rpa:RPA1386 putative ATP-binding component of
FT                   ABC phosphonate transporter; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69803"
FT                   /db_xref="GOA:E3HYR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69803.1"
FT                   /translation="MTASVRRIGEEQKLAIVVEQLTLRRGKVEVLRDLSLSFRECSVTA
FT                   VVGPSGVGKTTLVSAINGLLLPEKGRIAVSGIGALDNPAALKAARHRIATIFQDHALIG
FT                   RLSAIDNVLLGLADMRHPLSPLPWPGELRLRAAEALEQVGLLDKAAVRADQLSGGERQR
FT                   VGIARALIRKPVILLGDEPFASVDPVLAQRLAENFKSLITKHGITVILVLHQLQMARAL
FT                   ADRIVGLSGGRIAFDGPAAEFDADAEARIFSPAQKAGSRAFQPQEEM"
FT   gene            complement(596558..597609)
FT                   /pseudo
FT                   /locus_tag="Rvan_0522"
FT   gene            complement(597719..597803)
FT                   /locus_tag="Rvan_R0005"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(597719..597803)
FT                   /locus_tag="Rvan_R0005"
FT                   /product="tRNA-Leu"
FT   gene            597957..598940
FT                   /locus_tag="Rvan_0523"
FT   CDS_pept        597957..598940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0523"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   azc:AZC_1016 NAD dependent epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69804"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP69804.1"
FT                   /translation="MASANGNSTVVTVFGGSGFLGRYVVQALAKAGFRIKVAVRRPELA
FT                   LYLQPLGSVGQIALVSANVRDEKSVAEAVRGADAVVNLVGILAPSGRQRFKAVHADAPE
FT                   LIAKAARAAGVKRFVHVSAIGADRLSHSAYARTKGEGEARALAAFPQTVILRPSLVFGP
FT                   EDQFFNRFAGLAALSPVLPLIGGNTRFQPVYVGDVARAVTAAVEGRATEGAVYELGGPS
FT                   VYTFREILQKVCEWTQRPRVLLPVPFWAAKIQAFFVQALPGAPITLDQVRLLQNDNIVG
FT                   AEAIRDQRTLEGLGVTEPKSIEVIVPPYLQRYRPRGEFSTGRAAAF"
FT   gene            598952..599644
FT                   /locus_tag="Rvan_0524"
FT   CDS_pept        598952..599644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0524"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mno:Mnod_5423 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69805"
FT                   /db_xref="GOA:E3HYR4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR4"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ADP69805.1"
FT                   /translation="MPTTLIHFPLCPASRAIRVALFECGIEADLSEVKPWALARDFLNI
FT                   NPAGTLPVLMLDARAICGVYPVVEYLSESTPRETGAAARAQIWPGLPVERAEARRVADW
FT                   FLTKFDAEVSQSLLDEKLYKPMARGRLAPDLPAIRACRSNLRYHLSYISFLSDQRKWLG
FT                   GDHISFADVAAAAQLSVMDYLSEIPWTEFPEAKAWYQRLKSRPSFRSILADRIPGFSPP
FT                   ETYADLDF"
FT   gene            599625..600782
FT                   /locus_tag="Rvan_0525"
FT   CDS_pept        599625..600782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0525"
FT                   /product="domain of unknown function DUF1730"
FT                   /note="PFAM: domain of unknown function DUF1730; KEGG:
FT                   oan:Oant_1337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69806"
FT                   /db_xref="GOA:E3HYR5"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR5"
FT                   /inference="protein motif:PFAM:PF08331"
FT                   /protein_id="ADP69806.1"
FT                   /translation="MRISTSEHARSAAAGDNLSGVVKARALAEGFDTVGIADPASIGGA
FT                   GEGLMGFLAAGFHGDMGWLEANADKRADPRVLWPDVRSVILVTLSYGPDVDPRTARNDP
FT                   SRGAVSVYAKGADYHDIIKAKLKAVARDFASIAGADVKVFVDTAPVMEKPLAQAAGLGW
FT                   QGKHTNLVARDLGSWFFLGAIFTTAKLAPDAPERDRCGTCRACLDACPTRAFPAPHRID
FT                   ARRCISYLTIEHKGQIAPEFREAIGNRIYGCDECLAACPWNKFAQEASEMRFHARDGAD
FT                   NPLLRELLRLDDAAFRARFAGSPIKRIKRDRFVRNALIAAGNSGDAALLDDALSLLCDD
FT                   SPLVRGMAVWAVRQLGGLELKSKLKESYSSEEKDVAVREEWERTP"
FT   gene            600779..601642
FT                   /locus_tag="Rvan_0526"
FT   CDS_pept        600779..601642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0526"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   NAD-dependent epimerase/dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69807"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP69807.1"
FT                   /translation="MSNLFVFGLGYSALATAVHLADGGWPVTGTVRSRDKLEQIARDGI
FT                   TPILFSDAEAVAAGLQTTSHCLVSVPPDAEGDPALLAYRDALLEAPELHWIGYLSTIGV
FT                   YGDHGGKWVDEETHVAATGGRRSARAEAEIEWTALAKEKGIALDIFRLAGIYGPGRSPI
FT                   DRIRSGEARWIHKAGQVFNRIHVEDIAQTVLAAIRRDRLGGVHIFNVTDDEPAPNPDVL
FT                   AYAADLIDVPKQPLIPYEEADLSPMARSFYEGNKRVHNAKIKRELGVLLRYPTYREGLR
FT                   ALAREG"
FT   sig_peptide     600779..600841
FT                   /locus_tag="Rvan_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.569 at
FT                   residue 21"
FT   gene            complement(601650..602426)
FT                   /locus_tag="Rvan_0527"
FT   CDS_pept        complement(601650..602426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69808"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR7"
FT                   /inference="similar to AA sequence:KEGG:Nham_0078"
FT                   /protein_id="ADP69808.1"
FT                   /translation="MNSGKLQLLPVPAADGSTSSIAWRFRKAEENRTTFVWFSGFRSQM
FT                   DGEKAMALDAWAGSNGAGCLRFDYSGHGLSSGACEDGTISRWLDEADAVIAAAAVSGRS
FT                   VFVGSSMGGWLSLLIARRLAELDRPSPAALVLIAPAWNMTRVMLDRFPPEAKAALERDG
FT                   VFLRPSAYGAEPYPITKTLVDDGERHLFGETIGISAPVRIIHGQQDADIPWRHSLDLID
FT                   RLAAPDIRLTLVKDAEHRLSRPQDLALLFATLAEFL"
FT   gene            602519..603775
FT                   /locus_tag="Rvan_0528"
FT   CDS_pept        602519..603775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0528"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mpo:Mpop_1613 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69809"
FT                   /db_xref="GOA:E3HYR8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP69809.1"
FT                   /translation="MMLKRSPWPVILQVVPELSTGGAERTAIEIAEAVTMGGGKALVIS
FT                   EGGRLEDELAAVGGELIRMSAATKNPALVLANAMRIARLVRERGVSLVHARSRAPAWSA
FT                   WIAARRAKRTFVTTYHGIYNQTGRVKAFYNGVMAKGDAVICNSEYTARIVRERHPKATD
FT                   RVGVIYRGLDVERFDPALISPERVRALREAWGVPPGKRIVLMPARLTRWKGQRVLVEAA
FT                   ALLSARNRDGDLVFVLVGDDQGRTPYRAELAALVEARGLADRVIIAGHCDDMPAAFKAS
FT                   WLTVIASIEAEAFGRVSVESQAMGCPVIASNIGALPETIAPEPGILANAGADGFSEPVP
FT                   AAGQRPWLFEPGNPQALCDSISAALALDAAVLDAFRQHAMERARTSFSKRALQHQTLAV
FT                   YDRLIGTQLAANFANAASR"
FT   gene            603947..604468
FT                   /locus_tag="Rvan_0529"
FT   CDS_pept        603947..604468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0529"
FT                   /product="translation initiation factor IF-3"
FT                   /note="KEGG: xau:Xaut_1937 translation initiation factor
FT                   IF-3; TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   Translation initiation factor 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69810"
FT                   /db_xref="GOA:E3HYR9"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYR9"
FT                   /inference="protein motif:TFAM:TIGR00168"
FT                   /protein_id="ADP69810.1"
FT                   /translation="MRGAPVKEGPRINEGIIARDVQLIDEAGENHGTVSKRDALAKAQE
FT                   AGLDLVEIAVNGEVPVTKIMDFGKYKFQAQKKAAEARKKQKTVEVKEIKLRPNIDTNDY
FT                   NVKMRSIKKFFEEGDKVKVTLRFRGREMAHQDIGMQLLLQVKEETTAIAKVELEPRLEG
FT                   RQMIMVLAPR"
FT   gene            604672..605271
FT                   /locus_tag="Rvan_0530"
FT   CDS_pept        604672..605271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0530"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: pla:Plav_0191 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69811"
FT                   /db_xref="GOA:E3HYS0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS0"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADP69811.1"
FT                   /translation="MTIKVTGKNIDLGESLREYALNRVESALDKYSGRSVSGQISVEKN
FT                   TDGFFSHCAIHLESGLDLQSTGTGVDGYASVDSAMERLEKRLRRYKRRIDDHGQGDAAA
FT                   LQFESAGVDYIIDVESADESADTHDGDGAPAVIAESPVQVKALSVSDAVMQLDLADKSF
FT                   LVFRNAAHGGINVVYRRADGNIGWIDTGGAVTSAKS"
FT   gene            605308..605784
FT                   /locus_tag="Rvan_0531"
FT   CDS_pept        605308..605784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0531"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: oan:Oant_0172 PTS
FT                   IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69812"
FT                   /db_xref="GOA:E3HYS1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS1"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADP69812.1"
FT                   /translation="MGHDMDLSDLITPYGVIPSLKAANKKQALKILSERAADLTGLNSV
FT                   EIFNILIQRERLGSTGVGSGIAIPHGKLTTIKASVGVFARLEEPLDFDSIDEEPVDIIM
FT                   LLLAPESAGADHLKALARVSRLLRDQKSVDKLRACRDRAAIYAVLTEKAASHAA"
FT   gene            complement(606059..606802)
FT                   /locus_tag="Rvan_0532"
FT   CDS_pept        complement(606059..606802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69813"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS2"
FT                   /inference="similar to AA sequence:KEGG:mlr0120"
FT                   /protein_id="ADP69813.1"
FT                   /translation="MLRATAFIAMAAFCGSSEAAAQTCKPYAFEGNGYTLCEASLDRFA
FT                   VRLFWQKPDGGPYTYLSALPKTDERGGRLAFALNGGMFHPDYKPVGLHVENGRELVRAN
FT                   TRPGPGNFHLRPNGIFYFGEAEAGVMETGAFLKKKPKANFATQSGPMLVIDGKLHPRIA
FT                   KANVSAKPRDGVCVRGDKSVVFAISDGGVPFDTFMRLFRDGLKCRNALFLDGGTAPALF
FT                   VPGTRSGNVLFGLGPMIAVYEKPRP"
FT   sig_peptide     complement(606743..606802)
FT                   /locus_tag="Rvan_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 20"
FT   gene            606983..608017
FT                   /locus_tag="Rvan_0533"
FT   CDS_pept        606983..608017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0533"
FT                   /product="ribonuclease BN"
FT                   /note="KEGG: ribonuclease BN; TIGRFAM: ribonuclease BN;
FT                   PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69814"
FT                   /db_xref="GOA:E3HYS3"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS3"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADP69814.1"
FT                   /translation="MPDYGNSQAQGQVRARARKLPIARRRAFGQSSFRNRSNANFSDSL
FT                   RNAALSFNVRARAAKLAFARQRKRYTPLHVLVRVWKSIAADNISLLAAGVAFYALLAIF
FT                   PGLVFFVAVFGLLAETGQVQNFLLTLKDVLPTEAWEAINAQVEVLVRQNTTSLSLATMI
FT                   SLGLAFINARLGVYALMSALNGVYRRTETRSFAHTNSLAILFTLGALAVLAFNILVVAA
FT                   VPGIFRLVGISEFTNAVLHYARWPALAIIVALSLAVVYRYGPDRKDAHWRWVSLGSLAA
FT                   TALWLAASTGFSWYVSAFNSYDRIYGSFGAVVILLYWLWLTAFAALMGAELDMQIQTAL
FT                   EERQ"
FT   gene            608014..609042
FT                   /locus_tag="Rvan_0534"
FT   CDS_pept        608014..609042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0534"
FT                   /product="magnesium chelatase ATPase subunit I"
FT                   /EC_number="6.6.1.1"
FT                   /note="SMART: AAA ATPase; TIGRFAM: magnesium chelatase
FT                   ATPase subunit I; KEGG: rpc:RPC_1250 magnesium chelatase
FT                   ATPase subunit I; PFAM: magnesium chelatase ChlI subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69815"
FT                   /db_xref="GOA:E3HYS4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS4"
FT                   /inference="protein motif:TFAM:TIGR02030"
FT                   /protein_id="ADP69815.1"
FT                   /translation="MTRPVYPFSAIVGQDELKLALIISAIDPSIGGVLAFGDRGTGKST
FT                   TVRALAALLPPVRAVRDCRFNCDPDGSNLCEECREKLREGEKLVARFIRVPVVDLPLGA
FT                   TEDRVVGALDLEKALTRGEKAFETGLLARANRGFLYIDEVNLLEDFLVDLLLDVAASGE
FT                   NVVEREGMSLRHPARFVLIGSGNPEEGELRPQLLDRFGLSVEVRTPQDLASRIEVVRRR
FT                   DGFERDPHGFAAAWRGENRKLRRKVATARARVNLIAVPDSILEDSAKLCLALGTDGLRG
FT                   ELTLMRAARALAAYEGAETVTQKHLISIAPPALRHRLRRDPLDEAGSSVRVDMALEKAF
FT                   SA"
FT   gene            609042..610856
FT                   /locus_tag="Rvan_0535"
FT   CDS_pept        609042..610856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0535"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: rce:RC1_2082 magnesium chelatase subunit D;
FT                   PFAM: von Willebrand factor type A; SMART: von Willebrand
FT                   factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69816"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS5"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADP69816.1"
FT                   /translation="MNGGGEAEERSLWEEAVMAASLFAVDPVGLGGIAVASKYGPVRDS
FT                   WMDFLRSIVPGWAPFRKLPLYAADERLFGGLDLAATLARGKPVAERGLLAEMDRGFLVI
FT                   PSAERMESGLASRLGLVIDAGAVHVEREAASLMHPARFGVIALDESESGDDETPPAALL
FT                   ERLGLRIDLTDVTWRDVGLSDTTLEEIEAAQARLPKVVVPDNIIAGLVSAAVSFGIQTL
FT                   RAPVFAVRAARASAALAGRDEANEEDAGLAAMFVLAPRATRMPEPMEDQAPPEPPPPEP
FT                   QDDKEEDGKGGGESGENETAPEDDKALTDMIIAAAAAAMPKEMLVKAAAKPFRVPPSAP
FT                   MGKAGAERTNAARGRPAGVRRGMPKPGSPLSLLETLRAAAPWQKIRKSMLDKAIGAGGR
FT                   LDRIEVRSDDFRIKRLKARSQTATIFAVDASGSAAMQRLAETKGAVELLLAECYIRRDQ
FT                   VALVAFRGTRAEILLPPTRSLTRAKKSLAALAGGGGTPLASGIDAAGALALNIRRRGIS
FT                   PLVVFLTDGKANIAADGKPGRERAQNDANTAGRRLRAEGIATILVDTSPRPQVQAEKLA
FT                   QEMAARYVPMPYANAAAISKAAKMAAKG"
FT   gene            610853..611776
FT                   /locus_tag="Rvan_0536"
FT   CDS_pept        610853..611776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0536"
FT                   /product="magnesium chelatase accessory protein"
FT                   /note="KEGG: bra:BRADO1609 putative alpha/beta hydrolase,
FT                   putative protoporphyrin IX magnesium chelatase BchO-like;
FT                   TIGRFAM: magnesium chelatase accessory protein; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69817"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR017497"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS6"
FT                   /inference="protein motif:TFAM:TIGR03056"
FT                   /protein_id="ADP69817.1"
FT                   /translation="MTALKWERDGLHWPNRAASRFVSAGGLRWHVQEMGSGPTVLLLHG
FT                   TGASTHSWRHFMPILARRFRVIAPDLPGHGFTEAPRTSSLLTLPHMAQAIATLLGTLHV
FT                   KPDLAIGHSAGSAILCRMALDGKLGAQAIISLNGAFLPFPGIASQLFPMIARALFLNPF
FT                   VPGYFAWKARDKVTVRRLIEGTGSHLDAEGLAQYGLLLGNSTHIASALGMMANWDLQSL
FT                   SNDLPKLKTKLTLIACTEDKAVPSQVAFKVYNMVPGSKVILLRHMGHLAHEEKPQEVVD
FT                   IVFAEAERYGILAKDEYPAEPQPAAE"
FT   gene            611821..611946
FT                   /locus_tag="Rvan_0537"
FT   CDS_pept        611821..611946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hip:CGSHiEE_09100 large-conductance
FT                   mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69818"
FT                   /db_xref="GOA:E3HYS7"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS7"
FT                   /inference="similar to AA sequence:KEGG:CGSHiEE_09100"
FT                   /protein_id="ADP69818.1"
FT                   /translation="MGVEAELLLVLGVLAFAVYELIKTRRALRKSREEKPPPKGE"
FT   gene            612160..613983
FT                   /locus_tag="Rvan_0538"
FT   CDS_pept        612160..613983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0538"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; KEGG: bid:Bind_0857 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69819"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS8"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADP69819.1"
FT                   /translation="MLTSDFVRRISLRNTSRALVAACLAILLAYPADARAAPNQSKAPV
FT                   RSESFGSNSLLGSYLAGHVARSARDSENAALYYRRALQKDPANSDILDDAFQLELASGA
FT                   FASAKTLALRLIKRPGEAAIAYDFLGLDAFKRKDYAKADEYFRLAAKGTSPEEPTMKLA
FT                   RAWVAVAQGQSDQAIATLSEPSKAAWATHFETVQRAFVADVAKKKAAATEAYKAVYEKK
FT                   PTNMRIAEGYARHLAVWGDKQQALAVLKESGAEDTPLGSALMADLKAGKTPKLMVSTVD
FT                   EGLAETFLGIGQVLASNNGVDAAQIYLRLALYLNPASDIAKLELAEIYGNLEQYHKAVS
FT                   VLDAIRETSPFRLNAQVRKALYLNALQKTDEATALLTALSEKHPKEESVLQTLASIDSA
FT                   AKRYDAAIPYYTRVIELVDEPEKRHWTLFYQRGIAYERTKQWAKAEADFKRALDLDPEQ
FT                   GAVLNYLGYSWLDQNINIPEAFDLIKKAVRLKPNDGYIIDSLGWGYYIQKDYVQAVKHL
FT                   DKAVELRPEDPTLNDHLGDVYWRLGRKLEAKFQWTQALSLNPEPDDVVKIKKKLEAGLP
FT                   DEAGPHAELQTQPEAVPAVASEPQPQATANP"
FT   sig_peptide     612160..612270
FT                   /locus_tag="Rvan_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.943 at
FT                   residue 37"
FT   gene            614211..615140
FT                   /locus_tag="Rvan_0539"
FT   CDS_pept        614211..615140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0539"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; KEGG: mpo:Mpop_3302
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69820"
FT                   /db_xref="GOA:E3HYS9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYS9"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADP69820.1"
FT                   /translation="MTHSSEADIIQATAHEDTWPVTIRERARAKVNLTLHVKGKRPDGY
FT                   HELESLVVFANDVADELEFSPDIDDRLEIDGAFAPLLEGDNLILKAKRAVAEWFDMDIH
FT                   GHFRLRKNIPVAAGLGGGSSDAAATIRALVAIYGENRKAHEFIEASKEIGADVPVCLYG
FT                   RAAWMCGLGERITPVTRLAPLPAILVNPRIKLSTADVFRTLAAKPLEPGAENAPFSVST
FT                   DWDSPESAAACLAHGRNDLEGPAIALEPQVARVLDTVRALDGCVLSRLSGSGPTCFGVF
FT                   ATAEKAKAAAGALAAAHPNWWVAATILA"
FT   gene            615185..615907
FT                   /locus_tag="Rvan_0540"
FT   CDS_pept        615185..615907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0540"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: oan:Oant_4041 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69821"
FT                   /db_xref="GOA:E3HYT0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT0"
FT                   /inference="similar to AA sequence:KEGG:Oant_4041"
FT                   /protein_id="ADP69821.1"
FT                   /translation="MDDRHAFPESAAGGAGRSSVLIRFAGLAVVLDGSGAAYLPDHAML
FT                   IVSDLHLEKGSGAAARGRLVPALDSHDTLARLRRAVEAWRPRCVICLGDSFHDGAAGSR
FT                   MAEADRAALASLCALAEEWIWIGGNHDPHAPDFCEGARLPELRLDGVVLRHEPGEEHKP
FT                   ERGAPEIVGHFHPKARLKGGGYGFSGPCFCVSDDLMILPAFGAYTGGLSCSAPVLRALH
FT                   RNEPRLFMLHGGKVWRVA"
FT   gene            616085..616633
FT                   /locus_tag="Rvan_0541"
FT   CDS_pept        616085..616633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ncr:NCU04252 similar to sly1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69822"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT1"
FT                   /inference="similar to AA sequence:KEGG:NCU04252"
FT                   /protein_id="ADP69822.1"
FT                   /translation="MRLRFAFWLASLAAVAGTTPMPHSALAQGFGQPMRGPTNILGRSY
FT                   PGKIKAIGVESMTVNLREGGPQTVLYSDIWRLRRSFASDEPNGSSIVDFGNNRMFIAAS
FT                   FDALVAEVSKKLPLTKFTAPNGDTVYLVANKVTDITGAIPGLHNPASKTVVGTRNGSQQ
FT                   VLETIADTKKVIAAASIAR"
FT   sig_peptide     616085..616168
FT                   /locus_tag="Rvan_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            616663..617571
FT                   /locus_tag="Rvan_0542"
FT   CDS_pept        616663..617571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0542"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: rce:RC1_0837 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69823"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT2"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADP69823.1"
FT                   /translation="MWRVGVDLGGTKIEALALSSDGEERARLRMATPRGDYEATLDAIA
FT                   ALVARCVDGLPPSDIAGVGVGIPGSLSPATGLVRNANSTWLNGKPLHRDLQARLPWRCV
FT                   VENDANCFALSEAADGAGAGYRTVFGVIIGTGVGGGIVIEGRSHLGLNALGGEWGHNAL
FT                   PWPDADEWPGEPCYCGKRGCIETFLSGPALQRQYAALSGETVKAKTISVRAEAGEAAAI
FT                   AALETYSRRLAKALASVVNILDPDVIVFGGGVSNIDAVITGAAHRLPDWAFSDSFATQL
FT                   LKNRWGDSSGVRGAARLIILG"
FT   gene            complement(617994..619487)
FT                   /locus_tag="Rvan_0543"
FT   CDS_pept        complement(617994..619487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0543"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: pla:Plav_3236 carbohydrate kinase, YjeF
FT                   related protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: YjeF-family domain-containing protein;
FT                   protein of unknown function UPF0031"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69824"
FT                   /db_xref="GOA:E3HYT3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT3"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADP69824.1"
FT                   /translation="MLELLTSEEMARAEQLAAEAGTSTLTMMENAGRAVAEEVVRRYPR
FT                   GSRVTVLCGPGNNGGDGFVCARYLRERGYQVRLALLGKQEELHRDPKEMARRWDEAIEP
FT                   LSLQSLEGAQIIVDAIFGTGLRDDIGGAVAQIIEEVTARKLPVVSVDVPTGIDATRGNV
FT                   RGLAFKAAATITFFRRKTGHVLLPGRLYCGDVRAVEIGIPATVLADIAPRTFANDPDFW
FT                   LRYYPKLRLEGHKYDRGHAIVVSGPMESTGAARLAARAALRSGAGLVSVATSKAAFYIN
FT                   AAQLTAIMVAPFDGAAGLSDYLSDPRIRATLIGPGAGRDPEVKDLVLSVLASDAVAVLD
FT                   AEGITAFEDAPAELFDQIRARPAPTIMTPHEGEFLKVFPELENEVSKLERARRAAELSG
FT                   AVIILKGADTVVAAPDGLAAISENAPPWLATAGSGDVLAGLVTGLLAQGMAAFDAASAA
FT                   VWIHGELATTYGPGLIAEDLTEVLPAVLQRLDKRGKIFS"
FT   gene            complement(619512..619718)
FT                   /locus_tag="Rvan_0544"
FT   CDS_pept        complement(619512..619718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cms:CMS_2843 putative heme synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69825"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT4"
FT                   /inference="similar to AA sequence:KEGG:CMS_2843"
FT                   /protein_id="ADP69825.1"
FT                   /translation="MFRAAMHRATPGASPRQGANARGRVGPSISRRKWKVGVYQQRSTR
FT                   IAFLSPCANFRYIRRTSPSNGIV"
FT   gene            619885..620223
FT                   /locus_tag="Rvan_0545"
FT   CDS_pept        619885..620223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0545"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pla:Plav_3243 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69826"
FT                   /db_xref="GOA:E3HYT5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT5"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADP69826.1"
FT                   /translation="MKKIEAVIKPFKLDEVKEALQEIGLQGITVTEAKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEIVLPEDMVEKACEAIKNSARTGRIGDGKIFILNVEDAIRIRT
FT                   GETGTEAI"
FT   gene            620329..621738
FT                   /locus_tag="Rvan_0546"
FT   CDS_pept        620329..621738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0546"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: ara:Arad_2372 glutamine synthetase protein;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69827"
FT                   /db_xref="GOA:E3HYT6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT6"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADP69827.1"
FT                   /translation="MANASEVVKKLKDEDIRFVDLRFTDPRGKLQHVTMETSEMGEDAF
FT                   AEGIMFDGSSIAGWKAINESDMTLMPDPETAHLDPFFAQSTLAIFCDILEPATGERYER
FT                   DPRGIARKAEAYLKQTGIGDTAYFGPEAEFFIFDDVRFSADPYNCGYRLDSSELPSNMG
FT                   TEYEMGNLGHRPRTKGGYFPVPPVDSAQDIRSEMLSTMAAMGVKTEKHHHEVAAAQHEL
FT                   GIKFGTLTTTADAMQIYKYVTHNVAQSYGKTATFMPKPVFGDNGSGMHVHQSIWKGSEP
FT                   VFAGSEYADLSETCLFYIGGILKHAKALNAFTNPSTNSYKRLVPGYEAPVLRAYSSRNR
FT                   SASCRIPVVSSPKGKRVEVRFPDPTANPYLAFSAMLMAGLDGIKNRIHPGQPMDKNLYD
FT                   LPEAELREIPTVCGSLQEAIDSLDADRTFLKEGGVFTDDQIDAYIALKVEEIDRFRMMP
FT                   HPIEFEMYYSA"
FT   gene            complement(622117..622611)
FT                   /locus_tag="Rvan_0547"
FT   CDS_pept        complement(622117..622611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0547"
FT                   /product="Uncharacterized conserved protein UCP032146"
FT                   /note="PFAM: Uncharacterised conserved protein UCP032146;
FT                   KEGG: rhi:NGR_c02250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69828"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT7"
FT                   /inference="protein motif:PFAM:PF06793"
FT                   /protein_id="ADP69828.1"
FT                   /translation="MPERTEVDPSARLIEVNIDEASMGANALEVEHERRVAIFDLLEEN
FT                   AFELIAGPAGPYKLDIAMIEQKLVLAVRTNGAAEADATFILSLNPFRRVVKDYFLICES
FT                   YFEAIKTAPPSRIEALDMARRALHDDGSQLLQERLEGKVRMDTATSRRLFTLLCALHWR
FT                   G"
FT   gene            complement(622622..623923)
FT                   /locus_tag="Rvan_0548"
FT   CDS_pept        complement(622622..623923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0548"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   sme:SMc02307 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69829"
FT                   /db_xref="GOA:E3HYT8"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT8"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADP69829.1"
FT                   /translation="MTLYLRSTEPDFQQRFDALVHGRRDQPHDVQDAVRSMIAAVRERG
FT                   DAALIEFTERFDHVDLAETGLAIAPEELEAAWNGLAPDLKAALQTAYERIEKHHRRQIP
FT                   ADDRYADAIGAELGHRWTPLDSVGLYVPGGKASYPSSVLMNAVPAKVAGVPRLVMVVPT
FT                   PKGEVNPAVLAAAHLAGIREVYRIGGAQAVAALAYGTETIKPVVKIVGPGNAWVAEAKR
FT                   QVFGVVGIDMIAGPSEVVAVADARADPVWLAADLLAQAEHDEAAQSILITDSPALAEAT
FT                   AKAVDAQLAIMPRGAIAAKSWADHGAVLLVSDLAKEAPALVNALAPEHLELACDEAEAM
FT                   LPAIRNAGAIFIGHFTPEAVGDYVGGSNHVLPTSRAARFSSGLGVLDYMKRTSLLKLSR
FT                   ASLAVLAAPTMTLAEAEGLFGHRQSVAVRTNGSD"
FT   gene            complement(624073..624579)
FT                   /locus_tag="Rvan_0549"
FT   CDS_pept        complement(624073..624579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_2639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69830"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYT9"
FT                   /inference="similar to AA sequence:KEGG:M446_2639"
FT                   /protein_id="ADP69830.1"
FT                   /translation="MGSFPKAPLKLIALDEDDLKVISAHLQDAVIRMADMAYVPSEHRF
FT                   AAILNRFDWLSAVEGEGDPAALHRCRCALRFERVKRAQVLNIRPGETTDFAELLAVTYE
FT                   ESEPPGGFITLYFAGGGALRLHVECIEAEMRDLGAAWKTAIKPEHALGDAEPGSPAAEL
FT                   VRDSS"
FT   gene            complement(624610..625899)
FT                   /locus_tag="Rvan_0550"
FT   CDS_pept        complement(624610..625899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0550"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: atc:AGR_C_953 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69831"
FT                   /db_xref="GOA:E3HYU0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU0"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADP69831.1"
FT                   /translation="MDRIRIVGGRHLNGTIPISGAKNAALPLMIASLLTPETVTLKNVP
FT                   NLADVSLLIRILRNHGTDAAFDGKRANGHVHQGDTIHFTARDIVDTTAPYDLVRRMRAS
FT                   FWVLGPLLAREGKARVSLPGGCAIGTRPVDLHLTGLQALGADIKLDGGYVVASAPGGLK
FT                   GGVVRFPKISVGATHNVLMAATLAKGEVVIENAACEPEVVDVAACLSKMGAKIEGAGTP
FT                   TIHIQGVDELEGATHTVLPDRIETGTYAMAVAAAGGDVTLEGARGDLLPGVLDLLRNAG
FT                   VEIAETNRGIRVTRNGAALRPVTVETEPFPGFPTDLQAQLMALMCRADGISEIRETIFE
FT                   NRFMHVSELTRLGADIEVKGDMARVKGVPRLHGAEVMATDLRASVSLVIAGLMAEGETM
FT                   VNRVYHLDRGFERLEEKLGSCGAEIERLHS"
FT   gene            complement(626001..626159)
FT                   /locus_tag="Rvan_0551"
FT   CDS_pept        complement(626001..626159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69832"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU1"
FT                   /inference="similar to AA sequence:KEGG:Meso_0193"
FT                   /protein_id="ADP69832.1"
FT                   /translation="MAKEKDPAGAQLAAKTSRDEDKKKRLAAALRRNIARRKDTKQTDS
FT                   GGNPDTH"
FT   gene            complement(626288..627895)
FT                   /locus_tag="Rvan_0552"
FT   CDS_pept        complement(626288..627895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0552"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="KEGG: rfr:Rfer_2818 propionyl-CoA carboxylase; PFAM:
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69833"
FT                   /db_xref="GOA:E3HYU2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU2"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADP69833.1"
FT                   /translation="MPPFASKIAPGSDAFRANAAAMLAKVEAFRAVERAVIAHSAKAAD
FT                   KFAARGQLLPRERVTRLLDPGTPFLELSTLAGLGMHDDDGEARAMGGGSVIGIGVVSGK
FT                   RVLVSASDSAIKGGTVSPMGLRKALRAQEIALENKLPLIYLVESGGANLLYQAEMFVEG
FT                   GRSFANQARLSAAGIPQIAVVHGSSTAGGAYLPGLSDYVILVRDRSKIFLAGPPLVKAA
FT                   IGEDTTDEALGGTNLHASVTGLGEFVARDDAHAIQLARDLLAKLKWDRAPARAKAAPPK
FT                   YDAEEILGLVPVSEREPYDVREIIARLVDGSDFLDFKRDYGAEIVCGFAAINGFEVGIL
FT                   GNNGAIQPDGSTKAAQFMQACDQTGTPLVFLQNTTGYMVGSAAERGGAIKHGSKMIQAV
FT                   ANARVPKFTILVGGSYGAGNYGMCGRGFDPRFIFSWPNARVAVMGGAQAAKVMEMITRA
FT                   KFEKAGGVNEPVLKQMAQAIEAQLDRESTALYATARLWDDGIIDPCDTRAVLSLCLSLA
FT                   AEADARKLHPNAFGVARL"
FT   gene            complement(627895..628782)
FT                   /locus_tag="Rvan_0553"
FT   CDS_pept        complement(627895..628782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0553"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pfo:Pfl01_3946 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69834"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP69834.1"
FT                   /translation="MSEAGSYRSIFRPGLFAGQVHIVTGGGTGIGRCTAHELASLGATV
FT                   VLVGRKEDRLAATAAEIAEDGGTASHAVCDIRDEDAVRTLVSGIVARHGRIHGLVNNAG
FT                   RQFPAPLMAIPKKGFDAVVATNLTGGFLMMREVFTQSMRAHGGAIVNMAADMWNGMPGM
FT                   GHSGAARAGMVNLTKTAAFEWGFAGVRVNAVAPGWIASSGMDRYEGPVKALIPKLKDHV
FT                   PLRRLGTEAEVSAAICFLLSEGAAFINGTTIQIDGGAPLGNPLFDMGTSPPSPEFNGFH
FT                   RAAKPKVLDSKDES"
FT   gene            628961..629575
FT                   /locus_tag="Rvan_0554"
FT   CDS_pept        628961..629575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpb:Cphamn1_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69835"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU4"
FT                   /inference="similar to AA sequence:KEGG:Cphamn1_0145"
FT                   /protein_id="ADP69835.1"
FT                   /translation="MTVTDILLVCVTLLSPLIAVQVQKWIERSTERNRSRQQLFKTLMA
FT                   TRATRLATEHIQALNMISLEFGARPKVSNVIAKWRLYADHLNPPAPDTSQAWQAKADDL
FT                   FLDLLESMSKSLGYDFDKVEIRRGIYYPNGQLKNDLDREIFNTEILKIVKGEKPLPISI
FT                   SATQEAHEQQKIIQERMAQCFSEDGAIKIHMDLHRKQDAKR"
FT   gene            629668..629967
FT                   /locus_tag="Rvan_0555"
FT   CDS_pept        629668..629967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0555"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   hoh:Hoch_3088 sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69836"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU5"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADP69836.1"
FT                   /translation="MDLNEVADALTKRVGSKSPLGGSVKFDLGEAGCLYIDGTGAANTV
FT                   AVDKNDPAKCTISMSAGDFSDLIHGRLQPTSAFMQGKMRVDGDMGLAMKLGQIV"
FT   gene            630050..630544
FT                   /locus_tag="Rvan_0556"
FT   CDS_pept        630050..630544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0556"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: rfr:Rfer_2820 MerR family transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69837"
FT                   /db_xref="GOA:E3HYU6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU6"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ADP69837.1"
FT                   /translation="MTAVRQRAKADSSESEKLYGIAELAAELGITARAIRFYEAKELLA
FT                   PVRANGGRVYTRRDRARLKLILRAKSIGFSLAEVQQFLELYGSRGEGRPLQVSFLADRS
FT                   AAMIAELEQKQADIVKTLEELRDIHAQCLRFLAEDGTPCKTAGDGEAADAPHKKSRRTA
FT                   G"
FT   gene            630625..631836
FT                   /locus_tag="Rvan_0557"
FT   CDS_pept        630625..631836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0557"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   rce:RC1_1744 3-ketoacyl-CoA thiolase; PFAM: Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69838"
FT                   /db_xref="GOA:E3HYU7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3HYU7"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP69838.1"
FT                   /translation="MVDAYVFDAVRTPRGKGKKDGALHEVTPVKLAAQMLDAVQERNPG
FT                   LDTRDVEDVILGCVSPVGEQGADIARSASLISGFDESVPGVQVNRFCASGLEAINMAAA
FT                   KVMSGQSPFIVGGGVESMSRVPMASDGGAWPIDPAVAFSTYFVPQGISADLIATKWGYS
FT                   RDDLDAYSVESHKRATQSWAEGRFAKSIVPVKDILGITLLDKDEMIRPDASMQSLGALK
FT                   PSFADMGKNYGFDGVALQKYPEIERIDHVHTPGNSSGIVDGAAVALIGSKEAGEKAGIK
FT                   PRARIRSFASIGSEPTIMLTGPSFAAERALAKAGMTKADIDLWELNEAFASVVLRFRDL
FT                   LDIADDKLNVNGGAIAMGHPLGATGAMVLGTLLDEMERRGAATGLVTLCIGAGMGTATI
FT                   LELV"
FT   gene            631870..634044
FT                   /locus_tag="Rvan_0558"
FT   CDS_pept        631870..634044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0558"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain-containing protein; KEGG: rce:RC1_1743
FT                   fatty acid oxidation complex alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69839"
FT                   /db_xref="GOA:E3HZ93"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ93"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADP69839.1"
FT                   /translation="MSSISYQVDADGIATLTIDQPGKSMNVISPEFTEELSEAIERAAA
FT                   DSSVKGIVITSGKSSFVAGADLIGMSGMIEHARNAPAAEALKVSSRLTEVLRRLETIGK
FT                   PVATAINGTALGGGFEIALATHYRVAADDESIKIGQPEVQVGLLPGAGGTQRIPRLIGI
FT                   MASAPLLLEGKHLSPQQAKSSGLIHDVVPAAELLAKAKAWLLSPQAKSVQPWDERGFKV
FT                   PGGAGGMHPAAAQLFMAANAMTRDKTLGNYPAAQAILSAVYEGTQVPIDLGLKIEAKYF
FT                   LSLLRGPVAPAMIRTLFVNKGRADKLVRRPQGVPKAKFKKIGMLGAGMMGAAIAYVAAS
FT                   NGIEVVLLDRDVEAAERGKGYARKLVEKAVSRRKTTEADGQGLLARIHATADYADLADV
FT                   DYIIEAVFEDRAIKADVTKKVEAVIRPDVIFGSNTSTIPITSLAEASERPEKFIGIHFF
FT                   SPAEKMPLVEIIRGKKTSDEALAVTLDFVQAIRKTPIVVNDGRGFFTSRFCMNYIGEGE
FT                   IMLTEGIPAALVENAGKLAGMPVGPLALADETAIDLGWKIHKAAETDLGDAYTPSAAIG
FT                   VMEAMYVKNGRAGRKNGKGFYEYPEGGPKTLWAGLADLFPVKPESEWPSIDDLKKRLLF
FT                   AQALDAVRTMEDGVLTDPEDGDVGGIFGLGFAPYTGGPLSMLDGIGIANAVAECERLAA
FT                   RYGERFSPPKLLRDMAAEGRTFYPAAKAAA"
FT   gene            complement(634237..635289)
FT                   /locus_tag="Rvan_0559"
FT   CDS_pept        complement(634237..635289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0559"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: mrd:Mrad2831_4738 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69840"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ94"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADP69840.1"
FT                   /translation="MTKPHLILAALCLAGAAGMSVRAQDAGAAPDAAKEPGSVAAQAQA
FT                   PETPPAKAENPGSLAVATAEGGVLGKIKAAGAITLGYREAAAPFSYAADQNAAGFAVDL
FT                   CGLVADKVKEKLALPELKVVWRATTDADRAALASKRDIDIDCAATPDKATLDDAAEFSA
FT                   PVYASELRFVVPSKLRPEAEGFRRRRADFKTPAAIDDLKGKTVVLLQGSPGLPYVLGQS
FT                   VERYLGISVAYAKTPAEAFKLVETGAAAAYLDDDAVLIGLKAGAKSPDAFLLLGTGKPG
FT                   ADYALVLPKDEPLKDLADAAIRDAVKSGEYEKLYAKWFENPIPPKNVTLAYPMTERLRQ
FT                   FVKDPAAATE"
FT   sig_peptide     complement(635218..635289)
FT                   /locus_tag="Rvan_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            635891..636622
FT                   /locus_tag="Rvan_0560"
FT   CDS_pept        635891..636622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0560"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bbt:BBta_0946
FT                   putative outer membrane protein precursor of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69841"
FT                   /db_xref="GOA:E3HZ95"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ95"
FT                   /inference="protein motif:PFAM:PF03922"
FT                   /protein_id="ADP69841.1"
FT                   /translation="MKRFAYAAIAGVMAMGGANAADLYGAGGGYKDAPVVVESWTNPGD
FT                   IFVRARGLAVIPNEKTKDWTVNGSSSGTAGFGATISTSGIPELDVTYFLTKNIAVEAIA
FT                   GVTPHTVDSNSVIGAGKIADVWLLPPTVTLQYHLDTGTAFKPYIGAGVNYTVFFGVDEG
FT                   SAFKKVKFDNNWGFALQAGFDYKLAGNWFLNFDFKYLFLDTDVTATLQNNAVVRTKADI
FT                   DPIIVGAGIGYKFGSSYVPLK"
FT   sig_peptide     635891..635953
FT                   /locus_tag="Rvan_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(636720..637862)
FT                   /locus_tag="Rvan_0561"
FT   CDS_pept        complement(636720..637862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0561"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   bid:Bind_0211 serine O-acetyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69842"
FT                   /db_xref="GOA:E3HZ96"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ96"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADP69842.1"
FT                   /translation="MGQKTGWCVRWRQGQLKLLPPCWTTAQRHFPIRRPNAILIFSIKI
FT                   ARQYILLLLGQSQQIFTIYFAKSAVVIKYIFARETAGYNEPAIRRRCFVNAPIDEKASV
FT                   LLRTGAPLPAEDAVWTVLQAEAEQARSGEAALAPLYDSILGAPTFESALIDTLVARLGH
FT                   NSIAAPTLRAKFRTAAEADPAIGAAGRADLKAVVERDPASGRLLEPFLFFKGFAAIQTH
FT                   RFAHWMWANGRPDLARYLQSRSSEVFQTDIHPGAEFGRGLFLDHATGFVAGETVVIEDD
FT                   VSILHGVTLGGTGNQKTDRHPTVRTGVLVGAGAIILGDIEIGAFSKIASGSFVTQSVPP
FT                   RCTAVGVPARIIEGAGSTNPAQSMDQHLALGTYESFTYVI"
FT   gene            638086..638442
FT                   /locus_tag="Rvan_0562"
FT   CDS_pept        638086..638442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0562"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="KEGG: bra:BRADO3457 putative Zn-ribbon-containing
FT                   protein involved in phosphonate metabolism, PhnA-like
FT                   protein; TIGRFAM: alkylphosphonate utilization operon
FT                   protein PhnA; PFAM: PhnA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69843"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ97"
FT                   /inference="protein motif:TFAM:TIGR00686"
FT                   /protein_id="ADP69843.1"
FT                   /translation="MTATPRCPKCQSENAYFDGNLWVCPECFHEWSGDAAADSAPAEEN
FT                   AGVRDSNGTALADGDSVTVIKELKVKGASGAIKVGTKVKNIRLIPDATDGHNIACKIDG
FT                   IGALNLKSEFVRKA"
FT   gene            638493..639203
FT                   /locus_tag="Rvan_0563"
FT   CDS_pept        638493..639203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_2322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69844"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ98"
FT                   /inference="similar to AA sequence:KEGG:Mext_2322"
FT                   /protein_id="ADP69844.1"
FT                   /translation="MWFRRIFRKPTPEMGGAEALPNVLPAAATARREVVPEDGRYIEAA
FT                   MTELVKVGLRLAPAARDDPARVAASIAYDCRGSSFAGEPGLGHWALFALAGHADGPRPF
FT                   ENAIRVDDHCYDVAEASDYAAMISNIAAMAGDKWPVKSVEARNASDPHKRIEFGKPVAI
FT                   TIHADPEIPPFELAHGKDFDWSVIFRLNERLPGDVEERFAIFLDGDATIVFLSPEDIGR
FT                   LDAMTGWEFFYLDS"
FT   gene            639292..639348
FT                   /pseudo
FT                   /locus_tag="Rvan_0564"
FT   gene            complement(639397..639473)
FT                   /locus_tag="Rvan_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(639397..639473)
FT                   /locus_tag="Rvan_R0006"
FT                   /product="tRNA-Asp"
FT   gene            complement(639625..639846)
FT                   /locus_tag="Rvan_0565"
FT   CDS_pept        complement(639625..639846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0565"
FT                   /product="ribosomal protein L31"
FT                   /note="KEGG: mmr:Mmar10_2581 50S ribosomal protein L31P;
FT                   TIGRFAM: ribosomal protein L31; PFAM: ribosomal protein
FT                   L31"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69845"
FT                   /db_xref="GOA:E3HZ99"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZ99"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ADP69845.1"
FT                   /translation="MKKDIHPDYHKITVVMTNGETFETFSTYGQEGGKLNLDIDPNSHP
FT                   AWTGGNQQLLDRGGRVSKFKKKFEGFLK"
FT   gene            640005..641867
FT                   /locus_tag="Rvan_0566"
FT   CDS_pept        640005..641867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0566"
FT                   /product="lipid A ABC exporter family, fused ATPase and
FT                   inner membrane subunits"
FT                   /note="TIGRFAM: lipid A ABC exporter family, fused ATPase
FT                   and inner membrane subunits; PFAM: ABC transporter related;
FT                   ABC transporter transmembrane region; KEGG: oca:OCAR_7320
FT                   ABC transporter, permease/ATP-binding protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69846"
FT                   /db_xref="GOA:E3HZA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA0"
FT                   /inference="protein motif:TFAM:TIGR02204"
FT                   /protein_id="ADP69846.1"
FT                   /translation="MTLHTLADRRSNLPAPAGENRKPGEIAAREARSRANLKPLQLLRP
FT                   YVLKYKAVAIAALIALIVSSSATLMLPFAVREMIDRGFSPEKQSLINIYFAGLFAVGAL
FT                   LGISSAIRFYCVSWLGERVIADVRADVFRHLSRLSAAFYEKTHSGEIMSRLNADTTQIK
FT                   AAVSTSVSQVLRNAVMFIGALVLMVFTSLKLSLLVLVVIPVIIVPLVLYGRTVRRYSRI
FT                   AQDEVAASSSFASENLSAIRTMQAFTSETLVANRYAAAVSRSFDAAVSRTKRRAIMTAS
FT                   AIFLIFGAIVGVLWYGAHDVMEGVITGGILAQFVLYAVIAAACLSEFSEIFGEMQQAAG
FT                   AAERLSELMAIPAEIRSPADPRPFPDHAKGEVTFEAVSFTYPLRPDHPALHNVSFIARP
FT                   GERVAIVGPSGSGKTTIFNLILRFYDAHQGRILVDRVPVEKADLTELRKRISLVSQDTI
FT                   IFAETVIDNIRYGSPDASDEDVRAAAKAALANTFIEQLPEGYNTLLGERGVVLSGGQRQ
FT                   RIAIARAILKNAPILLLDEATSALDQESEKLVQTALERVMRGRTTLVIAHRLATVINAD
FT                   RILVIDGGELVEEGTHAQLLGAGGVYARLAGLQLEGHQEGALAS"
FT   gene            642211..644091
FT                   /locus_tag="Rvan_0567"
FT   CDS_pept        642211..644091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0567"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.1.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: bid:Bind_1231 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69847"
FT                   /db_xref="GOA:E3HZA1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA1"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADP69847.1"
FT                   /translation="MDKKNKLNLTYMAVALGLLLLFQVYWANYNEIEPVPYSRYQQLLR
FT                   ENQLTNVVVGPSQIRGEFKTPQDGKKYFATTRVDPAVATELEKQGIEFSGSSGQNIFRD
FT                   IASWVLPIFIFFAIWAFFIRRMGDKQGIGGLMSVGKSRAKIYVEKVTGVGFEDVAGADE
FT                   AKGELMEIVNFLKDPDHYGRLGARVPKGILLVGPPGIGKTLLARAVAGEAGVPFFSISG
FT                   SEFVEMFVGVGAARVRDLFEQARKMKPCIIFIDELDSLGRSRAAGMAGGGGNDEKEQTL
FT                   NQLLAELDGFDPREGIVLLAATNRPEILDPALTRAGRFDRQIALDRPDKNARIAILGVH
FT                   IKRIKAAKDVDLEQVAGITPGFSGADLANLVNEAALGATRRGAEHVTMDDFTRAVERLV
FT                   AGIEKRSRVLSKKEREVVAHHEMGHALVASALPGVDPVHKVSIIPRGIGALGYTMQRPT
FT                   EDRFVIQRGELINRMTVLMGGRAAEEIIFGEISTGAADDIDRATDIARQMVTRFGMIEG
FT                   LGQRVYEPQRQAFLGEGLIGKPKDYSDQTNREIDLAVKKLVDDAYANAKKTLNGRRKDL
FT                   DEGTALLLAKETITPDDFPPLVNIAPGQKLDGSSPDEVLAPEAEHAPTLS"
FT   gene            complement(644142..647258)
FT                   /locus_tag="Rvan_0568"
FT   CDS_pept        complement(644142..647258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0568"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; ribosomal
FT                   protein S19/S15; KEGG: bid:Bind_2924 acriflavin resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69848"
FT                   /db_xref="GOA:E3HZA2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA2"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADP69848.1"
FT                   /translation="MNISALFIRRPIGTILLSIGLFLAGIVSYSALPVASLPNVDMPAV
FT                   RVGANLPGADPETVAATIAAPLERRIGEIAGVKELTSTSSLGSTSIQVQFDLSRNADDA
FT                   ARDVQAAINAAQSDLPSTLTRRPTIRKANAAAAPVMILAMTSPIRRPTDLYDLGDLIAS
FT                   TRISQVNGIAEVMIGGAQTPAVRVVTDPGALKSRGLSAEDVRTAITQANSLVPIGVLDG
FT                   AEKSTIVTVNGQITKAADYETLVVKVRNGDVVRIADVAQVSNSTSNRLSAGFFNRENAV
FT                   ILIIFKTSDANVIETIDNVYALLPELQRLLPADVKLTVLNDRTQTIRASIADIQHTLIV
FT                   CVVLVMLVVLLFLRRIVPTLAAGAAVPLSLSGTLALMWASGYSLDNISLLALTISVGFV
FT                   VDDAIVVIENCYRNMEAGMKPMQAALVGSRQIGFTIVSISLSLIAAFIPLLFMGGMIGR
FT                   LFGEFAWTLTYAILISAIVSLTLTPMVCARFIRRLPRPRETWLDRRVEPFFEWLLARYD
FT                   RSLTYGLRHRWLMLVVTFASLAFTIQLFIVIPKGLIPSGDTGLIMGFARASAETSFEAI
FT                   LETQNRVTEILTADPAVEGVATSIAAGGGPGSSQSNEARFFVSLKPIGERKDSAAAVIA
FT                   RLRQKFAAIKGVDIFMFPGQEIMFGGRQSRSQYQVTLWGPDLKEIAEWLPKAQAAMKRI
FT                   PGVIDVNSDREAGGPQATVTIDRVKAAKFGVSVADVNSALNNAFSQRAVSTVYTLRTQY
FT                   NVILEADPAIQRSLQGLDSIYVKGSASQQVPLSSVATIAMTQTPLSVRHTGQFPSATVS
FT                   FNLSPGVALGPVIPKILEAGRDLGLPEQLHFELSGETLAQQEQSSSTLLLIVAALVTVY
FT                   IVLGVLYEDLVHPLTILSTLPSAGFGALLVMHAAGETLSIISLIGIILLIGLVKKNGIM
FT                   LVDFALDAERRLGLSSEEAIRRACIERFRPILMTTLAAMFGALPLVFASGPGSELRTPL
FT                   GLTIVGGLAVSQLLTIYTTPVIYLWLDKLRWRKRRAAREAKAAAQPQAT"
FT   gene            complement(647255..650767)
FT                   /locus_tag="Rvan_0569"
FT   CDS_pept        complement(647255..650767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0569"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bja:blr4457 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69849"
FT                   /db_xref="GOA:E3HZA3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA3"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADP69849.1"
FT                   /translation="MSGPTAEEPGGVGAQGADAAGEDTYSGISAPFIARPIATSLLAVA
FT                   ILLASLLAYSLLPISSLPQVDFPVVQVTTRLPGANADTMARLVTAPLERQLGQIPSLEN
FT                   MSSTSSEGLSQITLRFMLSRDINAAGQDVQSAISAAGGSLPQNLPYPPVYAKVNPSDPP
FT                   IVTIALTSQSVSLERLSDFADTLLAPRLSQVAGVGRVTVQGNIRPAIRIQANPLQLASL
FT                   GIALETVRSAIANANVTGSKGLISGPEKSYIVGANDQLETAGAYEDVVVAYRNKAPVLL
FT                   RDVATVVAGLENERVAARYNGTPAVVIDVQRQPSANIVGTVDELKKILPKLVDALPAGV
FT                   KLDIVADRTGTIRASVEEVQFTLVLSVALVIMVVLLFLRTLSATIVAGITLPLSLMAAF
FT                   GVMYYAGFSLNNLSLMALTIATGFVVDDAIVMIENVMRYIEKGEKPLVAAYKGAGEIGF
FT                   TIVSLTLSLIAVFIPLLFMEGIVGRLFREFALTLTAAVVTSMIVALTLTPMMAARLLRA
FT                   PRHGETAPWYSRAFEAPFNALLSVYRVTLDWALNARRFMLLVAAATFVLTVVLYIAIPK
FT                   GFLPDQDTGFLTAETEAAPGVSFERINALQAEVERIIRRDPDVLGVVSVIGVGTTNATP
FT                   NAAHLALTLKPKTERKATATEILQRLTEATADFPGLRTTFQIVQDIQIGTARSRTQYQY
FT                   VIVGLDREGFSGWAQKLEAELSRDRRLIHVASDLQEDGNAVLIKTDRVIAGRLGVTMQA
FT                   LNDTLYDAFGQRQISTIYGQSNQYRVVLEVAPAFQTDTAALGSIYVPGTAISNSTSGNA
FT                   STGNATASGATNSSITATSASGTGVGSQVPLSSFSVIERATAPLSVNHVQQYPAATISF
FT                   DVAPGFSLDAAVQAVTDAQSRIALPSSIVGSYTGAAAEFNASLANQPLLILAAVVTIYI
FT                   ILGVLYESFIHPFTILTTLPSAGIGALLALEILGMEFSFIALIGIILLMGIVKKNAIIM
FT                   IDFALDAERTRGLAPFDAIREACLLRFRPIMMTTVAALLGALPLVIGSGPGSELRMPLG
FT                   VTIIGGLLLSQLLTLYTTPVIYLAMDGLKRRIERRFGIDEPNYPPPALRPEPGLPDPGP
FT                   RGGSPRGTGGGGAAGLLPIFGTPSLPMLPPRADWLLLPSPEGNAALPSPNEPLALPPPD
FT                   KPAS"
FT   gene            complement(650764..652023)
FT                   /locus_tag="Rvan_0570"
FT   CDS_pept        complement(650764..652023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0570"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: ara:Arad_4549 secretion protein HlyD; TIGRFAM:
FT                   efflux transporter, RND family, MFP subunit; PFAM:
FT                   secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69850"
FT                   /db_xref="GOA:E3HZA4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA4"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADP69850.1"
FT                   /translation="MKRLLPWLIFILITAFLAIFVYSDRIFGTSGRGGDAAGMGGGPPG
FT                   GFRRGDQAVSAETKPARLENVPVWLSGVGTVQAFNTATVRAQVSGRLIEVNYHEGQDVK
FT                   AGDVLARIDPVLYQAAYDEAVAKKAQDEALLANARRDAARYSSLVGQNYSSQLETDAAK
FT                   SKVQQYEAQVKQDQAAIDTARANLDYATIRAPIDGRTGIRQLDTGNLVTSGDSTGIVVI
FT                   TQLRPISVVFTLPESAVSDILDAQAKAALPLQAQAGGRVLGEGSVAVIDNQIDQTTGTV
FT                   KIKGTFPNDENRLWPGQFVNVKLRLKTLENAVVVPSAAVQQGANGAFVYRVTPEKTASI
FT                   VSVKVVQEGEKDAVIGEGIAAGDVVVTSGFSNLQDGSKLKLEGNEASGTAPAQNSGERK
FT                   NGERRGKGADAAKPEGAARP"
FT   gene            complement(652020..653441)
FT                   /pseudo
FT                   /locus_tag="Rvan_0571"
FT   gene            complement(653729..654349)
FT                   /locus_tag="Rvan_0572"
FT   CDS_pept        complement(653729..654349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0572"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   azc:AZC_1094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69851"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA5"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADP69851.1"
FT                   /translation="MMAIFLATASNALFMQERARLFDPNGLPSTSVSVTQFPHDKTSPI
FT                   APAVSGGGIQQVSLPAAKGPRMHVALYRELGQRGYSEQLRQGDNGLRLAVLAYQFDNAM
FT                   PLTGEPTNELLKRVLFDPNQGPHGAFADRAELNAKLVIETQKALLGLGFFRGTFSGRLD
FT                   VWTSNAIKDFERHRGLPVTGRLTDQTLLELIAFSGQPMLPAAG"
FT   gene            654615..655031
FT                   /locus_tag="Rvan_0573"
FT   CDS_pept        654615..655031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69852"
FT                   /db_xref="InterPro:IPR035220"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA6"
FT                   /inference="similar to AA sequence:KEGG:AZC_1092"
FT                   /protein_id="ADP69852.1"
FT                   /translation="MFFMLRLVFWLALVCLLLPGVGGDAGRHISSVEQTATDVKGFCQR
FT                   NAAVCEDARATMTLVLAKLKSGAQAAQAWLDEQKRQNPGLQGPVREAKIPSMDQSLPAD
FT                   APRPVVKWHDNLRAADRDIPWQEPQSASPGPRRL"
FT   sig_peptide     654615..654683
FT                   /locus_tag="Rvan_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.573 at
FT                   residue 23"
FT   gene            655168..655668
FT                   /locus_tag="Rvan_0574"
FT   CDS_pept        655168..655668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msl:Msil_3525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69853"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA7"
FT                   /inference="similar to AA sequence:KEGG:Msil_3525"
FT                   /protein_id="ADP69853.1"
FT                   /translation="MSDAKIISIAREDLISFGDVPDATNALLQRGVLAYRKDPEAAEVL
FT                   FQEALALDPAQLPVYYCLYKIYAYRGLLDNALAVATVGLNEAARQAGWSDDFRAWERAA
FT                   VSSGGPDHFALYTLKALAFIHLRRGETSAAQACLDKLAELAPNREVDFTVVAALAEKVA
FT                   GGA"
FT   gene            complement(655688..656452)
FT                   /locus_tag="Rvan_0575"
FT   CDS_pept        complement(655688..656452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0575"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="PFAM: protein of unknown function DUF1007; KEGG:
FT                   rpe:RPE_4805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69854"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA8"
FT                   /inference="protein motif:PFAM:PF06226"
FT                   /protein_id="ADP69854.1"
FT                   /translation="MTPLWIDDAYRELEYLKKPEFRAVPQALAFESKTMIQRWFSCLGL
FT                   ILCALAAQTALGRAHPHVWVTMHTEVQLGQNGEVVALRHKWTFDQFYTSFAVEGMDTNG
FT                   DGVYSEEELKPLAQTNVEALKEFEYFTYAFVGKTKAALKEPTTDYRLEYKDDLLTLYFT
FT                   LPLEKPVPRDELKDFNFSIYDPGMYVSLTFSKDDPVKLAAPAGATPSPCTPHVGDRAVG
FT                   QEKKLSQLGENIDPASNLGSQFAERVTFRCTP"
FT   gene            656547..657149
FT                   /locus_tag="Rvan_0576"
FT   CDS_pept        656547..657149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_1739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69855"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZA9"
FT                   /inference="similar to AA sequence:KEGG:RD1_1739"
FT                   /protein_id="ADP69855.1"
FT                   /translation="MKILTTIPLAALISACALTASQAEEHRQLGAHVHGHGKLNIALEK
FT                   NILSIELEAPGADIAGFEHEAATKEDKAKLEKAKATLAKGLELFTPASAAGCKQTSAKV
FT                   ALEAEHEHEGEGKEEHEHAAEAKDHDHEKGEHHHSEFHVEYAFECAAPEKIASLSFGYF
FT                   KAFPNAQELDVTVITPKGQSSYEVTKDKPKLELKGVM"
FT   sig_peptide     656547..656618
FT                   /locus_tag="Rvan_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.531 at
FT                   residue 24"
FT   gene            657146..657904
FT                   /locus_tag="Rvan_0577"
FT   CDS_pept        657146..657904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0577"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tmz:Tmz1t_3494 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69856"
FT                   /db_xref="GOA:E3HZB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZB0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP69856.1"
FT                   /translation="MIASPLPSTEDKPRRHEGGADIVRIGGVQFTWPGRNPFTLAIDGF
FT                   SLAKGERLLLIGPSGSGKSTFLSLLAGIAKPDAGKIDVLGCDIARLDGAARDRFRAEHY
FT                   GIIFQMFNLLPYASVIDNVLLPLSFSPSRKKRAEARGGGRTEAARLLGNLGIEPSLIES
FT                   GSAASLSVGQQQRVAAARALIGSPEIVIADEPTSSLDRNRQQAFLDLLFAEVEAAGATL
FT                   IMVSHDESLAGRFSRVADLAEIAQASRGGR"
FT   gene            657904..659163
FT                   /locus_tag="Rvan_0578"
FT   CDS_pept        657904..659163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0578"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rde:RD1_1737 peptide ABC transporter, permease component,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69857"
FT                   /db_xref="GOA:E3HZB1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZB1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADP69857.1"
FT                   /translation="MIIVRLALQSLANRWLTACLTILSIALSVMLLLGVEKVRTGARQS
FT                   FADTISGTDLIVGARSGNLNLLLYSVFRIGNATNNITWKTYQDIRQSPDIAWIVPISLG
FT                   DSHRGFRVMGTVPEYFTHYHYRRGQPLTFAAGAPFSDLFDAVIGADVAAQLGYRVGDKI
FT                   VVAHGAGAVSFLEHDDKPFRVSGILAKTGTPVDRTVHVSLGAIEAIHVDWQSGARDPTK
FT                   AVSADDVRQMDLTPKAITAAFVGLKSRLAAFRVQREINNYRQEPLSAILPGATLQELWG
FT                   LVGTAETALSAVSGMVVITALLGMVTMILTTLNERRREMAILRSVGARPSTILSLLVVE
FT                   AGVLTFLGVLAGTLLLYGALMGLQPYIDRTYGLHVAVDPPSADQLKILGGIVAAGFLAG
FT                   LLPALRAYRLSLADGMTVRT"
FT   gene            659183..659758
FT                   /locus_tag="Rvan_0579"
FT   CDS_pept        659183..659758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69858"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZB2"
FT                   /inference="similar to AA sequence:KEGG:IL2266"
FT                   /protein_id="ADP69858.1"
FT                   /translation="MKRLAAACVALLLTTGFAPIENEPPMEIGWGRLVPPAPVTPPNVK
FT                   SKSFLSGATPSPALGGSEPPPPLLPPGEDRPWLSERRNQPGAGAPVPVVQELDGKRVKI
FT                   GGYVVPLDFDATNVKEFLLVPFIGACIHVPPPPPNQIIYVKVENGFDVAGSFDPVWVTG
FT                   RIAVASQFTGLAETGYTIDADTVDTRKE"
FT   sig_peptide     659183..659248
FT                   /locus_tag="Rvan_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.539 at
FT                   residue 22"
FT   gene            complement(659779..661026)
FT                   /locus_tag="Rvan_0580"
FT   CDS_pept        complement(659779..661026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0580"
FT                   /product="NnrS family protein"
FT                   /note="PFAM: NnrS family protein; KEGG: rhi:NGR_c09940
FT                   putative membrane protein, NnrS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69859"
FT                   /db_xref="GOA:E3HZB3"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZB3"
FT                   /inference="protein motif:PFAM:PF05940"
FT                   /protein_id="ADP69859.1"
FT                   /translation="MTAAMTGTDPNTATSPRQPETASPRGGIPRGLARTGPILFSYGFR
FT                   PFFLGAGLWAFASMALWIAALAGHLPIGGSYGATYWHAHELLFGFSTAALAGFLLTAVP
FT                   NWTGRLPVSGWPLAGLFAIWCAGRAAMLAPDVLGLTASAAIDALFLPALAFIVARELIA
FT                   GKKWGDMKILAAVLFLTGANVWFHAAVLTGGDETIPARLGVSAFTVMVMLVGGRIIPSF
FT                   THNWLNRFGKKPLPMPFGRYDIAAIVVGAVALGFYTAAPSNPLTAIPATLAFAMQSYRL
FT                   YRWRGWKTASDPLLLILHLAYAFVPLAFAAIAAAALDLVPTWSVLHILTVGVISTMIVA
FT                   VMTRASLAHTGRALSASRITQASYAALLLAALSRPLAGFFPEHAMFFYSASGVLWLAAF
FT                   GLFLIQYAPILVGARR"
FT   gene            complement(661170..661865)
FT                   /locus_tag="Rvan_0581"
FT   CDS_pept        complement(661170..661865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0581"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: smd:Smed_6276 CRP/FNR family transcriptional
FT                   regulator; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: cyclic nucleotide-binding; regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69860"
FT                   /db_xref="GOA:E3HZB4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZB4"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADP69860.1"
FT                   /translation="MALDKGVLKGFALFASMTDAQVDLLASRATARRVAEGSAVFEQGE
FT                   PATSFYLLLDGRLKVRQITADGQQIIVRIVNPGDLLGFACALSRPDYPGTATAAVDSVV
FT                   AAWPSTNWNAFVEANPHLAMNAIRTIGQRLDEAHTRIREMSTQEVERRVAHTVLRLVDQ
FT                   AGKADAGGTRVDFPISRRDIAEMTGTTLHTVSRILSAWEAQGLVEGGRRKLVVRDAAKL
FT                   AKLAEAPRD"
FT   gene            complement(661945..662349)
FT                   /locus_tag="Rvan_0582"
FT   CDS_pept        complement(661945..662349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0582"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: xau:Xaut_1527 regulatory protein ArsR; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Rvan_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADP69861"
FT                   /db_xref="GOA:E3HZB5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3HZB5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADP69861.1"
FT                   /translation="MTSEDATLPVDVGDTLQEAADCPPKLDDMMRNARLATDFLKALSH
FT                   ETRLLLLCLLSEGERSVTDLENTLSLRQPTISQQLARLRLDGLVSTRRDGKTVYYRIAD
FT                   EDIKRVIALLYEIFCKGPGQERKSPRDWRE"
FT   gene            662781..663572
FT                   /locus_tag="Rvan_0583"
FT   CDS_pept        662781..663572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rvan_0583"
FT