(data stored in ACNUC7421 zone)

EMBL: CP002293

ID   CP002293; SV 1; circular; genomic DNA; STD; PRO; 3840330 BP.
XX
AC   CP002293; ACVM01000000-ACVM01000108;
XX
PR   Project:PRJNA33183;
XX
DT   07-NOV-2010 (Rel. 106, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Geobacillus sp. Y4.1MC1, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Geobacillus sp. Y4.1MC1
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
XX
RN   [1]
RP   1-3840330
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Zhang X., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G., Brumm P.,
RA   Mead D., Woyke T.;
RT   "Complete sequence of chromosome of Geobacillus sp. Y4.1MC1";
RL   Unpublished.
XX
RN   [2]
RP   1-3840330
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Zhang X., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Ovchinnikova G., Brumm P.,
RA   Mead D., Woyke T.;
RT   ;
RL   Submitted (27-OCT-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1df7f89db3dd94d6d1bb92606ca0979f.
DR   BioSample; SAMN00002562.
DR   EnsemblGenomes-Gn; EBG00001018979.
DR   EnsemblGenomes-Gn; EBG00001018980.
DR   EnsemblGenomes-Gn; EBG00001018981.
DR   EnsemblGenomes-Gn; EBG00001018982.
DR   EnsemblGenomes-Gn; EBG00001018983.
DR   EnsemblGenomes-Gn; EBG00001018984.
DR   EnsemblGenomes-Gn; EBG00001018985.
DR   EnsemblGenomes-Gn; EBG00001018986.
DR   EnsemblGenomes-Gn; EBG00001018987.
DR   EnsemblGenomes-Gn; EBG00001018988.
DR   EnsemblGenomes-Gn; EBG00001018989.
DR   EnsemblGenomes-Gn; EBG00001018990.
DR   EnsemblGenomes-Gn; EBG00001018991.
DR   EnsemblGenomes-Gn; EBG00001018992.
DR   EnsemblGenomes-Gn; EBG00001018993.
DR   EnsemblGenomes-Gn; EBG00001018994.
DR   EnsemblGenomes-Gn; EBG00001018995.
DR   EnsemblGenomes-Gn; EBG00001018996.
DR   EnsemblGenomes-Gn; EBG00001018997.
DR   EnsemblGenomes-Gn; EBG00001018998.
DR   EnsemblGenomes-Gn; EBG00001018999.
DR   EnsemblGenomes-Gn; EBG00001019000.
DR   EnsemblGenomes-Gn; EBG00001019001.
DR   EnsemblGenomes-Gn; EBG00001019002.
DR   EnsemblGenomes-Gn; EBG00001019003.
DR   EnsemblGenomes-Gn; EBG00001019004.
DR   EnsemblGenomes-Gn; EBG00001019005.
DR   EnsemblGenomes-Gn; EBG00001019006.
DR   EnsemblGenomes-Gn; EBG00001019007.
DR   EnsemblGenomes-Gn; EBG00001019008.
DR   EnsemblGenomes-Gn; EBG00001019009.
DR   EnsemblGenomes-Gn; EBG00001019010.
DR   EnsemblGenomes-Gn; EBG00001019011.
DR   EnsemblGenomes-Gn; EBG00001019012.
DR   EnsemblGenomes-Gn; EBG00001019013.
DR   EnsemblGenomes-Gn; EBG00001019014.
DR   EnsemblGenomes-Gn; EBG00001019015.
DR   EnsemblGenomes-Gn; EBG00001019016.
DR   EnsemblGenomes-Gn; EBG00001019017.
DR   EnsemblGenomes-Gn; EBG00001019018.
DR   EnsemblGenomes-Gn; EBG00001019019.
DR   EnsemblGenomes-Gn; EBG00001019020.
DR   EnsemblGenomes-Gn; EBG00001019021.
DR   EnsemblGenomes-Gn; EBG00001019022.
DR   EnsemblGenomes-Gn; EBG00001019023.
DR   EnsemblGenomes-Gn; EBG00001019024.
DR   EnsemblGenomes-Gn; EBG00001019025.
DR   EnsemblGenomes-Gn; EBG00001019026.
DR   EnsemblGenomes-Gn; EBG00001019027.
DR   EnsemblGenomes-Gn; EBG00001019028.
DR   EnsemblGenomes-Gn; EBG00001019029.
DR   EnsemblGenomes-Gn; EBG00001019030.
DR   EnsemblGenomes-Gn; EBG00001019031.
DR   EnsemblGenomes-Gn; EBG00001019032.
DR   EnsemblGenomes-Gn; EBG00001019033.
DR   EnsemblGenomes-Gn; EBG00001019034.
DR   EnsemblGenomes-Gn; EBG00001019035.
DR   EnsemblGenomes-Gn; EBG00001019036.
DR   EnsemblGenomes-Gn; EBG00001019037.
DR   EnsemblGenomes-Gn; EBG00001019038.
DR   EnsemblGenomes-Gn; EBG00001019039.
DR   EnsemblGenomes-Gn; EBG00001019040.
DR   EnsemblGenomes-Gn; EBG00001019041.
DR   EnsemblGenomes-Gn; EBG00001019042.
DR   EnsemblGenomes-Gn; EBG00001019043.
DR   EnsemblGenomes-Gn; EBG00001019044.
DR   EnsemblGenomes-Gn; EBG00001019045.
DR   EnsemblGenomes-Gn; EBG00001019046.
DR   EnsemblGenomes-Gn; EBG00001019047.
DR   EnsemblGenomes-Gn; EBG00001019048.
DR   EnsemblGenomes-Gn; EBG00001019049.
DR   EnsemblGenomes-Gn; EBG00001019050.
DR   EnsemblGenomes-Gn; EBG00001019051.
DR   EnsemblGenomes-Gn; EBG00001019052.
DR   EnsemblGenomes-Gn; EBG00001019053.
DR   EnsemblGenomes-Gn; EBG00001019054.
DR   EnsemblGenomes-Gn; EBG00001019055.
DR   EnsemblGenomes-Gn; EBG00001019056.
DR   EnsemblGenomes-Gn; EBG00001019057.
DR   EnsemblGenomes-Gn; EBG00001019058.
DR   EnsemblGenomes-Gn; EBG00001019059.
DR   EnsemblGenomes-Gn; EBG00001019060.
DR   EnsemblGenomes-Gn; EBG00001019061.
DR   EnsemblGenomes-Gn; EBG00001019062.
DR   EnsemblGenomes-Gn; EBG00001019063.
DR   EnsemblGenomes-Gn; EBG00001019064.
DR   EnsemblGenomes-Gn; EBG00001019065.
DR   EnsemblGenomes-Gn; EBG00001019066.
DR   EnsemblGenomes-Gn; EBG00001019067.
DR   EnsemblGenomes-Gn; EBG00001019068.
DR   EnsemblGenomes-Gn; EBG00001019069.
DR   EnsemblGenomes-Gn; EBG00001019070.
DR   EnsemblGenomes-Gn; EBG00001019071.
DR   EnsemblGenomes-Gn; EBG00001019072.
DR   EnsemblGenomes-Gn; EBG00001019073.
DR   EnsemblGenomes-Gn; EBG00001019074.
DR   EnsemblGenomes-Gn; EBG00001019075.
DR   EnsemblGenomes-Gn; EBG00001019076.
DR   EnsemblGenomes-Gn; EBG00001019077.
DR   EnsemblGenomes-Gn; EBG00001019078.
DR   EnsemblGenomes-Gn; EBG00001019079.
DR   EnsemblGenomes-Gn; EBG00001019080.
DR   EnsemblGenomes-Gn; EBG00001019081.
DR   EnsemblGenomes-Gn; EBG00001019082.
DR   EnsemblGenomes-Gn; EBG00001019083.
DR   EnsemblGenomes-Gn; EBG00001019084.
DR   EnsemblGenomes-Gn; EBG00001019085.
DR   EnsemblGenomes-Gn; EBG00001019086.
DR   EnsemblGenomes-Gn; EBG00001019087.
DR   EnsemblGenomes-Gn; EBG00001019088.
DR   EnsemblGenomes-Gn; EBG00001019089.
DR   EnsemblGenomes-Gn; EBG00001019090.
DR   EnsemblGenomes-Gn; EBG00001019091.
DR   EnsemblGenomes-Gn; EBG00001019092.
DR   EnsemblGenomes-Gn; EBG00001019093.
DR   EnsemblGenomes-Gn; EBG00001019094.
DR   EnsemblGenomes-Gn; EBG00001019095.
DR   EnsemblGenomes-Gn; EBG00001019096.
DR   EnsemblGenomes-Gn; EBG00001019097.
DR   EnsemblGenomes-Gn; EBG00001019098.
DR   EnsemblGenomes-Gn; EBG00001019099.
DR   EnsemblGenomes-Gn; EBG00001019100.
DR   EnsemblGenomes-Gn; EBG00001019101.
DR   EnsemblGenomes-Gn; EBG00001019102.
DR   EnsemblGenomes-Gn; EBG00001019103.
DR   EnsemblGenomes-Gn; EBG00001019104.
DR   EnsemblGenomes-Gn; EBG00001019105.
DR   EnsemblGenomes-Gn; EBG00001019106.
DR   EnsemblGenomes-Gn; EBG00001019107.
DR   EnsemblGenomes-Gn; EBG00001019108.
DR   EnsemblGenomes-Gn; EBG00001019109.
DR   EnsemblGenomes-Gn; EBG00001019110.
DR   EnsemblGenomes-Gn; EBG00001019111.
DR   EnsemblGenomes-Gn; EBG00001019112.
DR   EnsemblGenomes-Gn; EBG00001019113.
DR   EnsemblGenomes-Gn; EBG00001019114.
DR   EnsemblGenomes-Gn; EBG00001019115.
DR   EnsemblGenomes-Gn; EBG00001019116.
DR   EnsemblGenomes-Gn; EBG00001019117.
DR   EnsemblGenomes-Gn; EBG00001019118.
DR   EnsemblGenomes-Gn; EBG00001019119.
DR   EnsemblGenomes-Gn; EBG00001019120.
DR   EnsemblGenomes-Gn; EBG00001019121.
DR   EnsemblGenomes-Gn; EBG00001019122.
DR   EnsemblGenomes-Gn; EBG00001019123.
DR   EnsemblGenomes-Gn; EBG00001019124.
DR   EnsemblGenomes-Gn; EBG00001019125.
DR   EnsemblGenomes-Gn; EBG00001019126.
DR   EnsemblGenomes-Gn; EBG00001019127.
DR   EnsemblGenomes-Gn; EBG00001019128.
DR   EnsemblGenomes-Gn; EBG00001019129.
DR   EnsemblGenomes-Gn; EBG00001019130.
DR   EnsemblGenomes-Gn; EBG00001019131.
DR   EnsemblGenomes-Gn; EBG00001019132.
DR   EnsemblGenomes-Gn; EBG00001019133.
DR   EnsemblGenomes-Gn; EBG00001019134.
DR   EnsemblGenomes-Gn; EBG00001019135.
DR   EnsemblGenomes-Gn; EBG00001019136.
DR   EnsemblGenomes-Gn; EBG00001019137.
DR   EnsemblGenomes-Gn; EBG00001019138.
DR   EnsemblGenomes-Gn; EBG00001019139.
DR   EnsemblGenomes-Gn; EBG00001019140.
DR   EnsemblGenomes-Gn; EBG00001019141.
DR   EnsemblGenomes-Gn; EBG00001019142.
DR   EnsemblGenomes-Gn; EBG00001019143.
DR   EnsemblGenomes-Gn; EBG00001019144.
DR   EnsemblGenomes-Gn; EBG00001019145.
DR   EnsemblGenomes-Gn; EBG00001019146.
DR   EnsemblGenomes-Gn; EBG00001019147.
DR   EnsemblGenomes-Gn; EBG00001019148.
DR   EnsemblGenomes-Gn; EBG00001019149.
DR   EnsemblGenomes-Gn; EBG00001019150.
DR   EnsemblGenomes-Gn; EBG00001019151.
DR   EnsemblGenomes-Gn; EBG00001019152.
DR   EnsemblGenomes-Gn; EBG00001019153.
DR   EnsemblGenomes-Gn; EBG00001019154.
DR   EnsemblGenomes-Gn; EBG00001019155.
DR   EnsemblGenomes-Gn; EBG00001019156.
DR   EnsemblGenomes-Gn; EBG00001019157.
DR   EnsemblGenomes-Gn; EBG00001019158.
DR   EnsemblGenomes-Gn; EBG00001019159.
DR   EnsemblGenomes-Gn; EBG00001019160.
DR   EnsemblGenomes-Gn; EBG00001019161.
DR   EnsemblGenomes-Gn; EBG00001019162.
DR   EnsemblGenomes-Gn; EBG00001019163.
DR   EnsemblGenomes-Gn; EBG00001019164.
DR   EnsemblGenomes-Gn; EBG00001019165.
DR   EnsemblGenomes-Gn; EBG00001019166.
DR   EnsemblGenomes-Gn; EBG00001019167.
DR   EnsemblGenomes-Gn; EBG00001019168.
DR   EnsemblGenomes-Gn; EBG00001019169.
DR   EnsemblGenomes-Gn; EBG00001019170.
DR   EnsemblGenomes-Gn; EBG00001019171.
DR   EnsemblGenomes-Gn; EBG00001019172.
DR   EnsemblGenomes-Gn; EBG00001019173.
DR   EnsemblGenomes-Gn; EBG00001019174.
DR   EnsemblGenomes-Gn; EBG00001019175.
DR   EnsemblGenomes-Gn; EBG00001019176.
DR   EnsemblGenomes-Gn; EBG00001019177.
DR   EnsemblGenomes-Gn; EBG00001019178.
DR   EnsemblGenomes-Gn; EBG00001019179.
DR   EnsemblGenomes-Gn; EBG00001019180.
DR   EnsemblGenomes-Gn; EBG00001019181.
DR   EnsemblGenomes-Gn; EBG00001019182.
DR   EnsemblGenomes-Gn; EBG00001019183.
DR   EnsemblGenomes-Gn; EBG00001019184.
DR   EnsemblGenomes-Gn; EBG00001019185.
DR   EnsemblGenomes-Gn; EBG00001019186.
DR   EnsemblGenomes-Gn; EBG00001019187.
DR   EnsemblGenomes-Gn; EBG00001019188.
DR   EnsemblGenomes-Gn; EBG00001019189.
DR   EnsemblGenomes-Gn; EBG00001019190.
DR   EnsemblGenomes-Gn; EBG00001019191.
DR   EnsemblGenomes-Gn; EBG00001019192.
DR   EnsemblGenomes-Gn; EBG00001019193.
DR   EnsemblGenomes-Gn; EBG00001019194.
DR   EnsemblGenomes-Gn; EBG00001019195.
DR   EnsemblGenomes-Gn; EBG00001019196.
DR   EnsemblGenomes-Gn; EBG00001019197.
DR   EnsemblGenomes-Gn; EBG00001019198.
DR   EnsemblGenomes-Gn; EBG00001019199.
DR   EnsemblGenomes-Gn; EBG00001019200.
DR   EnsemblGenomes-Gn; EBG00001019201.
DR   EnsemblGenomes-Gn; EBG00001019202.
DR   EnsemblGenomes-Gn; EBG00001019203.
DR   EnsemblGenomes-Gn; EBG00001019204.
DR   EnsemblGenomes-Gn; EBG00001019205.
DR   EnsemblGenomes-Gn; EBG00001019206.
DR   EnsemblGenomes-Gn; EBG00001019207.
DR   EnsemblGenomes-Gn; EBG00001019208.
DR   EnsemblGenomes-Gn; EBG00001019209.
DR   EnsemblGenomes-Gn; EBG00001019210.
DR   EnsemblGenomes-Gn; EBG00001019211.
DR   EnsemblGenomes-Gn; EBG00001019212.
DR   EnsemblGenomes-Gn; EBG00001019213.
DR   EnsemblGenomes-Gn; EBG00001019214.
DR   EnsemblGenomes-Gn; EBG00001019215.
DR   EnsemblGenomes-Gn; EBG00001019216.
DR   EnsemblGenomes-Gn; EBG00001019217.
DR   EnsemblGenomes-Gn; EBG00001019218.
DR   EnsemblGenomes-Gn; EBG00001019219.
DR   EnsemblGenomes-Gn; EBG00001019220.
DR   EnsemblGenomes-Gn; EBG00001019221.
DR   EnsemblGenomes-Gn; EBG00001019222.
DR   EnsemblGenomes-Gn; EBG00001019223.
DR   EnsemblGenomes-Gn; EBG00001019224.
DR   EnsemblGenomes-Gn; EBG00001019225.
DR   EnsemblGenomes-Gn; EBG00001019226.
DR   EnsemblGenomes-Gn; EBG00001019227.
DR   EnsemblGenomes-Gn; EBG00001019228.
DR   EnsemblGenomes-Gn; EBG00001019229.
DR   EnsemblGenomes-Gn; EBG00001019230.
DR   EnsemblGenomes-Gn; EBG00001019231.
DR   EnsemblGenomes-Gn; EBG00001019232.
DR   EnsemblGenomes-Gn; EBG00001019233.
DR   EnsemblGenomes-Gn; EBG00001019234.
DR   EnsemblGenomes-Gn; EBG00001019235.
DR   EnsemblGenomes-Gn; EBG00001019236.
DR   EnsemblGenomes-Gn; EBG00001019237.
DR   EnsemblGenomes-Gn; EBG00001019238.
DR   EnsemblGenomes-Gn; EBG00001019239.
DR   EnsemblGenomes-Gn; EBG00001019240.
DR   EnsemblGenomes-Gn; EBG00001019241.
DR   EnsemblGenomes-Gn; EBG00001019242.
DR   EnsemblGenomes-Gn; EBG00001019244.
DR   EnsemblGenomes-Gn; EBG00001019246.
DR   EnsemblGenomes-Gn; EBG00001019248.
DR   EnsemblGenomes-Gn; EBG00001019250.
DR   EnsemblGenomes-Gn; EBG00001019252.
DR   EnsemblGenomes-Gn; EBG00001019254.
DR   EnsemblGenomes-Gn; EBG00001019257.
DR   EnsemblGenomes-Gn; EBG00001019259.
DR   EnsemblGenomes-Gn; EBG00001019260.
DR   EnsemblGenomes-Gn; EBG00001019263.
DR   EnsemblGenomes-Gn; EBG00001019265.
DR   EnsemblGenomes-Gn; EBG00001019267.
DR   EnsemblGenomes-Gn; EBG00001019269.
DR   EnsemblGenomes-Gn; EBG00001019271.
DR   EnsemblGenomes-Gn; EBG00001019272.
DR   EnsemblGenomes-Gn; EBG00001019275.
DR   EnsemblGenomes-Gn; EBG00001019277.
DR   EnsemblGenomes-Gn; EBG00001019279.
DR   EnsemblGenomes-Gn; EBG00001019282.
DR   EnsemblGenomes-Gn; EBG00001019283.
DR   EnsemblGenomes-Gn; GY4MC1_R0001.
DR   EnsemblGenomes-Gn; GY4MC1_R0002.
DR   EnsemblGenomes-Gn; GY4MC1_R0003.
DR   EnsemblGenomes-Gn; GY4MC1_R0004.
DR   EnsemblGenomes-Gn; GY4MC1_R0005.
DR   EnsemblGenomes-Gn; GY4MC1_R0006.
DR   EnsemblGenomes-Gn; GY4MC1_R0007.
DR   EnsemblGenomes-Gn; GY4MC1_R0008.
DR   EnsemblGenomes-Gn; GY4MC1_R0009.
DR   EnsemblGenomes-Gn; GY4MC1_R0010.
DR   EnsemblGenomes-Gn; GY4MC1_R0011.
DR   EnsemblGenomes-Gn; GY4MC1_R0012.
DR   EnsemblGenomes-Gn; GY4MC1_R0013.
DR   EnsemblGenomes-Gn; GY4MC1_R0014.
DR   EnsemblGenomes-Gn; GY4MC1_R0015.
DR   EnsemblGenomes-Gn; GY4MC1_R0016.
DR   EnsemblGenomes-Gn; GY4MC1_R0017.
DR   EnsemblGenomes-Gn; GY4MC1_R0018.
DR   EnsemblGenomes-Gn; GY4MC1_R0019.
DR   EnsemblGenomes-Gn; GY4MC1_R0020.
DR   EnsemblGenomes-Gn; GY4MC1_R0021.
DR   EnsemblGenomes-Gn; GY4MC1_R0022.
DR   EnsemblGenomes-Gn; GY4MC1_R0023.
DR   EnsemblGenomes-Gn; GY4MC1_R0024.
DR   EnsemblGenomes-Gn; GY4MC1_R0025.
DR   EnsemblGenomes-Gn; GY4MC1_R0026.
DR   EnsemblGenomes-Gn; GY4MC1_R0027.
DR   EnsemblGenomes-Gn; GY4MC1_R0028.
DR   EnsemblGenomes-Gn; GY4MC1_R0029.
DR   EnsemblGenomes-Gn; GY4MC1_R0030.
DR   EnsemblGenomes-Gn; GY4MC1_R0031.
DR   EnsemblGenomes-Gn; GY4MC1_R0032.
DR   EnsemblGenomes-Gn; GY4MC1_R0033.
DR   EnsemblGenomes-Gn; GY4MC1_R0034.
DR   EnsemblGenomes-Gn; GY4MC1_R0035.
DR   EnsemblGenomes-Gn; GY4MC1_R0036.
DR   EnsemblGenomes-Gn; GY4MC1_R0037.
DR   EnsemblGenomes-Gn; GY4MC1_R0038.
DR   EnsemblGenomes-Gn; GY4MC1_R0039.
DR   EnsemblGenomes-Gn; GY4MC1_R0040.
DR   EnsemblGenomes-Gn; GY4MC1_R0041.
DR   EnsemblGenomes-Gn; GY4MC1_R0042.
DR   EnsemblGenomes-Gn; GY4MC1_R0043.
DR   EnsemblGenomes-Gn; GY4MC1_R0044.
DR   EnsemblGenomes-Gn; GY4MC1_R0045.
DR   EnsemblGenomes-Gn; GY4MC1_R0046.
DR   EnsemblGenomes-Gn; GY4MC1_R0047.
DR   EnsemblGenomes-Gn; GY4MC1_R0048.
DR   EnsemblGenomes-Gn; GY4MC1_R0049.
DR   EnsemblGenomes-Gn; GY4MC1_R0050.
DR   EnsemblGenomes-Gn; GY4MC1_R0051.
DR   EnsemblGenomes-Gn; GY4MC1_R0052.
DR   EnsemblGenomes-Gn; GY4MC1_R0053.
DR   EnsemblGenomes-Gn; GY4MC1_R0054.
DR   EnsemblGenomes-Gn; GY4MC1_R0055.
DR   EnsemblGenomes-Gn; GY4MC1_R0056.
DR   EnsemblGenomes-Gn; GY4MC1_R0057.
DR   EnsemblGenomes-Gn; GY4MC1_R0058.
DR   EnsemblGenomes-Gn; GY4MC1_R0059.
DR   EnsemblGenomes-Gn; GY4MC1_R0060.
DR   EnsemblGenomes-Gn; GY4MC1_R0061.
DR   EnsemblGenomes-Gn; GY4MC1_R0062.
DR   EnsemblGenomes-Gn; GY4MC1_R0063.
DR   EnsemblGenomes-Gn; GY4MC1_R0064.
DR   EnsemblGenomes-Gn; GY4MC1_R0065.
DR   EnsemblGenomes-Gn; GY4MC1_R0066.
DR   EnsemblGenomes-Gn; GY4MC1_R0067.
DR   EnsemblGenomes-Gn; GY4MC1_R0068.
DR   EnsemblGenomes-Gn; GY4MC1_R0069.
DR   EnsemblGenomes-Gn; GY4MC1_R0070.
DR   EnsemblGenomes-Gn; GY4MC1_R0071.
DR   EnsemblGenomes-Gn; GY4MC1_R0072.
DR   EnsemblGenomes-Gn; GY4MC1_R0073.
DR   EnsemblGenomes-Gn; GY4MC1_R0074.
DR   EnsemblGenomes-Gn; GY4MC1_R0075.
DR   EnsemblGenomes-Gn; GY4MC1_R0076.
DR   EnsemblGenomes-Gn; GY4MC1_R0077.
DR   EnsemblGenomes-Gn; GY4MC1_R0078.
DR   EnsemblGenomes-Gn; GY4MC1_R0079.
DR   EnsemblGenomes-Gn; GY4MC1_R0080.
DR   EnsemblGenomes-Gn; GY4MC1_R0081.
DR   EnsemblGenomes-Gn; GY4MC1_R0082.
DR   EnsemblGenomes-Gn; GY4MC1_R0083.
DR   EnsemblGenomes-Gn; GY4MC1_R0084.
DR   EnsemblGenomes-Gn; GY4MC1_R0085.
DR   EnsemblGenomes-Gn; GY4MC1_R0086.
DR   EnsemblGenomes-Gn; GY4MC1_R0087.
DR   EnsemblGenomes-Gn; GY4MC1_R0088.
DR   EnsemblGenomes-Gn; GY4MC1_R0089.
DR   EnsemblGenomes-Gn; GY4MC1_R0090.
DR   EnsemblGenomes-Gn; GY4MC1_R0091.
DR   EnsemblGenomes-Gn; GY4MC1_R0092.
DR   EnsemblGenomes-Gn; GY4MC1_R0093.
DR   EnsemblGenomes-Gn; GY4MC1_R0094.
DR   EnsemblGenomes-Gn; GY4MC1_R0095.
DR   EnsemblGenomes-Gn; GY4MC1_R0096.
DR   EnsemblGenomes-Gn; GY4MC1_R0097.
DR   EnsemblGenomes-Gn; GY4MC1_R0098.
DR   EnsemblGenomes-Gn; GY4MC1_R0099.
DR   EnsemblGenomes-Gn; GY4MC1_R0100.
DR   EnsemblGenomes-Gn; GY4MC1_R0101.
DR   EnsemblGenomes-Gn; GY4MC1_R0102.
DR   EnsemblGenomes-Gn; GY4MC1_R0103.
DR   EnsemblGenomes-Gn; GY4MC1_R0104.
DR   EnsemblGenomes-Gn; GY4MC1_R0105.
DR   EnsemblGenomes-Gn; GY4MC1_R0106.
DR   EnsemblGenomes-Gn; GY4MC1_R0107.
DR   EnsemblGenomes-Gn; GY4MC1_R0108.
DR   EnsemblGenomes-Gn; GY4MC1_R0109.
DR   EnsemblGenomes-Gn; GY4MC1_R0110.
DR   EnsemblGenomes-Gn; GY4MC1_R0111.
DR   EnsemblGenomes-Gn; GY4MC1_R0112.
DR   EnsemblGenomes-Gn; GY4MC1_R0113.
DR   EnsemblGenomes-Gn; GY4MC1_R0114.
DR   EnsemblGenomes-Gn; GY4MC1_R0115.
DR   EnsemblGenomes-Gn; GY4MC1_R0116.
DR   EnsemblGenomes-Gn; GY4MC1_R0117.
DR   EnsemblGenomes-Gn; GY4MC1_R0118.
DR   EnsemblGenomes-Gn; GY4MC1_R0119.
DR   EnsemblGenomes-Gn; GY4MC1_R0120.
DR   EnsemblGenomes-Gn; GY4MC1_R0121.
DR   EnsemblGenomes-Gn; GY4MC1_R0122.
DR   EnsemblGenomes-Tr; EBT00001622604.
DR   EnsemblGenomes-Tr; EBT00001622605.
DR   EnsemblGenomes-Tr; EBT00001622606.
DR   EnsemblGenomes-Tr; EBT00001622607.
DR   EnsemblGenomes-Tr; EBT00001622608.
DR   EnsemblGenomes-Tr; EBT00001622609.
DR   EnsemblGenomes-Tr; EBT00001622610.
DR   EnsemblGenomes-Tr; EBT00001622611.
DR   EnsemblGenomes-Tr; EBT00001622612.
DR   EnsemblGenomes-Tr; EBT00001622613.
DR   EnsemblGenomes-Tr; EBT00001622614.
DR   EnsemblGenomes-Tr; EBT00001622615.
DR   EnsemblGenomes-Tr; EBT00001622616.
DR   EnsemblGenomes-Tr; EBT00001622617.
DR   EnsemblGenomes-Tr; EBT00001622618.
DR   EnsemblGenomes-Tr; EBT00001622619.
DR   EnsemblGenomes-Tr; EBT00001622620.
DR   EnsemblGenomes-Tr; EBT00001622621.
DR   EnsemblGenomes-Tr; EBT00001622622.
DR   EnsemblGenomes-Tr; EBT00001622623.
DR   EnsemblGenomes-Tr; EBT00001622624.
DR   EnsemblGenomes-Tr; EBT00001622625.
DR   EnsemblGenomes-Tr; EBT00001622626.
DR   EnsemblGenomes-Tr; EBT00001622627.
DR   EnsemblGenomes-Tr; EBT00001622628.
DR   EnsemblGenomes-Tr; EBT00001622629.
DR   EnsemblGenomes-Tr; EBT00001622630.
DR   EnsemblGenomes-Tr; EBT00001622631.
DR   EnsemblGenomes-Tr; EBT00001622632.
DR   EnsemblGenomes-Tr; EBT00001622633.
DR   EnsemblGenomes-Tr; EBT00001622634.
DR   EnsemblGenomes-Tr; EBT00001622635.
DR   EnsemblGenomes-Tr; EBT00001622636.
DR   EnsemblGenomes-Tr; EBT00001622637.
DR   EnsemblGenomes-Tr; EBT00001622638.
DR   EnsemblGenomes-Tr; EBT00001622639.
DR   EnsemblGenomes-Tr; EBT00001622640.
DR   EnsemblGenomes-Tr; EBT00001622641.
DR   EnsemblGenomes-Tr; EBT00001622642.
DR   EnsemblGenomes-Tr; EBT00001622643.
DR   EnsemblGenomes-Tr; EBT00001622644.
DR   EnsemblGenomes-Tr; EBT00001622645.
DR   EnsemblGenomes-Tr; EBT00001622646.
DR   EnsemblGenomes-Tr; EBT00001622647.
DR   EnsemblGenomes-Tr; EBT00001622648.
DR   EnsemblGenomes-Tr; EBT00001622649.
DR   EnsemblGenomes-Tr; EBT00001622650.
DR   EnsemblGenomes-Tr; EBT00001622651.
DR   EnsemblGenomes-Tr; EBT00001622652.
DR   EnsemblGenomes-Tr; EBT00001622653.
DR   EnsemblGenomes-Tr; EBT00001622654.
DR   EnsemblGenomes-Tr; EBT00001622655.
DR   EnsemblGenomes-Tr; EBT00001622656.
DR   EnsemblGenomes-Tr; EBT00001622657.
DR   EnsemblGenomes-Tr; EBT00001622658.
DR   EnsemblGenomes-Tr; EBT00001622659.
DR   EnsemblGenomes-Tr; EBT00001622660.
DR   EnsemblGenomes-Tr; EBT00001622661.
DR   EnsemblGenomes-Tr; EBT00001622662.
DR   EnsemblGenomes-Tr; EBT00001622663.
DR   EnsemblGenomes-Tr; EBT00001622664.
DR   EnsemblGenomes-Tr; EBT00001622665.
DR   EnsemblGenomes-Tr; EBT00001622666.
DR   EnsemblGenomes-Tr; EBT00001622667.
DR   EnsemblGenomes-Tr; EBT00001622668.
DR   EnsemblGenomes-Tr; EBT00001622669.
DR   EnsemblGenomes-Tr; EBT00001622670.
DR   EnsemblGenomes-Tr; EBT00001622671.
DR   EnsemblGenomes-Tr; EBT00001622672.
DR   EnsemblGenomes-Tr; EBT00001622673.
DR   EnsemblGenomes-Tr; EBT00001622674.
DR   EnsemblGenomes-Tr; EBT00001622675.
DR   EnsemblGenomes-Tr; EBT00001622676.
DR   EnsemblGenomes-Tr; EBT00001622677.
DR   EnsemblGenomes-Tr; EBT00001622678.
DR   EnsemblGenomes-Tr; EBT00001622679.
DR   EnsemblGenomes-Tr; EBT00001622680.
DR   EnsemblGenomes-Tr; EBT00001622681.
DR   EnsemblGenomes-Tr; EBT00001622682.
DR   EnsemblGenomes-Tr; EBT00001622683.
DR   EnsemblGenomes-Tr; EBT00001622684.
DR   EnsemblGenomes-Tr; EBT00001622685.
DR   EnsemblGenomes-Tr; EBT00001622686.
DR   EnsemblGenomes-Tr; EBT00001622687.
DR   EnsemblGenomes-Tr; EBT00001622688.
DR   EnsemblGenomes-Tr; EBT00001622689.
DR   EnsemblGenomes-Tr; EBT00001622690.
DR   EnsemblGenomes-Tr; EBT00001622691.
DR   EnsemblGenomes-Tr; EBT00001622692.
DR   EnsemblGenomes-Tr; EBT00001622693.
DR   EnsemblGenomes-Tr; EBT00001622694.
DR   EnsemblGenomes-Tr; EBT00001622695.
DR   EnsemblGenomes-Tr; EBT00001622696.
DR   EnsemblGenomes-Tr; EBT00001622697.
DR   EnsemblGenomes-Tr; EBT00001622698.
DR   EnsemblGenomes-Tr; EBT00001622699.
DR   EnsemblGenomes-Tr; EBT00001622700.
DR   EnsemblGenomes-Tr; EBT00001622701.
DR   EnsemblGenomes-Tr; EBT00001622702.
DR   EnsemblGenomes-Tr; EBT00001622703.
DR   EnsemblGenomes-Tr; EBT00001622704.
DR   EnsemblGenomes-Tr; EBT00001622705.
DR   EnsemblGenomes-Tr; EBT00001622706.
DR   EnsemblGenomes-Tr; EBT00001622707.
DR   EnsemblGenomes-Tr; EBT00001622708.
DR   EnsemblGenomes-Tr; EBT00001622709.
DR   EnsemblGenomes-Tr; EBT00001622710.
DR   EnsemblGenomes-Tr; EBT00001622711.
DR   EnsemblGenomes-Tr; EBT00001622712.
DR   EnsemblGenomes-Tr; EBT00001622713.
DR   EnsemblGenomes-Tr; EBT00001622714.
DR   EnsemblGenomes-Tr; EBT00001622715.
DR   EnsemblGenomes-Tr; EBT00001622716.
DR   EnsemblGenomes-Tr; EBT00001622717.
DR   EnsemblGenomes-Tr; EBT00001622718.
DR   EnsemblGenomes-Tr; EBT00001622719.
DR   EnsemblGenomes-Tr; EBT00001622720.
DR   EnsemblGenomes-Tr; EBT00001622721.
DR   EnsemblGenomes-Tr; EBT00001622722.
DR   EnsemblGenomes-Tr; EBT00001622724.
DR   EnsemblGenomes-Tr; EBT00001622725.
DR   EnsemblGenomes-Tr; EBT00001622727.
DR   EnsemblGenomes-Tr; EBT00001622729.
DR   EnsemblGenomes-Tr; EBT00001622731.
DR   EnsemblGenomes-Tr; EBT00001622733.
DR   EnsemblGenomes-Tr; EBT00001622735.
DR   EnsemblGenomes-Tr; EBT00001622736.
DR   EnsemblGenomes-Tr; EBT00001622738.
DR   EnsemblGenomes-Tr; EBT00001622740.
DR   EnsemblGenomes-Tr; EBT00001622742.
DR   EnsemblGenomes-Tr; EBT00001622744.
DR   EnsemblGenomes-Tr; EBT00001622746.
DR   EnsemblGenomes-Tr; EBT00001622747.
DR   EnsemblGenomes-Tr; EBT00001622749.
DR   EnsemblGenomes-Tr; EBT00001622751.
DR   EnsemblGenomes-Tr; EBT00001622753.
DR   EnsemblGenomes-Tr; EBT00001622755.
DR   EnsemblGenomes-Tr; EBT00001622757.
DR   EnsemblGenomes-Tr; EBT00001622759.
DR   EnsemblGenomes-Tr; EBT00001622760.
DR   EnsemblGenomes-Tr; EBT00001622762.
DR   EnsemblGenomes-Tr; EBT00001622764.
DR   EnsemblGenomes-Tr; EBT00001622766.
DR   EnsemblGenomes-Tr; EBT00001622768.
DR   EnsemblGenomes-Tr; EBT00001622770.
DR   EnsemblGenomes-Tr; EBT00001622772.
DR   EnsemblGenomes-Tr; EBT00001622774.
DR   EnsemblGenomes-Tr; EBT00001622776.
DR   EnsemblGenomes-Tr; EBT00001622778.
DR   EnsemblGenomes-Tr; EBT00001622780.
DR   EnsemblGenomes-Tr; EBT00001622782.
DR   EnsemblGenomes-Tr; EBT00001622783.
DR   EnsemblGenomes-Tr; EBT00001622785.
DR   EnsemblGenomes-Tr; EBT00001622787.
DR   EnsemblGenomes-Tr; EBT00001622789.
DR   EnsemblGenomes-Tr; EBT00001622791.
DR   EnsemblGenomes-Tr; EBT00001622793.
DR   EnsemblGenomes-Tr; EBT00001622795.
DR   EnsemblGenomes-Tr; EBT00001622796.
DR   EnsemblGenomes-Tr; EBT00001622798.
DR   EnsemblGenomes-Tr; EBT00001622800.
DR   EnsemblGenomes-Tr; EBT00001622802.
DR   EnsemblGenomes-Tr; EBT00001622804.
DR   EnsemblGenomes-Tr; EBT00001622806.
DR   EnsemblGenomes-Tr; EBT00001622807.
DR   EnsemblGenomes-Tr; EBT00001622810.
DR   EnsemblGenomes-Tr; EBT00001622811.
DR   EnsemblGenomes-Tr; EBT00001622812.
DR   EnsemblGenomes-Tr; EBT00001622813.
DR   EnsemblGenomes-Tr; EBT00001622815.
DR   EnsemblGenomes-Tr; EBT00001622816.
DR   EnsemblGenomes-Tr; EBT00001622817.
DR   EnsemblGenomes-Tr; EBT00001622819.
DR   EnsemblGenomes-Tr; EBT00001622821.
DR   EnsemblGenomes-Tr; EBT00001622823.
DR   EnsemblGenomes-Tr; EBT00001622824.
DR   EnsemblGenomes-Tr; EBT00001622825.
DR   EnsemblGenomes-Tr; EBT00001622826.
DR   EnsemblGenomes-Tr; EBT00001622827.
DR   EnsemblGenomes-Tr; EBT00001622828.
DR   EnsemblGenomes-Tr; EBT00001622829.
DR   EnsemblGenomes-Tr; EBT00001622830.
DR   EnsemblGenomes-Tr; EBT00001622831.
DR   EnsemblGenomes-Tr; EBT00001622832.
DR   EnsemblGenomes-Tr; EBT00001622833.
DR   EnsemblGenomes-Tr; EBT00001622834.
DR   EnsemblGenomes-Tr; EBT00001622835.
DR   EnsemblGenomes-Tr; EBT00001622836.
DR   EnsemblGenomes-Tr; EBT00001622837.
DR   EnsemblGenomes-Tr; EBT00001622838.
DR   EnsemblGenomes-Tr; EBT00001622839.
DR   EnsemblGenomes-Tr; EBT00001622840.
DR   EnsemblGenomes-Tr; EBT00001622841.
DR   EnsemblGenomes-Tr; EBT00001622842.
DR   EnsemblGenomes-Tr; EBT00001622843.
DR   EnsemblGenomes-Tr; EBT00001622844.
DR   EnsemblGenomes-Tr; EBT00001622845.
DR   EnsemblGenomes-Tr; EBT00001622846.
DR   EnsemblGenomes-Tr; EBT00001622847.
DR   EnsemblGenomes-Tr; EBT00001622848.
DR   EnsemblGenomes-Tr; EBT00001622849.
DR   EnsemblGenomes-Tr; EBT00001622850.
DR   EnsemblGenomes-Tr; EBT00001622851.
DR   EnsemblGenomes-Tr; EBT00001622852.
DR   EnsemblGenomes-Tr; EBT00001622853.
DR   EnsemblGenomes-Tr; EBT00001622854.
DR   EnsemblGenomes-Tr; EBT00001622855.
DR   EnsemblGenomes-Tr; EBT00001622856.
DR   EnsemblGenomes-Tr; EBT00001622857.
DR   EnsemblGenomes-Tr; EBT00001622858.
DR   EnsemblGenomes-Tr; EBT00001622859.
DR   EnsemblGenomes-Tr; EBT00001622860.
DR   EnsemblGenomes-Tr; EBT00001622861.
DR   EnsemblGenomes-Tr; EBT00001622862.
DR   EnsemblGenomes-Tr; EBT00001622863.
DR   EnsemblGenomes-Tr; EBT00001622864.
DR   EnsemblGenomes-Tr; EBT00001622865.
DR   EnsemblGenomes-Tr; EBT00001622866.
DR   EnsemblGenomes-Tr; EBT00001622867.
DR   EnsemblGenomes-Tr; EBT00001622868.
DR   EnsemblGenomes-Tr; EBT00001622869.
DR   EnsemblGenomes-Tr; EBT00001622870.
DR   EnsemblGenomes-Tr; EBT00001622871.
DR   EnsemblGenomes-Tr; EBT00001622872.
DR   EnsemblGenomes-Tr; EBT00001622873.
DR   EnsemblGenomes-Tr; EBT00001622874.
DR   EnsemblGenomes-Tr; EBT00001622875.
DR   EnsemblGenomes-Tr; EBT00001622876.
DR   EnsemblGenomes-Tr; EBT00001622877.
DR   EnsemblGenomes-Tr; EBT00001622878.
DR   EnsemblGenomes-Tr; EBT00001622879.
DR   EnsemblGenomes-Tr; EBT00001622880.
DR   EnsemblGenomes-Tr; EBT00001622881.
DR   EnsemblGenomes-Tr; EBT00001622882.
DR   EnsemblGenomes-Tr; EBT00001622883.
DR   EnsemblGenomes-Tr; EBT00001622884.
DR   EnsemblGenomes-Tr; EBT00001622885.
DR   EnsemblGenomes-Tr; EBT00001622886.
DR   EnsemblGenomes-Tr; EBT00001622887.
DR   EnsemblGenomes-Tr; EBT00001622888.
DR   EnsemblGenomes-Tr; EBT00001622889.
DR   EnsemblGenomes-Tr; EBT00001622890.
DR   EnsemblGenomes-Tr; EBT00001622891.
DR   EnsemblGenomes-Tr; EBT00001622892.
DR   EnsemblGenomes-Tr; EBT00001622893.
DR   EnsemblGenomes-Tr; EBT00001622894.
DR   EnsemblGenomes-Tr; EBT00001622895.
DR   EnsemblGenomes-Tr; EBT00001622896.
DR   EnsemblGenomes-Tr; EBT00001622897.
DR   EnsemblGenomes-Tr; EBT00001622898.
DR   EnsemblGenomes-Tr; EBT00001622899.
DR   EnsemblGenomes-Tr; EBT00001622900.
DR   EnsemblGenomes-Tr; EBT00001622901.
DR   EnsemblGenomes-Tr; EBT00001622902.
DR   EnsemblGenomes-Tr; EBT00001622903.
DR   EnsemblGenomes-Tr; EBT00001622904.
DR   EnsemblGenomes-Tr; EBT00001622905.
DR   EnsemblGenomes-Tr; EBT00001622906.
DR   EnsemblGenomes-Tr; EBT00001622907.
DR   EnsemblGenomes-Tr; EBT00001622908.
DR   EnsemblGenomes-Tr; EBT00001622909.
DR   EnsemblGenomes-Tr; EBT00001622910.
DR   EnsemblGenomes-Tr; EBT00001622911.
DR   EnsemblGenomes-Tr; EBT00001622912.
DR   EnsemblGenomes-Tr; EBT00001622913.
DR   EnsemblGenomes-Tr; EBT00001622914.
DR   EnsemblGenomes-Tr; EBT00001622915.
DR   EnsemblGenomes-Tr; EBT00001622916.
DR   EnsemblGenomes-Tr; EBT00001622917.
DR   EnsemblGenomes-Tr; EBT00001622918.
DR   EnsemblGenomes-Tr; EBT00001622919.
DR   EnsemblGenomes-Tr; EBT00001622920.
DR   EnsemblGenomes-Tr; EBT00001622921.
DR   EnsemblGenomes-Tr; EBT00001622922.
DR   EnsemblGenomes-Tr; EBT00001622923.
DR   EnsemblGenomes-Tr; EBT00001622924.
DR   EnsemblGenomes-Tr; EBT00001622925.
DR   EnsemblGenomes-Tr; EBT00001622926.
DR   EnsemblGenomes-Tr; EBT00001622927.
DR   EnsemblGenomes-Tr; EBT00001622928.
DR   EnsemblGenomes-Tr; EBT00001622929.
DR   EnsemblGenomes-Tr; EBT00001622930.
DR   EnsemblGenomes-Tr; EBT00001622931.
DR   EnsemblGenomes-Tr; EBT00001622932.
DR   EnsemblGenomes-Tr; GY4MC1_R0001-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0002-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0003-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0004-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0005-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0006-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0007-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0008-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0009-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0010-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0011-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0012-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0013-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0014-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0015-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0016-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0017-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0018-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0019-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0020-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0021-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0022-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0023-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0024-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0025-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0026-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0027-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0028-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0029-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0030-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0031-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0032-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0033-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0034-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0035-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0036-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0037-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0038-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0039-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0040-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0041-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0042-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0043-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0044-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0045-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0046-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0047-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0048-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0049-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0050-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0051-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0052-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0053-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0054-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0055-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0056-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0057-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0058-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0059-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0060-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0061-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0062-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0063-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0064-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0065-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0066-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0067-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0068-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0069-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0070-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0071-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0072-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0073-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0074-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0075-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0076-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0077-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0078-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0079-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0080-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0081-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0082-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0083-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0084-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0085-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0086-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0087-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0088-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0089-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0090-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0091-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0092-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0093-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0094-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0095-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0096-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0097-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0098-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0099-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0100-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0101-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0102-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0103-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0104-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0105-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0106-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0107-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0108-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0109-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0110-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0111-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0112-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0113-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0114-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0115-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0116-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0117-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0118-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0119-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0120-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0121-1.
DR   EnsemblGenomes-Tr; GY4MC1_R0122-1.
DR   EuropePMC; PMC3416512; 22815439.
DR   EuropePMC; PMC4995803; 27559429.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01352; CRISPR-DR43.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP002293.
DR   SILVA-SSU; CP002293.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086101
CC   Source DNA and organism available from David Mead
CC   (dmead@lucigen.com)
CC   Contacts: David Mead (dmead@lucigen.com)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Geobacillus sp. Y4.1MC1
CC   collection_date     :: Missing
CC   lat_lon             :: 44.376262 -110.690383
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: USA
CC   environment         :: Missing
CC   num_replicons       :: 2
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemoorganotroph
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03944
CC   Funding Program     :: DOEM 2004
CC   Isolation Site      :: Bath Hot Spring in Yellowstone National Park
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Sporulating
CC   Temperature Range   :: Thermophile
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3840330
FT                   /organism="Geobacillus sp. Y4.1MC1"
FT                   /strain="Y4.1MC1"
FT                   /mol_type="genomic DNA"
FT                   /country="USA"
FT                   /lat_lon="44.38 N 110.69 W"
FT                   /isolation_source="Bath Hot Spring, Yellowstone National
FT                   Park"
FT                   /db_xref="taxon:581103"
FT   gene            423..1775
FT                   /locus_tag="GY4MC1_0001"
FT   CDS_pept        423..1775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   gwc:GWCH70_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72857"
FT                   /db_xref="GOA:A0A0F6BHF6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHF6"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADP72857.1"
FT                   /translation="MENIHDLWNRVLGEIEKKISKPSFETWLKSTKAHSLRGDTLVIVA
FT                   PNEFARDWLDSRYSRLIAETIYDITGEELSVKFIIPPNQSEDDFELQQSLKKQRKSYEE
FT                   PADFPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLA
FT                   GKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLE
FT                   TRIAILRKKAKAEGFDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEINADLA
FT                   AEALKDIIPNSKPKVITIQDIQRVVGQHFNIKLEDFKAKKRTKSVAFPRQIAMYLSREL
FT                   TDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDVQLQKHIKEIQEKLKQL"
FT   gene            1957..3093
FT                   /locus_tag="GY4MC1_0002"
FT   CDS_pept        1957..3093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: gwc:GWCH70_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72858"
FT                   /db_xref="GOA:A0A0F6BHF7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHF7"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP72858.1"
FT                   /translation="MKITIDREALVQSVQDVMKAVSPRTTIPILTGIKITATPQGVTLT
FT                   GSDSDISIESFIPMEDEDKVLVEIAETGSIVLQARFFSEIVKKLPEKTVEIEVQPNFLT
FT                   VIRSGKAEFSLNGLDAEEYPRLPQIEEENVFEIPTDLLKTIIRQTVFAVSVSETRPILT
FT                   GVNWRIEDEELICTATDSHRLALRKAKIETENHQSHNVVIPGKSLNELSKILDDSNAPV
FT                   KIVITANQILFKTKRLLFFSRLLDGNYPETSRLIPTDSKTDIIVNAKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLSDGIIEISSVSPEIGKVTEEIQSESIEGEELKISFSAKYMMDALK
FT                   ALDGTDIKISFTGAMRPFLLRPLHSDSMLQLILPVRTY"
FT   gene            3197..3418
FT                   /locus_tag="GY4MC1_0003"
FT   CDS_pept        3197..3418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG:
FT                   gwc:GWCH70_0003 S4 domain protein YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72859"
FT                   /db_xref="GOA:A0A0F6BHF8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHF8"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADP72859.1"
FT                   /translation="MEKKVTIATETITLGQLLKLVQAVGTGGAVKWFLQTNEVLVNGEK
FT                   ETRRGRKLKNGDKVEVEGLGTFIVTRAE"
FT   gene            3430..4554
FT                   /locus_tag="GY4MC1_0004"
FT   CDS_pept        3430..4554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: gwc:GWCH70_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72860"
FT                   /db_xref="GOA:A0A0F6BHF9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHF9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADP72860.1"
FT                   /translation="MFLTHLSLKNYRNYKSETIQFANNVNIILGENAQGKTNMMEAIYV
FT                   LAMAKSHRTANDKDLIRWDEDYAKIEGRATTKSGALSLELIISKKGKKAKCNHVEQQRL
FT                   SQYVGHLNIVMFAPEDLNLVKGSPQVRRRFVDMEIGQVSPVYIHDLSQYQKLLQQRNHY
FT                   LKMLQTREQQDETVLDILTEQLIPLAAKITLKRHEFLLLLEKWAAPIHREISRGLETLQ
FT                   IQYRPSVDVSERMELSRIIEAYSEKFATIKEREIQRGMTLAGPHRDDILFSVNGKDVQT
FT                   FGSQGQQRTTALSIKLAEIELIFSEIGDYPILLLDDVLSELDDFRQTHLLDAIRQKVQT
FT                   FVTTTSIDGIEHDIIKEAAIYKVHSGHVTAPLCD"
FT   gene            4593..6515
FT                   /locus_tag="GY4MC1_0005"
FT   CDS_pept        4593..6515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: gwc:GWCH70_0005 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72861"
FT                   /db_xref="GOA:A0A0F6BHG0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG0"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADP72861.1"
FT                   /translation="MTMEQKVEHTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLV
FT                   WEIVDNSIDEALAGYCTEINVTIEKDGSITVTDNGRGIPVDIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSEELEVYVHRDGKIHYQKYQRGVPCTDLQVVG
FT                   ETDRTGTTVHFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLEDKRVENRKNEY
FT                   CYEGGIQSYVKHLNRTREVLHEEPIYIIGERDGIYVEIAFQYNDSYSSNIYSFVNNIHT
FT                   HEGGTHESGFKMALTRIINDYARKQQIFKDNDPNLTGEDVREGLTAIVSIKHPAPQFEG
FT                   QTKTKLGNSDARTVTDAVFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTR
FT                   RKSALEISNLPGKLADCSSKDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKIIN
FT                   VEKARLDKILSNNEVRAIITALGTGIGEDFDITKARYHKIIIMTDADVDGAHIRTLLLT
FT                   FFYRYMREFIERGYVYIAQPPLYKIEQDKQVRYAYNDRQLEKILAELPENPKPTIQRYK
FT                   GLGEMNPEQLWETTMNPETRTLLQVSLQDAIEADETFEILMGDKVEPRRQFIEENARYV
FT                   KNLDI"
FT   gene            6577..9051
FT                   /locus_tag="GY4MC1_0006"
FT   CDS_pept        6577..9051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: gwc:GWCH70_0006 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72862"
FT                   /db_xref="GOA:A0A0F6BHG1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADP72862.1"
FT                   /translation="MSENQHPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKIAMEMLRDINKDTIDYQDNYDGSEKEPVVLPSR
FT                   FPNLLVNGSSGIAVGMATNIPPHQLGEVIDAILALSKNPDMTVADLMEHIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGKEMIIVRELPYQVNKAKLIERIAELV
FT                   REKKIDGITDLRDESDRSGMRIVIEVRKDANAKVILNNLYKHTAMQTSFGINMLALVDG
FT                   QPKVLNLKECLQHYLDHQKTVIRRRTAYELKKAEARAHILEGLRIALDYLDEVINLIRS
FT                   SKTTEIAREGLMQQFSLSERQAQAILDMRLQRLTGLEREKIEQEYQELIRLIAELKAIL
FT                   ADEEKVLQIIRDELTEIKERFNDERRTEIVAGGAEEFEDEDLIPRENIVITLTHKGYIK
FT                   RLPVSTYKSQKRGGRGVQGMHTNEDDFVEHLLITSTHDTVLFFTNKGKVYRAKGYEIPE
FT                   FGRTAKGIPLINLLELDKDEWINTIIPIDNEFDDNLYLFFTTKQGIAKRSPLSSFAHIR
FT                   NNGLIAIHLREGDELISAKLTDGSKHIIVGTKNGMLIRFPETDVRAMGRSATGVKAITL
FT                   EDGDEVVGMEILEDGCDVLVVTKNGYGKRTPASEYRIQSRGGKGIKTCNITEKNGPIVA
FT                   VKTVTGEEDLMLITASGILIRIAVSDISRMGRNTQGVKLIRLSDDNEHEYVATVAKVPK
FT                   EEKENEAEEEEH"
FT   gene            9167..10252
FT                   /locus_tag="GY4MC1_0007"
FT   CDS_pept        9167..10252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0007"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: gwc:GWCH70_0007 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72863"
FT                   /db_xref="GOA:A0A0F6BHG2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG2"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADP72863.1"
FT                   /translation="MIRVKLHQLQEGCILAEDVLGKTQKTIMPKNTILTPYLLNVLEKF
FT                   LIQEVYVEPVLANGKPFKPAELLDRREEDSPSDEQPIYLYLQAVQKYKKAFQSWQSGAP
FT                   IDIGQIRNIIIPLFDKLIHNRKKLLALHRYVTKEDYLYHHAVSVGLLSGFLAKQLNYSK
FT                   SDCYQIVLAGILSDCGMARVDKRILTKNSALTTHEYEEMKQHTVIGYRMVEKIKTLKEG
FT                   VKLAVLQHHERIDGTGYPFGIRGQQIHPYSKIVAVADVYHAMTSERLYRSRQSPFKALE
FT                   KIQIEQFGKLSMEAIQILLDNLINFHVGTVVKLSNGEMAEIVFIQREAPTRPIVKIVDK
FT                   DEFLSLSEHRDIYIEEVVYND"
FT   gene            10646..12192
FT                   /locus_tag="GY4MC1_R0001"
FT   rRNA            10646..12192
FT                   /locus_tag="GY4MC1_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            12307..12380
FT                   /locus_tag="GY4MC1_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            12307..12380
FT                   /locus_tag="GY4MC1_R0002"
FT                   /product="tRNA-Ile"
FT   gene            12393..12468
FT                   /locus_tag="GY4MC1_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            12393..12468
FT                   /locus_tag="GY4MC1_R0003"
FT                   /product="tRNA-Ala"
FT   gene            12723..15653
FT                   /locus_tag="GY4MC1_R0004"
FT   rRNA            12723..15653
FT                   /locus_tag="GY4MC1_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            15789..15905
FT                   /locus_tag="GY4MC1_R0005"
FT   rRNA            15789..15905
FT                   /locus_tag="GY4MC1_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 104.04"
FT   gene            complement(15957..16946)
FT                   /locus_tag="GY4MC1_0008"
FT   CDS_pept        complement(15957..16946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_0008 YaaC"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72864"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG3"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0008"
FT                   /protein_id="ADP72864.1"
FT                   /translation="MFDCRSNFNKFIVFHSADIAKQLLRQCYTKQKREDAVQKSYTNCY
FT                   PFLYYLEHGQNFYSTARDAPLSIKPVLLFYGMVQLLKACLLTVDADYPASTSVLAHGVS
FT                   TRKRKKQGYEFFNDEVKIQRNGLFTHFSEKMFHVKQPAGEKFRMSTLLERICELHPSFA
FT                   IFNDEKTLSLEIKYNASHHTIAIPTEILDHYHMSLNRFIYYIEQEWHFSKATFVKEKDR
FT                   FIHIGIQSPLQPIGCEPLMFHLNGTYRIPIKREKIFMLPEVMAHYLLLYNLSMISRYET
FT                   EWWSELLHAYSSNAYTLIVQFLSLTAEKVPLLLYEYLTQQLFPNSLYS"
FT   gene            17076..18542
FT                   /locus_tag="GY4MC1_0009"
FT   CDS_pept        17076..18542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0009"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG:
FT                   gwc:GWCH70_0009 inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72865"
FT                   /db_xref="GOA:A0A0F6BHG4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG4"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADP72865.1"
FT                   /translation="MWESKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTKLSETLQLNIP
FT                   IISAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   EHQVYDAEHLMSKYRISGVPIVNNEEEQKLVGIITNRDLRFIQDYSTKISDVMTKENLI
FT                   TAPVGTTLEEAEKILQKYKVEKLPLVDENGILKGLITIKDIEKVIEFPNSAKDAKGRLL
FT                   VGAAVGVTADTMIRVKKLVEANVDVIVVDTAHGHSKGVLETVRKIREQYPDLNIIAGNV
FT                   ATAEATRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKALAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEDNKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFIRMTSAGLRESHPHDVQITKEAPNYSIS"
FT   gene            18645..19997
FT                   /locus_tag="GY4MC1_0010"
FT   CDS_pept        18645..19997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0010"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: gwc:GWCH70_0010 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72866"
FT                   /db_xref="GOA:A0A0F6BHG5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG5"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADP72866.1"
FT                   /translation="MKRIKQKIIIIFLMIGLCFYFLPFHAAKAAVDPLNIEADAAILVD
FT                   ANTGRILYQKNIDTVLGIASMTKMMTEYLLLEAVKEKRVKWDQQYTPSDYVYRLSQDRA
FT                   LSNVPLRKDGKYTIRELYEAMAIYSANAATVAIAEIVGGSEQNFVKMMNEKANQLGLKG
FT                   YKFVNSTGLSNEDLKGFHPEGTNQSEENVMSARSVATLAYHLLKEYPEVLETASTPRKI
FT                   FREGTDDQIKMDNWNWMLPGLVHAYEGVDGLKTGYTEFAGYCFTGTAERNGVRFITVVM
FT                   NAKSNGKSTIEARFEQTRKLLDYGFSNYSMKKLYSKGYELKGKSVLPVVKGKEKSVAIA
FT                   TDKPLSLVVKNGEEKNYRPVYVFDKKKLTADGELTAPVKKGEKVGYMTLQYKGEEEYSF
FT                   LSPEMKKNVSVDIVAKNNVEKANWFVLTMRGIGGLFGDVWTSVAKTVKGWF"
FT   sig_peptide     18645..18734
FT                   /locus_tag="GY4MC1_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.952 at
FT                   residue 30"
FT   gene            20146..21030
FT                   /locus_tag="GY4MC1_0011"
FT   CDS_pept        20146..21030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0011"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: gwc:GWCH70_0011 pyridoxine biosynthesis
FT                   protein; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72867"
FT                   /db_xref="GOA:A0A0F6BHG6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG6"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADP72867.1"
FT                   /translation="MAITGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMKAVSIPVMAKARIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVSMSEDELVTEAKNLGAPVEVLREIKQLGRLPVVNFAAGGIATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATAHYEDYELIAHLSKGLGGAMRGIDVA
FT                   SLLPEQRMQERGW"
FT   gene            21046..21624
FT                   /locus_tag="GY4MC1_0012"
FT   CDS_pept        21046..21624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0012"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="KEGG: gwc:GWCH70_0012 SNO glutamine
FT                   amidotransferase; TIGRFAM: SNO glutamine amidotransferase;
FT                   PFAM: SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72868"
FT                   /db_xref="GOA:A0A0F6BHG7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG7"
FT                   /inference="protein motif:TFAM:TIGR03800"
FT                   /protein_id="ADP72868.1"
FT                   /translation="MMKIGVLGLQGAVQEHVRSIEACGAEAVVVKKIEQLEEIDGLILP
FT                   GGESTTMRRLMDKYGFIEPLKQFAAAGKPMFGTCAGLILLAKRIVGYDEPHLGLMDVTV
FT                   ERNSFGRQRESFEAELSVAGVADDFTGVFIRAPHIVEVGEDVEILAKYEGRIVAARQGQ
FT                   FLGCSFHPELTDDHRMTQYFLNMVKEAKA"
FT   gene            21966..23240
FT                   /locus_tag="GY4MC1_0013"
FT   CDS_pept        21966..23240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0014 seryl-tRNA synthetase;
FT                   TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (G H P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72869"
FT                   /db_xref="GOA:A0A0F6BHG8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG8"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADP72869.1"
FT                   /translation="MLDVKYLRNHFQEVKERIQKRGGDLANMDRFAELDKKRRELIAKA
FT                   EELKNKRNEVSQQIAVLKREKKDANHLIAEMREVGDRIKAMDDEIRQVEEELNALLLSI
FT                   PNIPHESVPVGKSEEDNVEVRKWGEPRSFSFEPKPHWDIADQLGILDFERAAKVTGSRF
FT                   VFYKGLGARLERALINFMLDVHIEEFGYQEILPPYLVNRASMTGTGQLPKFEEDAFRIE
FT                   TEDYFLIPTAEVPVTNLHRDEILSAEDLPIYYAAYSACFRAEAGAAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYDELEKLTNQAERILQLLGLPYRVVCLCTGDLGFAAAKTYDIEVW
FT                   LPSYGTYREISSCSNFEAFQARRANIRFRREPKSKPEYVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTVVIPEVLRPYMGNREVIR"
FT   gene            23335..23427
FT                   /locus_tag="GY4MC1_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            23335..23427
FT                   /locus_tag="GY4MC1_R0006"
FT                   /product="tRNA-Ser"
FT   gene            complement(23540..24208)
FT                   /locus_tag="GY4MC1_0014"
FT   CDS_pept        complement(23540..24208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0014"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: gwc:GWCH70_0015
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72870"
FT                   /db_xref="GOA:A0A0F6BHG9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG9"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADP72870.1"
FT                   /translation="MNLREKYRIPDNAIITIAGTVGVGKSTMTKALAKALNFRTSLEKV
FT                   DTNPYLDKFYADFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDAHIFAKMH
FT                   FENGTMTAVDYETYTSLFQAMVMTPYFPHPDLLIYLEGSFEEVIKRIRERGRPMEQKTP
FT                   VSYWKEMYERYEKWINEFNACPVLRVNINEYDIIEDEQSIEPIIKKAATIIHEYYHIKK
FT                   "
FT   gene            complement(24208..24843)
FT                   /locus_tag="GY4MC1_0015"
FT   CDS_pept        complement(24208..24843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0015"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: gwc:GWCH70_0016
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72871"
FT                   /db_xref="GOA:A0A0F6BHH0"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH0"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADP72871.1"
FT                   /translation="MGMVPFIAIEGPIGVGKTSLAKAISEHFHYHLVKEIVDENPFLGK
FT                   FYENIEEWSFQTEMFFLCHRYKQLEEIDRDFLQRQQPVVTDYHIMKNLIFAKRTLKIHH
FT                   YKKYTKIYDILTDGLPQPNMIIYLHASLETLLTRIQQRGRDFEKRMDPVYLQQLSADYE
FT                   EAFSLFEQANPHIPVLRFNGDLLDFVQREEDLHYIFERVKTVVKGVSQ"
FT   gene            complement(24941..26227)
FT                   /locus_tag="GY4MC1_0016"
FT   CDS_pept        complement(24941..26227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0016"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="KEGG: gwc:GWCH70_0017 glycoside hydrolase family 18;
FT                   PFAM: glycoside hydrolase family 18; Peptidoglycan-binding
FT                   lysin domain; SMART: chitinase II; Peptidoglycan-binding
FT                   LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72872"
FT                   /db_xref="GOA:A0A0F6BHH1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH1"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ADP72872.1"
FT                   /translation="MQIHVVQRGQTLSGIAQAYNTTPEEIIQANDLPNPDNLVVGQAIV
FT                   IPIVGRFYWVLRGDSLWSISRRFSIPMQQLAQINRISLDSPLQVGQRLYIPPRTKRRAE
FT                   FNGYIEPRGTAVSPALEASARQAAPHLTYLAPFHFQIQRNATLKEPPLNNFPSIARANG
FT                   VTLMMVVTNIENEQFSDELGALILNNEQLQNRLLDNITTIAKKYGFHDIHFDMEYLRPE
FT                   DREAYNAFLRKAKQRFGREGWLLSTALAPKTSATQKGRWYEAHDYRAHGQIADFVIIMT
FT                   YEWGYSGGPPMAVSPIGPVRRVLEYAISEIPASKIMMGQNLYGYDWTLPYVPGGPYAQA
FT                   ISPQQALRLASQHNVTIEYDANAQAPHFRYRDESGKEHEVWFEDARSIQAKFNLVKELG
FT                   LRGMSYWKLGLDFPQNWLLLTDNFTVVKK"
FT   gene            26312..26797
FT                   /locus_tag="GY4MC1_0017"
FT   CDS_pept        26312..26797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0017"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gwc:GWCH70_0018 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72873"
FT                   /db_xref="GOA:A0A0F6BHH2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH2"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADP72873.1"
FT                   /translation="MVNDEYYMRLAIEEAKQAEQIGEVPIGAIIVQGGNVIARAHNLRE
FT                   TAQRAIAHAEILAIDEACKKAGSWRLEDATLYVTLEPCAMCAGAIVLARIKRVVFGASD
FT                   PKGGCAGTLMNLLQEGRFNHQAEVIGGVLQEECGQMLSNFFRKLREKKKNIGQRSSK"
FT   gene            26953..27061
FT                   /gene="ffs"
FT                   /locus_tag="GY4MC1_R0007"
FT   ncRNA           26953..27061
FT                   /gene="ffs"
FT                   /locus_tag="GY4MC1_R0007"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            27234..28919
FT                   /locus_tag="GY4MC1_0018"
FT   CDS_pept        27234..28919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0018"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   gwc:GWCH70_0019 DNA polymerase III, subunits gamma and tau;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72874"
FT                   /db_xref="GOA:A0A0F6BHH3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH3"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADP72874.1"
FT                   /translation="MTYQALYRVFRPQRFADVVGQEHVTKTLQSALLQNKISHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPTAEPCNECPACIGITNGTIPDVLEIDAASNNRVDEI
FT                   RDIRDKVKFAPTSVRYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   LTIISRCQRFDFRRIPLHSIVARLRHVMEQQGMTASDEALFAIARAADGGMRDALSLLD
FT                   QAISFSDGELLLEDVLAMTGSVSSATLASLIQAVYEKDAATSLRLLEEMMDQGKDPNRL
FT                   MEDLILYYRDLLLYKTAPHVEGAIKGTIVDDTFQHLAESIPLSDIYEAIEVLNKSQQEM
FT                   KWTNHPRIFLEVALVKLCHQQASSTSSSAEEIQSLARKVEYLEAELRRLKEHNESVAAT
FT                   APAQAQKQTRPLKTGGYKTPVGRIHEILKQATHQDLSLIKSHWAEMLDTLKKQHKVSHA
FT                   ALLQESEPVAASPNAFVLKFKYEIHCKMAADNTNYVKDNLEAILFELTKKRFEMVAVPE
FT                   EEWGKIREEFIREKGTKREQEKEEDPLIAEAKRLFGEEIIEIKE"
FT   gene            28942..29268
FT                   /locus_tag="GY4MC1_0019"
FT   CDS_pept        28942..29268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0019"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="PFAM: Uncharacterised protein family UPF0133; KEGG:
FT                   gwc:GWCH70_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72875"
FT                   /db_xref="GOA:A0A0F6BHH4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH4"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADP72875.1"
FT                   /translation="MMRGGMGNMQKMMKQMQKMQKEMQKAQEQLAEKTVEGTAGGGMVT
FT                   VIANGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDALKKADELAAEMMGQFTKGLNI
FT                   PGLF"
FT   gene            29279..29875
FT                   /locus_tag="GY4MC1_0020"
FT   CDS_pept        29279..29875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0020"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: Zinc
FT                   finger C4-type, RecR; TOPRIM domain-containing protein;
FT                   KEGG: gwc:GWCH70_0021 recombination protein RecR; SMART:
FT                   Toprim sub domain-containing protein; Helix-hairpin-helix
FT                   DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72876"
FT                   /db_xref="GOA:A0A0F6BHH5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH5"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADP72876.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLTMKEDTVLEFAK
FT                   ALVDAKRNIRYCTICGHITDTDPCYICKDERRDRTTICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLKRLQDEAVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   gene            29893..30117
FT                   /locus_tag="GY4MC1_0021"
FT   CDS_pept        29893..30117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0021"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508; KEGG:
FT                   gwc:GWCH70_0022 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72877"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH6"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ADP72877.1"
FT                   /translation="MLWRRKGWLKKQFDLKLIEQLQAARDEWYGQKQLIEKSVEPSEEV
FT                   LMTLHVAEAKYFFLMREAKYRRVSLKGVK"
FT   gene            30196..30462
FT                   /locus_tag="GY4MC1_0022"
FT   CDS_pept        30196..30462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0022"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: gwc:GWCH70_0023 pro-sigmaK processing
FT                   inhibitor BofA; TIGRFAM: pro-sigmaK processing inhibitor
FT                   BofA; PFAM: sigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72878"
FT                   /db_xref="GOA:A0A0F6BHH7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH7"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADP72878.1"
FT                   /translation="MEQKFAVVLSLSMIIILLLVGARLKTLKFLGYGMIKLIVGALVLF
FT                   VINAVGGTFHVHIPINFITALICGFLGIPGAAALIIIDKYIVM"
FT   gene            30823..32369
FT                   /locus_tag="GY4MC1_R0008"
FT   rRNA            30823..32369
FT                   /locus_tag="GY4MC1_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            32484..32557
FT                   /locus_tag="GY4MC1_R0009"
FT                   /note="tRNA-Ile2"
FT   tRNA            32484..32557
FT                   /locus_tag="GY4MC1_R0009"
FT                   /product="tRNA-Ile"
FT   gene            32570..32645
FT                   /locus_tag="GY4MC1_R0010"
FT                   /note="tRNA-Ala2"
FT   tRNA            32570..32645
FT                   /locus_tag="GY4MC1_R0010"
FT                   /product="tRNA-Ala"
FT   gene            32825..35752
FT                   /locus_tag="GY4MC1_R0011"
FT   rRNA            32825..35752
FT                   /locus_tag="GY4MC1_R0011"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            35888..36004
FT                   /locus_tag="GY4MC1_R0012"
FT   rRNA            35888..36004
FT                   /locus_tag="GY4MC1_R0012"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 104.04"
FT   gene            36241..37791
FT                   /locus_tag="GY4MC1_0023"
FT   CDS_pept        36241..37791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0023"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72879"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP72879.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
FT   gene            38068..38274
FT                   /locus_tag="GY4MC1_0024"
FT   CDS_pept        38068..38274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0024"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: gwc:GWCH70_0024
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72880"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH9"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ADP72880.1"
FT                   /translation="MGSPITDKDGMEKVCIVCEQPKREGIQICDQFLCFDCERKIVQTD
FT                   TDDPEYSFYVKQLRKIISSKIYS"
FT   gene            38462..39904
FT                   /locus_tag="GY4MC1_0025"
FT   CDS_pept        38462..39904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0025"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   gwc:GWCH70_0025 Orn/Lys/Arg decarboxylase major region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72881"
FT                   /db_xref="GOA:A0A0F6BHI0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI0"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADP72881.1"
FT                   /translation="MDQQRTPLYTALKRHDSIHPFSFHVPGHKYGIVFPKEAKDDYKQL
FT                   LKLDATELSGLDDLHHPESVIAEAQSLAAKLYNVEATFFLVNGSTVGNLAMIFAVCGEK
FT                   KKVIVQRNCHKSIMHALQLVGATPVFLPPEFDEDVRVASYVAYETIKKAIELHQDAAAL
FT                   VLTNPNYYGMAVDLTEVVNIAHRYRIPVLVDEAHGAHFVLGDPFPKTAITCGADVVVQS
FT                   AHKTLPAMTMGSYLHVNSSLIDKEKLKYFLQVFQSSSPSYPIMASLDLARSYLARLTRK
FT                   DIEDIFKQIQQLKDALDEIEGIAVVHSQHPFVKTDLLKITIQTRSQLSGYELQQRLEQE
FT                   GIFAELADPFNVLLVYPLAVVERLEEVIKKVKRAFHGLSYSEELLHSFRAFSFSASSAA
FT                   ISYKELQTLPKKVIDLEKAEGFIAAETITPYPPGVPLLFIGERISREHIEQIKRLKSYH
FT                   ARFQGGKFLSSDQIEVYSTSKK"
FT   gene            39919..40551
FT                   /locus_tag="GY4MC1_0026"
FT   CDS_pept        39919..40551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0026"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: gwc:GWCH70_0026
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72882"
FT                   /db_xref="GOA:A0A0F6BHI1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI1"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADP72882.1"
FT                   /translation="MKGRFFSFEGPEGAGKTTMIAMLESFLREKGFDVLATREPGGVRI
FT                   AEEIRSIILNPAHTEMDGRTEALLYAAARRQHLLEKIIPAVKSGKIVLCDRFIDSSLAY
FT                   QGFARELGMDEILQINQFAIDGYFPTLTIYFDIDPKMGLERIQKNKQREMNRLDMENLS
FT                   FHYKVREGYLKLAKRFSDRIITIDASKSVDEVFAMTVAAIMDRIGER"
FT   gene            40637..41629
FT                   /locus_tag="GY4MC1_0027"
FT   CDS_pept        40637..41629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0027"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: gwc:GWCH70_0027 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72883"
FT                   /db_xref="GOA:A0A0F6BHI2"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI2"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADP72883.1"
FT                   /translation="MAMEWEQLERYQPAVVKMLTKSLEKGRISHAYLFEGQRGTGKKAM
FT                   SLLLAKSLFCLNRSGIKPCNECRNCRRIDSGNHPDVHIIEPDGQSVKKEQIEMLQQEFT
FT                   KTAVESDRKLYIIEHADKMTTNAANSLLKFLEEPRPGTVAILLTEQYHRMLETIISRCQ
FT                   VFSFKPIPPALLANYLEKQQIPPHIAFLAAHVTNNYEEALQLSRDDWFAQARKIVLQLY
FT                   ETLKKNDLQALFFVHDQWLPHFQEKPQIDLGLDLLLYIYKDMLHIQLGQVEQIIYRDRL
FT                   DDLRQWSLSCPQRQIVKSMEMILRAKARLNTTNMSVQLLMEQLILDLKE"
FT   gene            41645..42472
FT                   /locus_tag="GY4MC1_0028"
FT   CDS_pept        41645..42472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0028"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: gwc:GWCH70_0028
FT                   PSP1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72884"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI3"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADP72884.1"
FT                   /translation="MYNVVGVRFKKAGKIYYFDPGELTIPVGEFVIVETVRGIEYGKVV
FT                   ISNKQVDENDIVLPLKKVIRVADGKDKLIVEENKKAAREAYDICLKKVEEHGLEMKLVD
FT                   VEYTFDRNKVIFYFTADGRVDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDL
FT                   GEYVKTPHGLGKVIGLNILERVLQVELPEYGRVVEYTLDELMKDGTLPVQATD"
FT   gene            42488..42853
FT                   /locus_tag="GY4MC1_0029"
FT   CDS_pept        42488..42853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0029"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   gwc:GWCH70_0029 protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72885"
FT                   /db_xref="GOA:A0A0F6BHI4"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI4"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ADP72885.1"
FT                   /translation="MDKKEIFQSVTGMEEQLSHLYRQLVQLKEYVAELLEENHHLQIEN
FT                   DHLRRRLEQMSGELEEEKRKEKDHKHSHERRLIDIGEGYDNLARLYQEGFHICHVHYGS
FT                   VRKEGDCLFCLSFLNKK"
FT   gene            42903..43652
FT                   /locus_tag="GY4MC1_0030"
FT   CDS_pept        42903..43652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0030"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gwc:GWCH70_0030
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72886"
FT                   /db_xref="GOA:A0A0F6BHI5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI5"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADP72886.1"
FT                   /translation="MVELYDDERLDYLLHEEIRIIQSPSVFAFSLDAVLLAKFAYMPIQ
FT                   KGLIVDLCTGNGVIPLLLSMRTKGKIIGVEIQERLCDMAKRSVKYNGLEKQIEIIHGDI
FT                   KDAPKQLGYSKYDVVTCNPPYFPTISKEEMNKNVHLAIARHEIYCTLEDVVRVSSQLLK
FT                   QGGKAAFVHRPGRLLDIITLMREYRLEPKRLRFVYPKAGKEANTILIEGIKDGNPDLKI
FT                   LPPLIVYNDDNEYTDEVKQLLYGIIPS"
FT   gene            43667..44545
FT                   /locus_tag="GY4MC1_0031"
FT   CDS_pept        43667..44545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0031"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: gwc:GWCH70_0031
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72887"
FT                   /db_xref="GOA:A0A0F6BHI6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI6"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADP72887.1"
FT                   /translation="MLWQQKSFEDNHKGTLYIVPTPIGNLEDMTFRAVRILQEVDMIAA
FT                   EDTRQTKKLLNHFQIRTPLISYHEHNKYTSGPQIVERLKAGESVALVSDAGMPGISDPG
FT                   HELVVSALEERCPVVPLPGANAALTALVASGLSTNHFYFFGFLERTKKEKKEQLESLKK
FT                   IRETMIFYEAPHRMQETLMMMHEVFGERRVVLCRELTKRFEEFIRGNLSEIVEWVSIHE
FT                   IRGEFCIVVEGAKETQEDEKTEAWWHSLTPVEHVEYYIREKNFTTKEAIKQTAKDRNMS
FT                   KREVYRQYHRQ"
FT   gene            complement(44577..44879)
FT                   /locus_tag="GY4MC1_0032"
FT   CDS_pept        complement(44577..44879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0032"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: gwc:GWCH70_0032 transcriptional regulator,
FT                   AbrB family; TIGRFAM: transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72888"
FT                   /db_xref="GOA:A0A0F6BHI7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI7"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADP72888.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDIAEKDALEIYVDDDRIIL
FT                   KKYKPNMTCVVTGEVSDDNFKLAGGKIILSREGAEILLKEIQEHLQQSSNNDNNK"
FT   gene            45312..47258
FT                   /locus_tag="GY4MC1_0033"
FT   CDS_pept        45312..47258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0033"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0033 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72889"
FT                   /db_xref="GOA:A0A0F6BHI8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI8"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADP72889.1"
FT                   /translation="MEKKTFYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGYDVM
FT                   YLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQDRHKKV
FT                   VEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFK
FT                   MSKYVDRLLQYYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKH
FT                   VIYVWIDALTNYITALGYGTDDDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALDLP
FT                   LPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPE
FT                   GFVERINYDLANDLGNLLHRTVAMIEKYFDGVIPTYRGAKTPFDNDLVETAKETVKQYE
FT                   EAMEKMEFSVALATVWQLINRTNKYIDETQPWVLAKEESQKEQLASVMTHLAESLRHVA
FT                   ILLQPFLTRTPDKIFAQLGIVDESLKQWDSLYEFGLIKEGTKVAKGDPLFPRLDIEKEV
FT                   EYIKAHMQGSAPKKQAAEPQAPKADEITIDDFAKVDLRVAEVVHAEPVKNADKLLKLQL
FT                   DLGYEKRQVVSGIAQFYKPEELVGKKVICVTNLKPVKLRGELSQGMILAGEENGTLSVA
FT                   TVDKTIPNGTKIK"
FT   gene            47402..48172
FT                   /locus_tag="GY4MC1_0034"
FT   CDS_pept        47402..48172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0034"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: gwc:GWCH70_0034 hydrolase, TatD family;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72890"
FT                   /db_xref="GOA:A0A0F6BHI9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI9"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADP72890.1"
FT                   /translation="MLFDTHAHLNAVQYNDDLQEVIDRALGEGVSHIVVVGFDRPTIAR
FT                   AVELAEQYDFIYASVGWHPVDAIDMTDEDLDMIAELAAHPKVVALGEMGLDYYWDKSPK
FT                   EIQHEVFRRQIALAKKVKLPIIIHNREATADILRILKEENAAEVGGIMHCFSGSVEVAK
FT                   QCIEMNFLISLGGPVTFKNAKKPKEVAAQIPLEHLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KYVAEAIAEIKGISFEEVAKATTENAKKLFGIHR"
FT   gene            48260..48403
FT                   /locus_tag="GY4MC1_0035"
FT   CDS_pept        48260..48403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP72891.1"
FT                   /translation="MSTSLPFFFSDFSCIIECVYTYTFRERGIFAQEGGVLHDITQYEE
FT                   NF"
FT   gene            48372..49574
FT                   /locus_tag="GY4MC1_0036"
FT   CDS_pept        48372..49574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0036"
FT                   /product="G5 domain protein"
FT                   /note="PFAM: G5 domain protein; 3D domain-containing
FT                   protein; protein of unknown function DUF348; KEGG:
FT                   gwc:GWCH70_0035 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72892"
FT                   /db_xref="GOA:A0A0F6BHJ1"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ1"
FT                   /inference="protein motif:PFAM:PF07501"
FT                   /protein_id="ADP72892.1"
FT                   /translation="MILPNMKRISDSLRKNFTVTASSFIAFSATTGLAGYEIAKDDVTL
FT                   TVNGKKQEIRTHAKTVKEVLQEQNIKPRKEDHVYPSLDTPITDDLNIVWEASKKVTLIV
FT                   DGKKQEIWTTAKNVGELLNSQHITLGKHDKIAPSPNAEIKKGMEVNVEKAFPVQLNVGG
FT                   KQKQVWATSTTVADFLKQQNVKLGELDRVEPSLQEKVKEGMIVKVVKVQKVTDVVEEPI
FT                   DFAVVTRRDAQLPKGEQRVISPGEKGKALKRYEVVLENGKEVSRKLIETKLMKASKNRI
FT                   VAIGTRSTHARPVQIASRGQRHATKEFYVTATAYTAYCEGCSGTTSTGIDLRANPSAKV
FT                   IAVDPRIIPIGSKVYVEGYGYAIAGDTGSSINGYKIDVFFPKKSDAFRWGKKRVKVKII
FT                   Q"
FT   sig_peptide     48372..48476
FT                   /locus_tag="GY4MC1_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.275 at
FT                   residue 35"
FT   gene            49795..50367
FT                   /locus_tag="GY4MC1_0037"
FT   CDS_pept        49795..50367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0037"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain-containing protein; KEGG: gwc:GWCH70_0036
FT                   primase/topoisomerase like protein; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72893"
FT                   /db_xref="GOA:A0A0F6BHJ2"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ2"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADP72893.1"
FT                   /translation="MMKIKEIIVVEGKDDTVAIQRAVDADTIETNGSAISEEIIEQIKL
FT                   AKEKRGVIIFTDPDFPGEKIRKTITERVPGCKHAFLPRKAAIAKNGKGIGVEHASVEDI
FT                   RQALKNVYEETAEWNEEITFDELVAAGLIGGQLAKKRRQHLGEILKIGYTNGKQLYKRL
FT                   QIFQISKEAFYAALEQVLQEEANDEYK"
FT   gene            50354..51241
FT                   /locus_tag="GY4MC1_0038"
FT   CDS_pept        50354..51241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0038"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: gwc:GWCH70_0037 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72894"
FT                   /db_xref="GOA:A0A0F6BHJ3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ3"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADP72894.1"
FT                   /translation="MNTNKDIATPGRTREILEKYGFSFKKSLGQNFLIDTNILRKIVDV
FT                   AGLSRETGAIEIGPGIGALTEQLARRAKKVVAFEIDQRLLPILEDTLSPYENVRIIHQD
FT                   VLKADIHRVIAEEFTDAADIMVVANLPYYVTTPIIMKLLTDNLPIRGIVVMLQKEVADR
FT                   ISAQPGTKDYGSLSIAIQYYTEAEKIMTVPRTVFIPQPNVDSAVIRLIKRKQPPVDVDD
FT                   ESFFFQVVRASFAQRRKTILNNLISNLPNGKARKEKIERILTENGIDPRRRGETLTMEE
FT                   FAALSNALREVMCI"
FT   gene            51349..52233
FT                   /locus_tag="GY4MC1_0039"
FT   CDS_pept        51349..52233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0039"
FT                   /product="sporulation peptidase YabG"
FT                   /note="KEGG: gwc:GWCH70_0038 sporulation peptidase YabG;
FT                   TIGRFAM: sporulation peptidase YabG; PFAM: peptidase U57
FT                   YabG"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72895"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ4"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ADP72895.1"
FT                   /translation="MDVKVGDIVARKSYNCDLLFRVIDVKEKNGEREAILHGENVRLIA
FT                   DAPCSDLVIIDEREQQERKKKEIELIEQSYKLFRQDYHAIKQKTEYRATGGYRTEKDFF
FT                   QIPGRVLHLDGDPLYLRKCLDLYERIGVPVYGIFCEESEMPEKVGVLLERFRPDILVIT
FT                   GHDSYSKSKGKVTDLKAYRHSKHFVQTVKEARKKVPHLDQLIIFAGACQSHFESLIRAG
FT                   ANFASSPARVNIHALDPVYIVSRISFTPFMETVNVWDVLRNTLTGEKGLGGVETKGVLR
FT                   TGMPFRLIDTMND"
FT   gene            52425..52682
FT                   /locus_tag="GY4MC1_0040"
FT   CDS_pept        52425..52682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0040"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   gtn:GTNG_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72896"
FT                   /db_xref="GOA:A0A0F6BHJ5"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ5"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADP72896.1"
FT                   /translation="MPKTLSDIKKTLDSNIGRRLTLRANGGRRKTIERCGILAETYPSV
FT                   FVIELDQKENAFERVSFSYADVLTETVKLTFLDDEKVGGQ"
FT   gene            52810..52962
FT                   /locus_tag="GY4MC1_0041"
FT   CDS_pept        52810..52962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0041"
FT                   /product="small acid-soluble spore protein,
FT                   minoralpha/beta-type SASP"
FT                   /note="manually curated; KEGG: gwc:GWCH70_0040 small
FT                   acid-soluble spore protein, minoralpha/beta-type SASP"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72897"
FT                   /db_xref="GOA:A0A0F6BHJ6"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ6"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0040"
FT                   /protein_id="ADP72897.1"
FT                   /translation="MSQRFKEELAKELGFYDVVQKEGWGAIRAKDAGNMVKLAIEMAER
FT                   QLLKR"
FT   gene            53174..54043
FT                   /locus_tag="GY4MC1_0042"
FT   CDS_pept        53174..54043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0042"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="KEGG: gwc:GWCH70_0041
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72898"
FT                   /db_xref="GOA:A0A0F6BHJ7"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ7"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADP72898.1"
FT                   /translation="MKVLVKAPAKINLSLDVLHKRPDGYHEVKMVMTTIDLADRIELIP
FT                   RTDDVIQIISQNRFVPDDHRNLAYQAAKVLKDTFGIKQGVAISITKNIPVAAGLAGGSS
FT                   DAAATLRGLNKLWRLGLTLDELAELGAQIGSDVPFCVYGGTAVATGRGEKIMPISSPPP
FT                   CWVILAKPSIGVSTAEVYRNLKVGEIQHPDVDGMVEAIERQDYAAICQLVGNVLEEVTL
FT                   KMHPEVAHIKEQMKRFGADAVLMSGSGPTVFGLVQHDSRLQRIYNGLRGFCDQVFAVRI
FT                   LGEQNSLD"
FT   gene            54099..54923
FT                   /locus_tag="GY4MC1_0043"
FT   CDS_pept        54099..54923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0043"
FT                   /product="purine operon repressor, PurR"
FT                   /note="KEGG: gwc:GWCH70_0042 purine operon repressor, PurR;
FT                   TIGRFAM: pur operon repressor; PFAM: purine repressor ;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72899"
FT                   /db_xref="GOA:A0A0F6BHJ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ8"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ADP72899.1"
FT                   /translation="MKLRRSGRLVDMTHYLLERPHQLIPLTFFAERYESAKSSISEDLA
FT                   IIKQTFEQQGIGTIKTLPGAAGGVQYIPKMSRQEADGIVTYLCEQLSRPDRLLPGGYLY
FT                   MTDILGDPRVVNKIGRLYASIFADRPVDVVMTIATKGIPLAYAVAHFLYVPVVIVRHDN
FT                   KVTEGSMVSINYVSGSSKRIQTMVLAKRSLAEGANVLIIDDFMKAGGTVNGMINLLNEF
FT                   NAKLSGIGVLVESEETKERLVDEYISLVKLSSVDVKEKQITVKAGNYIHFME"
FT   gene            54950..55324
FT                   /locus_tag="GY4MC1_0044"
FT   CDS_pept        54950..55324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0044"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: gwc:GWCH70_0043 endoribonuclease L-PSP;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72900"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ9"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADP72900.1"
FT                   /translation="MEKVETNNAPQAIGPYSQGIVVNNMFYSSGQIPLTPEGEMVQGDI
FT                   KAQTHQVFQNLKAVLEAAGASLDTVVKTTVFLKSMDDFAAMNEVYSQYFTNHKPARSCV
FT                   EVARLPKDALVEIEVIALIR"
FT   gene            55466..55756
FT                   /locus_tag="GY4MC1_0045"
FT   CDS_pept        55466..55756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0045"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: SpoVG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72901"
FT                   /db_xref="GOA:A0A0F6BHK0"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK0"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADP72901.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
FT   gene            55887..57266
FT                   /locus_tag="GY4MC1_0046"
FT   CDS_pept        55887..57266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0046"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: gwc:GWCH70_0045 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72902"
FT                   /db_xref="GOA:A0A0F6BHK1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK1"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADP72902.1"
FT                   /translation="MVKRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLG
FT                   IEKLITVVGFGAEQVKMQLGDQSEYAFQQEQLGTAHAVMQAASHLHGKDGVTLVVCGDT
FT                   PLITAETMQALLDHHLATKAKATVLTAIADNPAGYGRIVRDSHGNVAKIVEHKDASEQE
FT                   RAIKEINTGTYCFDNKSLFEALTHVSNNNVQGEYYLTDVIEILKSNGGIISAYEAPSFE
FT                   ETIGVNDRAALAEAEKIMRARICRKHMLNGVTIIDPAHTYISAEAQIGRDTVIYPGTVI
FT                   EGKTVIGEDCIIGPNSEIKDCLIGNGTTIRHSVAHDSEIGNDVTIGPFAHIRPLSKIAD
FT                   EVRIGNFVEVKKSVFGKGSKASHLSYIGDAEIGADVNLGCGSITVNYDGKNKHMTKIED
FT                   GAFIGCNVNLIAPVTVGKGAYVAAGSTITDDVPANALSIARARQVNKENYVDRLSIKKN
FT                   S"
FT   gene            57279..58226
FT                   /locus_tag="GY4MC1_0047"
FT   CDS_pept        57279..58226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0047"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   gwc:GWCH70_0046 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72903"
FT                   /db_xref="GOA:A0A0F6BHK2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK2"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADP72903.1"
FT                   /translation="MSECHHNLKLFALNSNMKLAEEIAQVMGIELGKCSVSRFSDGEIQ
FT                   INIEESIRGDDVFVIQSTSVPVNEHLMELLIMIDALKRASAKTINIVMPYYGYARQDRK
FT                   ARSREPITAKLVANLLETAGASRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFKNKN
FT                   LDDIVVVSPDHGGVTRTRKLADRLKAPIAIIDKRRPKPNVAEVMNIVGQVQGKTAILID
FT                   DIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAIERIQNSKIKELVVTNTIALPE
FT                   EKKIDKIVELSVAPLIAEAITRVYEMKSVSVLFD"
FT   gene            58308..58940
FT                   /locus_tag="GY4MC1_0048"
FT   CDS_pept        58308..58940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0048"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: gwc:GWCH70_0047 ribosomal 5S rRNA E-loop
FT                   binding protein Ctc/L25/TL5; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72904"
FT                   /db_xref="GOA:A0A0F6BHK3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK3"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADP72904.1"
FT                   /translation="MAVVLEAKERTDRKHSTTRRIRLQGNIPGILYGKNVENKMIFVNG
FT                   SDFQKTIREAGRHSLITLKLNDEEYSVLLRDVQRDSLRGNILHVDFQAVDMSTEVDIDV
FT                   DIRFIGEAAGVKDGGVLQQNLHQLSIRVLPANIPPSIDIDISHLQIGDTITVGDVKTDG
FT                   KYEINHEPSEVIATILPPQQEEEIHSGEQQESGRPEAEEGRETTPDA"
FT   gene            59003..59566
FT                   /locus_tag="GY4MC1_0049"
FT   CDS_pept        59003..59566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0049"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   gwc:GWCH70_0048 peptidyl-tRNA hydrolase; PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72905"
FT                   /db_xref="GOA:A0A0F6BHK4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK4"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADP72905.1"
FT                   /translation="MLKLFVGLGNPGKEYEQTRHNVGFMVIDELAKRWNISFQTAKFNG
FT                   MIASHIISGEKVILCKPLTYMNLSGECVRPLIDYYRIDINDVVVIYDDLDLPVGKIRLR
FT                   MKGSAGGHNGIKSLIHHLGTQEFKRIRIGIGRPASGEKVIDYVLGRFHEEESGAIMEAI
FT                   LRSADACEKAVTEPFLQVMNEFNV"
FT   gene            59627..59857
FT                   /locus_tag="GY4MC1_0050"
FT   CDS_pept        59627..59857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0050"
FT                   /product="Uncharacterized protein family YabK"
FT                   /note="PFAM: Uncharacterised protein family YabK; KEGG:
FT                   gwc:GWCH70_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72906"
FT                   /db_xref="GOA:A0A0F6BHK5"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK5"
FT                   /inference="protein motif:PFAM:PF10955"
FT                   /protein_id="ADP72906.1"
FT                   /translation="MALHYYCRHCGTKVGTIDRVSIYSEQLGFHHLTEEERLEMIAYQP
FT                   NGDIHIKTICEDCQEALARNPELHQYEKFIH"
FT   gene            59991..63524
FT                   /locus_tag="GY4MC1_0051"
FT   CDS_pept        59991..63524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0051"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; TRCF domain protein;
FT                   KEGG: gwc:GWCH70_0050 transcription-repair coupling factor;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72907"
FT                   /db_xref="GOA:A0A0F6BHK6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK6"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADP72907.1"
FT                   /translation="MRSLHRYFAENQDIRSIIGGIEAGLKEQLIVGLSGSARSVFISSL
FT                   YKETDRPLLVITHNLFQAQKIYDDLVQLLGTEEVFLYPVNEVIATELAIASPELKAQRL
FT                   EVMNYWTKRDKGVVICPVAGLRRLLPPVSLWKNNILTLEVQQNIDVEYCKKQFVQMGYK
FT                   RVATVSAPGEFSVRGGIIDIYPLTAELPYRIELFDTEIESIRTFTADDQRSRDEVRQIT
FT                   IGPADEMIVYGEMLERGIARIEAGLTESLHKLKDEKAKQLLLEHISSELEQLKQGQEIE
FT                   QQYKYMALFYEEPASLLDYMPENGILLMDEMSRLQEAAESLDKEEAEWYTSLLSEGKII
FT                   HDVPISHSFSQLLQKHRKQRIYLSIFLRHVPHTRPENIVNISCKQMQNFHGQMSLLKSE
FT                   LERWKKAKYAVVFLTPNAERMKKLQSVLEDYEIDVAPLNREAVLMHGKYQMIEGDLNTG
FT                   FELPMQKLAVITEEELFKKRVKRPIRRQKLSNAERIKSYSELRVGDYVVHVNHGIGKYL
FT                   GIETLEINGVHKDYIHIQYQGSDTLYVPVDQIDQVQKYVGSEGKEPKIYKLGGSEWKKV
FT                   KKKVESSVQDIAEDLIKLYAEREASKGYAFSPDTEMQREFEAAFPYQETEDQLRSIEEI
FT                   KRDMESDKPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRE
FT                   RFQGFPITVGLLNRFRTRKQQAETIKGLKDGTIDMVIGTHRLLSKDVQFKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANIDVLTLTATPIPRTLHMSMIGVRDLSIIETPPENRFPVQTY
FT                   VMEYTPELVREAIERELAREGQVFFLYNHIEDIDVKAEEISQLVPEARVTYVHGRMSET
FT                   ELESTMLAFLEGQYDVLVTTTIIETGVDIPNVNTLIVYDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLNEAAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNILGAEQHGF
FT                   IDSVGFDLYSQMLKEAIEKRKGVKQEEAKHEITIDLEVDAYIPDTYISDGLQKIDMYKR
FT                   FKAVETMEDVEMLREEMLDRFGEYPDEVAYLFQIAEIKVYAKQTGVEVIKQQKQQVDIL
FT                   FAENASKEVEIQRLSKIGGQYGRLFGFGMDGSKLKIVLYIKDLKPQEWLMILYETLKEL
FT                   SGVKDEKSIIA"
FT   gene            63716..64252
FT                   /locus_tag="GY4MC1_0052"
FT   CDS_pept        63716..64252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0052"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: gwc:GWCH70_0051 transcriptional regulator,
FT                   AbrB family; TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72908"
FT                   /db_xref="GOA:A0A0F6BHK7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK7"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ADP72908.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALFDSLGQPVLICDRDVFIAVAGVSKKEYLNKNVGPLVEK
FT                   AMEERNSVLHTEEGEAELVDGVSETWKSYTIGPIVANGDPIGAVVILSKDKVLGEVEHK
FT                   AVETAASFLARQMEQ"
FT   gene            64557..66146
FT                   /locus_tag="GY4MC1_0053"
FT   CDS_pept        64557..66146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0053"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   gwc:GWCH70_0052 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72909"
FT                   /db_xref="GOA:A0A0F6BHK8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK8"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADP72909.1"
FT                   /translation="MRSPEEKIWKGAVILTIAAFVTKLLSAFYRVPYQNIVGDVGFYIY
FT                   QQVYPIYGIVMSLALYGYPIVISKLVAERVADRDQQGVVSVLLASLLFLCLFGLLLFSV
FT                   LYIGAQQVAIWMGDAELTPLVRLLSFSFLLFPFIALLRGYFQGKNNMLPTAVSQVGEQL
FT                   VRVITIILLSYLFIKGGRTVYDAGAAAVFGSLAGGLTALLLLTAYWLRRANRGKIYITW
FT                   KSGEAKRIISYLLIEGFIICVTNMVLTLTQLVDSFSVLPLLVESGKESFEQAKIWKGIY
FT                   DRGQPLIQLGTVVATSFSLALVPLISGAKKREDGQFIREKTDLSLRIATVIGLGASLGL
FT                   ICLIRPVNVMLFENDLGSLSLAILAASIFFTTLALTLSALLQGMGQEWTAVAGVCIAVA
FT                   GKAVCNWLLIPSFGTAGAAAATTLSYAAMSCFLYVMLRRKLHVRFPKKTYWYPVIKAAA
FT                   TMVVVLQLYTLLAETLGSGRLFAAGEAVAGVLLGGVTYIIIILKGNVFSQQELTFFPFG
FT                   DKLCLLWKTGDR"
FT   gene            66146..67609
FT                   /locus_tag="GY4MC1_0054"
FT   CDS_pept        66146..67609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0054"
FT                   /product="MazG family protein"
FT                   /note="KEGG: gwc:GWCH70_0053 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72910"
FT                   /db_xref="GOA:A0A0F6BHK9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK9"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADP72910.1"
FT                   /translation="MNTIYVFGLGAGDIEQLPLGVYRKLKTASPLFLRTKEHPVVHALQ
FT                   AEGVSFTSFDAIYEKHERFEDVYEEMAAILLEQAQKNDVFYAVPGHPLVAEKTVQLLLE
FT                   AERRKQCRVVIEGGQSFLDALFTTLKIDPIEGFQLIDATSFQGDEWQLTNHTIFCQVYD
FT                   SFIASEVKLTLMEQLPDDYPVYIVTAAGSKEEKVMEVPLYELDRATVLNNLTSVYVPPV
FT                   REETMLYHRFETLRRVIATLRGPNGCPWDRKQTHESLKRYLLEETYELFEAIDENDDEH
FT                   MVEELGDVLLQVMLHAQIGEDEGMFSIDDVIRGITEKMIRRHPHVFGDVTVENAEQVVE
FT                   NWQRIKEKEKQDRADSLLDDVPKSLPNILRAYEFQKKAAKVGFDWDDVKPMWEKVEEEM
FT                   AEFKREALGEKTVRSRLISEFGDILFALINVARYYGINPEEALHATNQKFYRRFSYIEE
FT                   QARKNGVALTSLSLAELDRFWEEAKEKGW"
FT   gene            67624..67896
FT                   /locus_tag="GY4MC1_0055"
FT   CDS_pept        67624..67896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0055"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: gwc:GWCH70_0054 RNA-binding S4 domain protein;
FT                   PFAM: RNA-binding S4 domain protein; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72911"
FT                   /db_xref="GOA:A0A0F6BHL0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL0"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADP72911.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRITINGAVAKASSTVRVGD
FT                   ELTIQFGQKKLTVKVTDLKETTKKEEAANLYEVIREERIDAGTEE"
FT   gene            68012..68317
FT                   /locus_tag="GY4MC1_0056"
FT   CDS_pept        68012..68317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0056"
FT                   /product="sporulation protein YabP"
FT                   /note="KEGG: gwc:GWCH70_0055 sporulation protein YabP;
FT                   TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72912"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL1"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ADP72912.1"
FT                   /translation="MSQHYDFGGNTNKGPVQEHDVIMRGRRLLDITGVKQVESFDNEEF
FT                   LLETVMGFLSIRGQNLQMKNLDVDKGVVSIKGRIFDLVYLDDHQEKAKGFFSKLFK"
FT   gene            68314..68925
FT                   /locus_tag="GY4MC1_0057"
FT   CDS_pept        68314..68925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0057"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="KEGG: gwc:GWCH70_0056 spore cortex biosynthesis
FT                   protein YabQ; TIGRFAM: spore cortex biosynthesis protein
FT                   YabQ; PFAM: Spore cortex biosynthesis protein, YabQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72913"
FT                   /db_xref="GOA:A0A0F6BHL2"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL2"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ADP72913.1"
FT                   /translation="MSVTTQLATMLAMIGMGSWLGAALDTYNRFLQRQNRKHWVVFIND
FT                   VLFWIVQGLIIFYVLLLVNEGELRFYIFLAVLCGYAAYQSLFRMIYLRVLEWVISLAVR
FT                   LYRFFIRLCYYLIVRPVQLLLQTLLMLSLFIWNVFLFVLRILYQCVKILFAPVRWIGFM
FT                   VWRRIPQNWKKTLKNFFRYLAGIIRPVKNMIVKWVLKWRK"
FT   sig_peptide     68314..68385
FT                   /locus_tag="GY4MC1_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.637) with cleavage site probability 0.395 at
FT                   residue 24"
FT   gene            68944..69351
FT                   /locus_tag="GY4MC1_0058"
FT   CDS_pept        68944..69351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0058"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   gwc:GWCH70_0057 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72914"
FT                   /db_xref="GOA:A0A0F6BHL3"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL3"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADP72914.1"
FT                   /translation="MNVPHRTNVTKLQSSYISAQEEKRTKASKRRKIAIVRFAFFGILL
FT                   AALSSIFFYTLHSQSQDIEAKLADKKRMEQQLDKLEKQQKQLEEEIKKLHDDEYIAELA
FT                   RKKYYLSKEGEIIFVVPEKNSPPYDAGKFGH"
FT   sig_peptide     68944..69126
FT                   /locus_tag="GY4MC1_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.792 at
FT                   residue 61"
FT   gene            69430..69828
FT                   /locus_tag="GY4MC1_0059"
FT   CDS_pept        69430..69828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0059"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gwc:GWCH70_0058 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72915"
FT                   /db_xref="GOA:A0A0F6BHL4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL4"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADP72915.1"
FT                   /translation="MSIEVGSKLQGKVTGITKFGAFVELPEGVTGLVHISEVADNYVKD
FT                   INDHLKVGDVVHVKVINVEKDGRIGLSIKKAKDTQPSQRSRYKANDRAAKDSLEQKISR
FT                   FLKESEDRLASLRRHMESKRGGRGARRG"
FT   gene            70219..70295
FT                   /locus_tag="GY4MC1_R0013"
FT                   /note="tRNA-Met1"
FT   tRNA            70219..70295
FT                   /locus_tag="GY4MC1_R0013"
FT                   /product="tRNA-Met"
FT   gene            70302..70376
FT                   /locus_tag="GY4MC1_R0014"
FT                   /note="tRNA-Glu1"
FT   tRNA            70302..70376
FT                   /locus_tag="GY4MC1_R0014"
FT                   /product="tRNA-Glu"
FT   gene            70511..72061
FT                   /locus_tag="GY4MC1_0060"
FT   CDS_pept        70511..72061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0060"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72916"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP72916.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
FT   gene            72332..74809
FT                   /locus_tag="GY4MC1_0061"
FT   CDS_pept        72332..74809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0061"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="SMART: protein phosphatase 2C domain protein;
FT                   TIGRFAM: stage II sporulation protein E; KEGG:
FT                   gwc:GWCH70_0059 stage II sporulation protein E, protein
FT                   serine/threonine phosphatase; PFAM: Stage II sporulation
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72917"
FT                   /db_xref="GOA:A0A0F6BHL6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ADP72917.1"
FT                   /translation="MERVEKRWMNRISEMSINETQAVLSRWVRHVKLRIGHLFIHKGFL
FT                   LFIIGFLLGRALILSKLTPFALPFFAAVYMLRRDKAALAFVALLAGSLTLSLTTTLFIF
FT                   IGIFSFLIVNAFLRKFFSESIKIVPLIIFCLSFFAKLAILRYFLKNETLYEAVMAFVEA
FT                   GLAFVLTLIFIQSIPLLAVRKHKQALRAEEIISLIILIASMLTGMIGWTFYGLSLEHVM
FT                   SRYLVLIFALVAGATIGPTVGVVTGLILSLANVGNLYEMSLLAFAGLLGGLLKEGKKAG
FT                   ASFGLLVATLLIGLYGNGKAEIVPTVMESCLAIILFICTPRSLTETIAKHIPGTVEYAN
FT                   EQQQYARKIRDVTAQRVSQFSHVFQALANSFSTDSFTSSEDYNEREIDYFLSDIAGKTC
FT                   QTCFKKEQCWSAHFDTTYEYMKKIMLEADAGKLEHNRKLLREWDRHCVKANKVVGMIEK
FT                   DVTLYRANRKVRKQMNESRKMVAEQLLGVSQVMEDFAKEIQRERENHYLQEEQIFHALQ
FT                   EFGIEIGHIDIYSLEKGNIDIEMSVPYCEGRGECEKLIAPMLSDILGETIVVKREECAV
FT                   YPNGYCRVAFGSARAFVVETGVAFAAKGGGLVSGDSYSMIELGTGKYAIAISDGMGNGE
FT                   RAHHESNETLRLLQKILQTGMDESIAIKSVNSILSLRTTEDMFSTLDLAMIDLQNAVTK
FT                   FLKIGSAPSFIKRGDKVMKIEASNLPIGIIKEVEFEIVSEQLKAGDLLIMMSDGVFEGP
FT                   PHVENHDLWMKRKIKELKTNDPQAVADLIMEEVIRSRSGRIEDDMTVVVAKINHNTPKW
FT                   ATIPAYMYTKKAQ"
FT   gene            74872..75606
FT                   /locus_tag="GY4MC1_0062"
FT   CDS_pept        74872..75606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0062"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   gwc:GWCH70_0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72918"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL7"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADP72918.1"
FT                   /translation="MSRGTLRQILLITDGCSNHGEDPIAMAALAKEQGITVNVIGVLDQ
FT                   DTIDESGLREIEGIALSGGGISQVVYAKQLSQTVQMVTRKAMTQTLQGVVNKELKQILG
FT                   SDVSLENLPPEKRGEVMEVVDELGETVELEVLILIDTSGSMKTKLPTVKEALLDLSLSL
FT                   NARIGDNRFAVFVFPGKRGNVEKIVDWTPEIEELSTVFPKLTSGGLTPTGPALREALTY
FT                   FERKRSLRSLIRDDESYFEGSM"
FT   gene            75575..76552
FT                   /locus_tag="GY4MC1_0063"
FT   CDS_pept        75575..76552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0063"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: gwc:GWCH70_0061 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72919"
FT                   /db_xref="GOA:A0A0F6BHL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP72919.1"
FT                   /translation="MMNHTLKGLCNLPAGTVITGKWHHQSYKLLKPLGHGANGAVYLAE
FT                   SAKGIVALKLSDNSEAVTSEVNVLRRFSKVQGVALGPSLLDVDDWAAPLMKKHISFYVM
FT                   EYIRGEDFSTFIRKHGKEWVAILLLQLLSVLDKLHQEGWVFGDLKPENLLITGPPPTVR
FT                   LLDVGGTTLQGRAVKEFTELYDRGYWGVGSRKAEPSYDLFAVAIIMIQSCCPIKLERKG
FT                   DGRRQLISIIQADVMLRKYQTVLMKAIDGKYKRASEMKQDLLAAIGRPDHSHSKQRASQ
FT                   KTVQKSRRSKQRKRGKARGVLETALIIAVLLCAYAVYVYHQVLP"
FT   gene            76672..78060
FT                   /locus_tag="GY4MC1_0064"
FT   CDS_pept        76672..78060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0064"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: gwc:GWCH70_0062 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; Protein of unkown function DUF1946 PP-loop
FT                   ATpase; tRNA(Ile)-lysidine synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72920"
FT                   /db_xref="GOA:A0A0F6BHL9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL9"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADP72920.1"
FT                   /translation="MIAEVCEFIKKHELLTPDSTVIVGVSGGPDSLALLHFFWSIRQKW
FT                   NITLIAAHVDHMFRGKQSEEDMNFVKHFCQTRGIICEAAQIDVPAFQRQHKLGVQEAAR
FT                   QCRYRFFGELMEKYKADYLALGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGGYI
FT                   IRPFLAISRAHIDAYCEKHQITPRHDASNDKDDYTRNRFRHHVIPFLKKENPRLHERFQ
FT                   SYSEMAIEDELFLEELAEDAIKKVIKKQEDAIALKIKPFQAMPKPLQRRGIQLILNYLY
FT                   KEIPSSLSSVHIHNLLAFLSRSHPSGRLDLPHGLKVVRSYDCCLLTFRKEKEDVSYAFK
FT                   LDIPAVLPLPNNHVIISENWEHYPKELRGNDVFIIDPEAVRFPLRVRTRRAGDRMTLKG
FT                   TKGTKKIKEIFIEAKIPLSERERWPIVEDGEGNILWVPKLKKSNFEATDVTKAHYIVLH
FT                   YKEQ"
FT   gene            78080..78625
FT                   /locus_tag="GY4MC1_0065"
FT   CDS_pept        78080..78625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0065"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: gwc:GWCH70_0063 hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72921"
FT                   /db_xref="GOA:A0A0F6BHM0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM0"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADP72921.1"
FT                   /translation="MGMKDDIQKILITEQQIQEKVKELGKLLTEEYEGRFPLAVGVLKG
FT                   AMPFMADLLKHIDTYLEMDFMDVSSYGNATVSSGEVKILKDLNTSVEGRDILIIEDIID
FT                   SGLTLSYLVDLFRYRKANSIKIVTLLDKPSGRKANIQADYTGFIVPDEFVVGYGLDYCE
FT                   KYRNLPYIGVLKPEVYNK"
FT   gene            78721..80625
FT                   /locus_tag="GY4MC1_0066"
FT   CDS_pept        78721..80625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0066"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: gwc:GWCH70_0064 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72922"
FT                   /db_xref="GOA:A0A0F6BHM1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM1"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADP72922.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFFNGSNQRTEPMTYDAFITHLE
FT                   NGDVKSFSMKPERGVYEIRGQLKSYSEDQYFSTYVMNSDTVLNRIDAAAQRTRVEVMPA
FT                   DETSGWVTFFTSIIPFVIILILFFFLLNQAQGGGSRVMNFGKSRAKLYTDDKRKVRFRD
FT                   VAGADEEKQELVEIVEFLKDPRKFVELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFSGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKTIAMRTPGFSGADLENLLNEAALVAARRNKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERRIVAYHEAGHTVIGMVLDDAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELMDKITGLLGGRVAEEIVFNEVSTGAHNDFQRATNIARRMVTEFGM
FT                   SEKLGPLQFGQPSGQVFLGRDLHNEQNYSDKIAYEIDLEIQRIIKECYEKAKNILTQYR
FT                   DKLELIATTLLEVETLDAEQIKHLFEHGTLPNRDASNGNNDNGDQDSDVKINIQKKDE"
FT   gene            80721..81494
FT                   /locus_tag="GY4MC1_0067"
FT   CDS_pept        80721..81494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0067"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   KEGG: gwc:GWCH70_0065 putative transcriptional acitvator,
FT                   Baf family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72923"
FT                   /db_xref="GOA:A0A0F6BHM2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM2"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADP72923.1"
FT                   /translation="MIFVLDVGNTNTVLGVYDGDELKHHWRIETSRGKTEDEYGMLIKA
FT                   LLNHVGLQFSDIDGIIISSVVPPIMFALERMCLKYFHIKPIIVGPGIKTGLDIKYDNPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEHKQYMGGAIAPGIMISTEALFA
FT                   RAAKLPRIEIARPDDIIGKNTVSAMQAGILYGYVGQVEGIVARMKAKSPVPPKVIATGG
FT                   LASLIASESDVIDIVDPFLTLTGLKILYEKNVDKK"
FT   gene            81512..82402
FT                   /locus_tag="GY4MC1_0068"
FT   CDS_pept        81512..82402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0068"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gwc:GWCH70_0066 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72924"
FT                   /db_xref="GOA:A0A0F6BHM3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM3"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADP72924.1"
FT                   /translation="MSDYLVKALAYDGQVRAYAARTTDTVSEAQRRHQTWPTASAALGR
FT                   AITAGVMMGAMLKGDDKLTIKIDGGGPIGTILVDSNAKGEVRGYVTNPHVHFDLNEHGK
FT                   LDVAKAVGTNGMLTVVKDLGLRDFFTGQVPIVSGELGEDFTYYFASSEQVPSSVGVGVL
FT                   VNPDNTILAAGGFIIQLMPGTEEKTIDEIEKRLRTIPPVSKMVESGLTPEEILEELLGK
FT                   GNVKVLETIPVAFVCRCSRERIADALISLGAQEIQDIIDKEGYAEASCHFCNETYHFSK
FT                   EELQQLKQLADAKEE"
FT   gene            82498..83424
FT                   /locus_tag="GY4MC1_0069"
FT   CDS_pept        82498..83424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0069"
FT                   /product="cysteine synthase"
FT                   /note="KEGG: gwc:GWCH70_0067 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase; cysteine synthase A; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72925"
FT                   /db_xref="GOA:A0A0F6BHM4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM4"
FT                   /inference="protein motif:TFAM:TIGR01136"
FT                   /protein_id="ADP72925.1"
FT                   /translation="MARTVNSVTELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVK
FT                   DRIALAMIEAAEKEGKIKPGDTIVEPTSGNTGIGLAMVAAAKGYKAILVMPDTMSLERR
FT                   NLLRAYGAELVLTPGSQGMRGAIAKAEELVKEHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFIAGVGTGGTITGAGQVLREKYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKIAKQL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFDE"
FT   gene            83542..84957
FT                   /locus_tag="GY4MC1_0070"
FT   CDS_pept        83542..84957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0070"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   KEGG: gtn:GTNG_0066 P-aminobenzoate synthase; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72926"
FT                   /db_xref="GOA:A0A0F6BHM5"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM5"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADP72926.1"
FT                   /translation="MRKWGNRKRRTLPYSNRDWFRQYKALAAHEPYHVLLESGQGGRYS
FT                   IIGLTPAGVIQAKENQLFISYHGETKWYEGNPLLSLKQWFAQFPLHFSKSELPFQGGAI
FT                   GYISYDCARYIEKIPSYAQDDLQLPSMYFLIFDDVFVYDHQKQLLHMIVHYADGEELEA
FT                   ERRLSFYESRWLEAEQCEGEWMFQKQDANPSVSMTKADFVEAVQKVQQYIAQGDVFQVN
FT                   LSVRQSKPLLTHPFHIYEQLRVINPSPYMAYIHFPEFQIVSGSPELLVKKRGDDISTRP
FT                   IAGTRSRGKTEEEDKWLATKLLSSEKEIAEHAMLVDLERNDLGRVCQYGTVKVDEWMTI
FT                   ERYSHVMHIVSHVSGKLKQGKDAFDVIQAMFPGGTITGAPKVRTMEIIEELEPVRRGIY
FT                   TGSIGWISFDGDMEFNIAIRTMIAKDGIAHVQAGAGIVIDSHPEHEYRECLKKAAALWK
FT                   AKELSEAEKSLRV"
FT   gene            84969..85547
FT                   /locus_tag="GY4MC1_0071"
FT   CDS_pept        84969..85547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0071"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: gwc:GWCH70_0070 glutamine amidotransferase of
FT                   anthranilate synthase; TIGRFAM: glutamine amidotransferase
FT                   of anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72927"
FT                   /db_xref="GOA:A0A0F6BHM6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM6"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADP72927.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGVLGEELVVKRNDEITVKEIETLNPD
FT                   FLMISPGPCTPNEAGVSIEAIEYFAGKIPVFGVCLGHQAIAQAFGGKVVRADRLMHGKT
FT                   SQIFHDGKTIFTNIPSPFTATRYHSLIVEKETLPDCFEISAWTEENEIMAIRHKTLPVE
FT                   GVQFHPESIMTSHGMKLLENFIQTYKRVR"
FT   gene            85552..86421
FT                   /locus_tag="GY4MC1_0072"
FT   CDS_pept        85552..86421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0072"
FT                   /product="Aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /note="KEGG: gwc:GWCH70_0071 aminotransferase class IV;
FT                   PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72928"
FT                   /db_xref="GOA:A0A0F6BHM7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM7"
FT                   /inference="protein motif:PRIAM:4.1.3.38"
FT                   /protein_id="ADP72928.1"
FT                   /translation="MYIYVNGEVVHKDEARISPFDHGFLYGLGVFETFRTYDGHPFLLD
FT                   DHLERLNRSLREMNIAKSFTRREVMEILHRLLEANRLQNAYVRLNVSAGIGDIGLQTSE
FT                   YDQPTVIMYMKPLFSSFSRGKIGIVLKTRRNTPEGKERLKSHHYLNNIIGKREIGTRPD
FT                   VEGIFLNEQGYVAEGIVSNIFWVKNGVVYTPAIHAGILNGVTRQFVIALLNALKIECQE
FT                   GFYPLDHLQRADEIFVTNSIQEIVPIYQMDGRAYQGADGPVTSLLQKHYKHFTSFLWTK
FT                   YELAERME"
FT   gene            86425..87279
FT                   /locus_tag="GY4MC1_0073"
FT   CDS_pept        86425..87279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0073"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   gwc:GWCH70_0072 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72929"
FT                   /db_xref="GOA:A0A0F6BHM8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM8"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADP72929.1"
FT                   /translation="MATTSATPFVLRCGDYELDLRKKTMVMGIVNVTPDSFSDGGRFYD
FT                   LDRAVEHAKQLVADGADIIDIGGESTRPGAEKVSLEEELRRVIPVVKAVAQEINVPISI
FT                   DTYKAEVAKQAIEAGAHIINDVWGAKADEKMAEVAAFYDVPIILMHNRHDLQYRDLISD
FT                   MISDLMESVAIVKRAGVKDENIILDPGIGFAKTLEHNLEIMRRLDEFAKLGYPLLLGTS
FT                   RKRFIGHVLDLPVDERVEGTGATVCLGIAKGAHIVRVHDVLPIARMVKMMDAMLGKGVA
FT                   NDR"
FT   gene            87251..87631
FT                   /locus_tag="GY4MC1_0074"
FT   CDS_pept        87251..87631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0074"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   gwc:GWCH70_0073 dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72930"
FT                   /db_xref="GOA:A0A0F6BHM9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM9"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADP72930.1"
FT                   /translation="MEKEWRTIDKIYLHRMEFYGYHGVLPEENVLGQRFIVDAILETDL
FT                   QKAGKSDQLNDTINYAEVYDICRNVVEKRRFSLIEAVAETIAEQILSSFPTVARCTIKV
FT                   TKPNPPIKGHYESVAVEIVRGR"
FT   gene            87632..88159
FT                   /locus_tag="GY4MC1_0075"
FT   CDS_pept        87632..88159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0075"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: gwc:GWCH70_0074
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72931"
FT                   /db_xref="GOA:A0A0F6BHN0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN0"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADP72931.1"
FT                   /translation="MENHAYIALGSNIGDRFFYLREAVKMLDSHQQISVAAASSIYETE
FT                   PVGYIHQNKFLNMVVKIYTSLSPFALLDVTQKIEQNFGRKREMRWGPRTLDLDILLYNH
FT                   ENIETEQLIIPHPRMTERAFVMIPLLELNRDIHIPNVTQCLLHLVDRLPDKEGVRVWKQ
FT                   KNGEDVFALFES"
FT   gene            88111..88329
FT                   /locus_tag="GY4MC1_0076"
FT   CDS_pept        88111..88329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0076"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: gwc:GWCH70_0075 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72932"
FT                   /db_xref="GOA:A0A0F6BHN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP72932.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQERLAKELGISVSILGEIERGNRLP
FT                   TEELVQQIAERLNISVEELAPHSEAGK"
FT   gene            88346..89347
FT                   /locus_tag="GY4MC1_0077"
FT   CDS_pept        88346..89347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0077"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: TIM-barrel protein, nifR3 family; TIGRFAM:
FT                   TIM-barrel protein, nifR3 family; PFAM: dihydrouridine
FT                   synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72933"
FT                   /db_xref="GOA:A0A0F6BHN2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN2"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADP72933.1"
FT                   /translation="MFKIGDVEIKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KGIVYNNEKTLNMLYIDEREKPLSLQIFGGEKETLVEAAKFVDKHTNADIIDINMGCPV
FT                   PKVTKCDAGAKWLLDPNKIYDVVAAIVDAVEKPVTVKMRIGWDENHIYAVENAQAVERA
FT                   GGKAVAVHGRTRVQMYEGKADWNIIKQVKEAVNIPVIGNGDVKTPQDAKRMLEETGVDG
FT                   VMIGRAALGNPWMIYRTVRYLETGELIPEPTVREKIEVCLLHLDRLIALKGEHIAVKEM
FT                   RKHAAWYLKGVRGNAKIRNAINECETREQLAALLLNFAEEVESKEQMNAQAV"
FT   gene            89437..90921
FT                   /locus_tag="GY4MC1_0078"
FT   CDS_pept        89437..90921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0078"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0078 lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72934"
FT                   /db_xref="GOA:A0A0F6BHN3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN3"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADP72934.1"
FT                   /translation="MSHEELNDQLRVRREKLHKLREMGIDPFGKRFERTHKAQELFDLY
FT                   GDLSKEELEEKQIKVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVREDAVGPEQYELF
FT                   KTSDLGDIIGVCGTVFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPDSKNTFITRSRIIQSMRRYLDSHGYLEVETPMMHNIAGGAAARPFITHHNALD
FT                   MPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMLELYEAYADFRDI
FT                   MTLTENLIAHIAQEVLGTTKIQYGEHKVDLTPEWKRLHMVDAIKEYVGVDFWKQMSDEE
FT                   ARELAKEHGVEIAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREQGNDEAHEMDEDFIEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRNK"
FT   gene            91265..92811
FT                   /locus_tag="GY4MC1_R0015"
FT   rRNA            91265..92811
FT                   /locus_tag="GY4MC1_R0015"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            93171..96098
FT                   /locus_tag="GY4MC1_R0016"
FT   rRNA            93171..96098
FT                   /locus_tag="GY4MC1_R0016"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            96225..96341
FT                   /locus_tag="GY4MC1_R0017"
FT   rRNA            96225..96341
FT                   /locus_tag="GY4MC1_R0017"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 104.04"
FT   gene            96352..96427
FT                   /locus_tag="GY4MC1_R0018"
FT                   /note="tRNA-Val1"
FT   tRNA            96352..96427
FT                   /locus_tag="GY4MC1_R0018"
FT                   /product="tRNA-Val"
FT   gene            96526..96598
FT                   /locus_tag="GY4MC1_R0019"
FT                   /note="tRNA-Lys1"
FT   tRNA            96526..96598
FT                   /locus_tag="GY4MC1_R0019"
FT                   /product="tRNA-Lys"
FT   gene            96608..96690
FT                   /locus_tag="GY4MC1_R0020"
FT                   /note="tRNA-Leu1"
FT   tRNA            96608..96690
FT                   /locus_tag="GY4MC1_R0020"
FT                   /product="tRNA-Leu"
FT   gene            96703..96777
FT                   /locus_tag="GY4MC1_R0021"
FT                   /note="tRNA-Gly1"
FT   tRNA            96703..96777
FT                   /locus_tag="GY4MC1_R0021"
FT                   /product="tRNA-Gly"
FT   gene            96788..96873
FT                   /locus_tag="GY4MC1_R0022"
FT                   /note="tRNA-Leu2"
FT   tRNA            96788..96873
FT                   /locus_tag="GY4MC1_R0022"
FT                   /product="tRNA-Leu"
FT   gene            96877..96953
FT                   /locus_tag="GY4MC1_R0023"
FT                   /note="tRNA-Arg1"
FT   tRNA            96877..96953
FT                   /locus_tag="GY4MC1_R0023"
FT                   /product="tRNA-Arg"
FT   gene            96957..97030
FT                   /locus_tag="GY4MC1_R0024"
FT                   /note="tRNA-Pro1"
FT   tRNA            96957..97030
FT                   /locus_tag="GY4MC1_R0024"
FT                   /product="tRNA-Pro"
FT   gene            97042..97114
FT                   /locus_tag="GY4MC1_R0025"
FT                   /note="tRNA-Ala3"
FT   tRNA            97042..97114
FT                   /locus_tag="GY4MC1_R0025"
FT                   /product="tRNA-Ala"
FT   gene            97309..98855
FT                   /locus_tag="GY4MC1_R0026"
FT   rRNA            97309..98855
FT                   /locus_tag="GY4MC1_R0026"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            99205..102132
FT                   /locus_tag="GY4MC1_R0027"
FT   rRNA            99205..102132
FT                   /locus_tag="GY4MC1_R0027"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            102269..102385
FT                   /locus_tag="GY4MC1_R0028"
FT   rRNA            102269..102385
FT                   /locus_tag="GY4MC1_R0028"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 104.04"
FT   gene            102589..103050
FT                   /locus_tag="GY4MC1_0079"
FT   CDS_pept        102589..103050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0079"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: transcriptional repressor, CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72935"
FT                   /db_xref="GOA:A0A0F6BHN4"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN4"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADP72935.1"
FT                   /translation="MPNISDIIEQYLKQVLNMSDKDIVEIKRSEIADKFQCVPSQINYV
FT                   INTRFTLERGYVVESKRGGGGYIRIMKVKTKSEAQLIDQLLELVGHHVSQSNAEDIIHR
FT                   LVEEKVISEREAKIMLSVMDRSVLCIDLPQRDELRARMLRAMLTSLKYK"
FT   gene            103065..103613
FT                   /locus_tag="GY4MC1_0080"
FT   CDS_pept        103065..103613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0080"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: gwc:GWCH70_0081
FT                   UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72936"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN5"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADP72936.1"
FT                   /translation="MICQECKQRPATMHFTKIINGEKTEFHLCEQCAHEHSDMFTFYGN
FT                   DDFSFNNLLSALLNFPSSMKELTTSSFHNPDILQCEKCNMTYQQFTKIGHFGCSHCYRT
FT                   FSRYLPPILKRLHSGNTAHAGKIPKRKGGTLHLRKQIAMLKQKLQEFVAREEFEKAAEV
FT                   RDQIRSLEYQLHQRGEGEM"
FT   gene            103618..104700
FT                   /locus_tag="GY4MC1_0081"
FT   CDS_pept        103618..104700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0081"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   gwc:GWCH70_0082 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72937"
FT                   /db_xref="GOA:A0A0F6BHN6"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN6"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADP72937.1"
FT                   /translation="MSFEKFFNTAVSSWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLF
FT                   SNEEAQQIVSLFEQTFAHRFYRSVGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPF
FT                   GACLLSENEEISIMINEEDHIRIQCLFPGFQLTEALKAANELDDWIEEHVIYAFDEKLG
FT                   YLTSCPTNVGTGMRASVMMHLPALVLTQQMNRIIPAVNQLGLVVRGTYGEGSEALGNIF
FT                   QISNQMTLGKSEEDIVEDLKSVVQQLITQERMARETLVKTLNIQLEDRVFRSYGILANS
FT                   RVIDSKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGVLRPEERDV
FT                   RRAALIRERLKMEERKMNGG"
FT   gene            104704..107142
FT                   /locus_tag="GY4MC1_0082"
FT   CDS_pept        104704..107142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0082"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: gwc:GWCH70_0083 ATPase AAA-2 domain protein;
FT                   PFAM: ATPase AAA-2 domain protein; AAA ATPase central
FT                   domain protein; UvrB/UvrC protein; Clp domain protein; Clp
FT                   ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72938"
FT                   /db_xref="GOA:A0A0F6BHN7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN7"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADP72938.1"
FT                   /translation="MMMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEG
FT                   IAAKALMALGLGPEKIQKEVESLIGRGHEVSHTIHYTPRAKKVLELSMDEARKLGHSYV
FT                   GTEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESVSGHSGGGASHVSTP
FT                   TLDSLARDLTAIAREGRLDPVVGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEG
FT                   LAQQIINNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFID
FT                   ELHTLIGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIY
FT                   VDEPTVEESIQILKGLRDRYEAHHRVSISDDAIVQAVKLSDRYITDRFLPDKAIDLIDE
FT                   ACSKVRLRSFTAPPKLKELEQKLEEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEET
FT                   KRAWKEKQGQENSEVTVEDIAMVVSSWTGIPVAKLAQTETERLLKLEEILHSRVVGQDE
FT                   AVKAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDALIRIDM
FT                   SEYMEKHSTSRLIGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQV
FT                   LEDGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNVQDEDQKYKDMKGKVMDE
FT                   LKRAFRPEFLNRIDEIIVFHSLEKQHLKQIVKLMADTLIKRLKEQDIDLELTDAAIEKI
FT                   VSEGYDPEYGARPLRRALQKQVEDRLSEELLKGTIAKGQKVIVDVKDGEFVVLAKQAVM
FT                   "
FT   gene            107231..108604
FT                   /locus_tag="GY4MC1_0083"
FT   CDS_pept        107231..108604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0083"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; PFAM: Circadian
FT                   clock protein KaiC central region; KEGG: gwc:GWCH70_0084
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72939"
FT                   /db_xref="GOA:A0A0F6BHN8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN8"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADP72939.1"
FT                   /translation="MGKKKTKFVCQECGYESAKWLGRCPGCNTWNSMVEEIERTKPATK
FT                   GVFVHSASDIISKPVPITTVTATQEPRIQTGISEFNRVLGGGIVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLAALQHKVLYISGEESVKQTKLRADRLHVASDQLYVLAETDLEYIVEAI
FT                   ETIHPVCVVIDSIQTIYRADIASAPGSVSQVRECTAELMKIAKTKGITIFIVGHVTKEG
FT                   AIAGPRILEHMVDTVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMRESGLVEVENPS
FT                   EVFLEERSRGAAGSTVVAAMEGTRPVLVEIQALVSPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRSGLLLQNQDAYLKVAGGVKLDEPAIDLAIAVSIASSFRDQPTNPHDVIIGEVGL
FT                   TGEVRRVSRIEQRVQEAVKLGFSRMIIPKNNLAGWNPPEHITVIGVSHITEALEHTLQ"
FT   gene            108716..109810
FT                   /locus_tag="GY4MC1_0084"
FT   CDS_pept        108716..109810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0084"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: gwc:GWCH70_0085 PilT protein domain protein;
FT                   PFAM: PilT protein domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72940"
FT                   /db_xref="GOA:A0A0F6BHN9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADP72940.1"
FT                   /translation="MVKRIVQLFFLVVGGTLGVVFLPNLLQLMNISDISLLNNSYTLAV
FT                   LGALIFFMMTFWLVDYVVDMIRWVEETLVKAPAADLLFGSLGLIFGLIVAFLVVMPLQA
FT                   FQFQVVNTVLPIFLTILLGYLGFQVGFKKRHELMNLFSLSNRMAKKKGTEGETDLPKGG
FT                   SLKILDTSVIIDGRIADICKTGFLEGTLVIPRFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNRIQKELDIKVEIYEGDFDDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQNVRVL
FT                   NINDLANAVKPVVLPGEELNVHVIKDGKEHNQGVAYLDDGTMIVVEDGKEYIGKRVDVL
FT                   VTSVLQTSAGRMIFAKLKLLQKAL"
FT   gene            109834..110520
FT                   /locus_tag="GY4MC1_0085"
FT   CDS_pept        109834..110520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0085"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: gwc:GWCH70_0086 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72941"
FT                   /db_xref="GOA:A0A0F6BHP0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP0"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADP72941.1"
FT                   /translation="MMYEVVIPAAGQGKRMKAGMNKQLIELRNEPLIVRTLKVFENDEW
FT                   CRGIIVVINEAERTQFEQLFSRFHIKKITAVVGGGKERQHSVYNGLRAVKNSDIVLIHD
FT                   GARPFVTIEQIHELVNEAKEHGAAIPAVRVKDTIKKVCDQFVEETVERSGLWAVQTPQA
FT                   FHVSLVLRAHEQAQKDGYIGTDDASLVERIGGKVKIIEGDYRNIKLTTPDDLLFAEVIL
FT                   SSWVSS"
FT   gene            110538..111014
FT                   /locus_tag="GY4MC1_0086"
FT   CDS_pept        110538..111014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0086"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: gwc:GWCH70_0087 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72942"
FT                   /db_xref="GOA:A0A0F6BHP1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP1"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADP72942.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGVRIPYEKGLLGHSDADVLLHAV
FT                   ADACLGAIGAGDIGKHFPDTDERYKDADSALLLKQVWELVKRQGYKLVNLDCTVIAQKP
FT                   KMAPHIEQMKENIAKLLEGESSQVNIKATTTEKLGFTGRGEGIAAQAVVLLQKQ"
FT   gene            111122..112582
FT                   /locus_tag="GY4MC1_0087"
FT   CDS_pept        111122..112582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0087"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0088 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72943"
FT                   /db_xref="GOA:A0A0F6BHP2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP2"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADP72943.1"
FT                   /translation="MSQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHNGKFIVRIED
FT                   TDIERNVEGGEQSQLENLKWLGIDYDESVDKDGGYGPYRQTERLDIYRKYVNELLEKGY
FT                   AYKCFCTPEELEQEREAQRAAGIAAPQYSGKCRHLTKEQIAQLEAEGKPYTIRVKVPEG
FT                   KVYEFEDIVRGKVTFESKDIGDWVIMKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSN
FT                   TPKQLMIYDYFGWEPPQFGHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEALFNF
FT                   FALLGWSPEGEEEIFSKEELIRIFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRLVE
FT                   ISLPHLIKAGRLPEQMSEEQRQWARDLIALYQEQMSYGAEIVQLSELFFKEDIEYNEEA
FT                   KEVLSGEQVPDVLKAFLEEVKQLDPFTAENIKAAIKSVQKSTGQKGKKLFMPIRVAATG
FT                   QTHGPELPVALQLLGKEKVISRLEKVVH"
FT   gene            112931..113599
FT                   /locus_tag="GY4MC1_0088"
FT   CDS_pept        112931..113599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0088"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   gwc:GWCH70_0089 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72944"
FT                   /db_xref="GOA:A0A0F6BHP3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP3"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADP72944.1"
FT                   /translation="MFKTLKEDIEVIFEQDPAARSYLEVILTYSGLHAIWAHRIAHALY
FT                   KRKFYFLARLISQISRFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGDNVTVYQGV
FT                   TLGGTGKEKGKRHPTIKDNCLIAAGAKVLGSITIGENSKIGAGSVVLKDVPPNSTVVGI
FT                   PGRVVVRDGVKVKKDLNHTDLPDPVADRIKELEAEIAKLRSEIESLKERKNEHEQHSAL
FT                   "
FT   gene            113577..114977
FT                   /locus_tag="GY4MC1_0089"
FT   CDS_pept        113577..114977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0089"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: gwc:GWCH70_0090
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia ; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72945"
FT                   /db_xref="GOA:A0A0F6BHP4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP4"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADP72945.1"
FT                   /translation="MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AIVFDTIRRYLEFRGYEVKYVSNFTDVDDKLIKAARELGEDVPTVAERFIQAYFEDITA
FT                   LGCKKADVHPRVTENMDTIIEFIQALVEKGYAYEVDGDVYYRTRKFAEYGKLSHQSIDE
FT                   LKAGARIEIGEKKEDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IRQIDPQVLRFFMLSVHYRHPINYSEELLENAKKGLERLKTAYFNLKHRLQSSTNLTDD
FT                   DEQWLARIQEQHEAFIREMDDDFNTANGIAVLFELAKQANLYLHEKNTSERVIHAFLRE
FT                   LEQLLDVLGITLQEEELLDEEIEALIQKRNEARKNRNFALADQIRDELRAKNIILEDTP
FT                   QGTRWKRG"
FT   gene            114983..115402
FT                   /locus_tag="GY4MC1_0090"
FT   CDS_pept        114983..115402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0090"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: gwc:GWCH70_0091 ribonuclease III; PFAM:
FT                   ribonuclease III; SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72946"
FT                   /db_xref="GOA:A0A0F6BHP5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP5"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADP72946.1"
FT                   /translation="MNLLQPVKDVKQMNGLTLAYIGDAVYELYVRHHLLSSGNVKPHQL
FT                   HKRAIQYVSAKAQAKVLLTLLENGILTEEEQSVVRRGRNAKSGTIPKNTDVQTYRYSTA
FT                   FEALIGYHFLGNNEKRVEELIRNSFVIIESEERKS"
FT   gene            115405..116142
FT                   /locus_tag="GY4MC1_0091"
FT   CDS_pept        115405..116142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0091"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: gwc:GWCH70_0092 RNA methyltransferase, TrmH
FT                   family, group 3; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: tRNA/rRNA methyltransferase (SpoU);
FT                   RNA 2-O ribose methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72947"
FT                   /db_xref="GOA:A0A0F6BHP6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP6"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADP72947.1"
FT                   /translation="MDFIIGKNPVIEALKSKRQINKIWIAESVQRHSIQPIIQLAKQNG
FT                   VLVQYVPKKKLDQMVEGTHQGIVAQVAAYRYYEIDDLFARASEKNEPPFFLILDELEDP
FT                   HNLGSIMRTADAVGAHGIIIPKRRSVGLTATVAKASTGAIEYIPVARVTNLARTMDELK
FT                   ERGVWIVGTDAKAKEDYRSLDGTMPLALVIGSEGKGIGRLILEKCDFLIRLPMRGHVTS
FT                   LNASVAASLLMYEVYRKRYPLGE"
FT   gene            116147..116659
FT                   /locus_tag="GY4MC1_0092"
FT   CDS_pept        116147..116659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0092"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   gwc:GWCH70_0093 protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72948"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP7"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADP72948.1"
FT                   /translation="MNILIVDGYNMIGAWPELRKLKEEDDLAAARDLLISKMAEYQGFT
FT                   GDKVIIVFDAHLVQGNAKKYKNHQVEVIFTKENETADERIERLAKSLINVRTKVYVATS
FT                   DYTEQWTIFSQGALRKSARELLMEMESIEKAISKKLQNMKEQTPASRVPLPDEVARIFE
FT                   KWRRGQK"
FT   gene            116729..117379
FT                   /locus_tag="GY4MC1_0093"
FT   CDS_pept        116729..117379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0093"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: gwc:GWCH70_0094 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-H
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72949"
FT                   /db_xref="GOA:A0A0F6BHP8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP8"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADP72949.1"
FT                   /translation="MGECFKEKTYKSYKHLEDEQLVELVHQGDGDALDFLIHKYQNFVR
FT                   AKARSYFLVGADREDIIQEGMIGLYKAVRDFKGDKLSSFKAFAELCITRQMITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDDESDRTLMDVISGTKATDPEELIVNREEVDDIEVKMTELL
FT                   SDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLECREISL"
FT   gene            117471..117620
FT                   /locus_tag="GY4MC1_0094"
FT   CDS_pept        117471..117620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0094"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: gwc:GWCH70_0095 ribosomal protein L33;
FT                   TIGRFAM: ribosomal protein L33; PFAM: ribosomal protein
FT                   L33"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72950"
FT                   /db_xref="GOA:A0A0F6BHP9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP9"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADP72950.1"
FT                   /translation="MRKKIILACSQCNSRNYVTMKNVNHVQQRFEAKKFCKTCNVHTTH
FT                   RETK"
FT   gene            117663..117845
FT                   /locus_tag="GY4MC1_0095"
FT   CDS_pept        117663..117845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0095"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: gwc:GWCH70_0096 preprotein translocase, SecE
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72951"
FT                   /db_xref="GOA:A0A0F6BHQ0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ0"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADP72951.1"
FT                   /translation="MQRMINFFKDVAREMKKVSWPSRKELVNYTVIVLATVAFFTVFFA
FT                   VVDLGISELIRLVFE"
FT   gene            117975..118508
FT                   /locus_tag="GY4MC1_0096"
FT   CDS_pept        117975..118508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0096"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: gwc:GWCH70_0097 NusG antitermination
FT                   factor; SMART: NGN domain-containing protein; KOW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72952"
FT                   /db_xref="GOA:A0A0F6BHQ1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ1"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADP72952.1"
FT                   /translation="MEKNWYVIHTYSGYENKVKANLEKRVESMGMQDKIFRIVVPEETE
FT                   TETKSGKKKAAKRKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLLEE
FT                   EVEMILKRMGMQLAELDVDYELKETVRVKEGPFANFTGTIEEIDVDKRKVKVLVNMFGR
FT                   ETPVEFEFSQIEKI"
FT   gene            118754..119179
FT                   /locus_tag="GY4MC1_0097"
FT   CDS_pept        118754..119179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0097"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: ribosomal protein L11; SMART:
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72953"
FT                   /db_xref="GOA:A0A0F6BHQ2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ2"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADP72953.1"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMVEGTARSMGIVIED"
FT   gene            119287..119988
FT                   /locus_tag="GY4MC1_0098"
FT   CDS_pept        119287..119988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0098"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gwc:GWCH70_0099 ribosomal protein L1; TIGRFAM:
FT                   ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72954"
FT                   /db_xref="GOA:A0A0F6BHQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ3"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADP72954.1"
FT                   /translation="MPRRGKKYLEALKLVDRSKAYPVAEAIELVKKTNIAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADYVGDTEYINKI
FT                   QEGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLVENFTTIYEAILKAKPAAAKGTYVKNVTVTSTMGPGI
FT                   KVDPSTVAVAQ"
FT   gene            120238..120738
FT                   /locus_tag="GY4MC1_0099"
FT   CDS_pept        120238..120738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0099"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gwc:GWCH70_0100
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72955"
FT                   /db_xref="GOA:A0A0F6BHQ4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ4"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADP72955.1"
FT                   /translation="MGSAIELKKQIVAEIADKFRASKSTVIVDYRGLNVAEITELRKRL
FT                   REAGVEFKVYKNTLTRRALAEVGLEGLNDVFTGPNAIAFSNEDVVAPAKILSEFAKEHE
FT                   ALEIKAGVIEGNIATIEEINALAKLPSREGLLSMLLSVLQAPIRNFALAAKAVADQKEE
FT                   QSA"
FT   gene            120792..121160
FT                   /locus_tag="GY4MC1_0100"
FT   CDS_pept        120792..121160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0100"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: gtn:GTNG_0096 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72956"
FT                   /db_xref="GOA:A0A0F6BHQ5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ5"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADP72956.1"
FT                   /translation="MTKEQIIEAIKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAA
FT                   GGDAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEGVSKEE
FT                   AEEIKAKLEEVGASVELK"
FT   gene            121263..121865
FT                   /locus_tag="GY4MC1_0101"
FT   CDS_pept        121263..121865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0101"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gwc:GWCH70_0102
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72957"
FT                   /db_xref="GOA:A0A0F6BHQ6"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ6"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADP72957.1"
FT                   /translation="MSEHYYSPTPSSESNPHTWTFTLRGHDLTFTTDSGVFSKREVDFG
FT                   TRLLIETFEEPDVDGGFLDVGCGYGPIGLAVAKSFPNRHVDMIDINKRALELANENKRV
FT                   NHIANVSIYESDLFEQVGDKKFAAILTNPPIRAGKRVVYAIFEQSAAHLYPDGELWVVI
FT                   QKKQGAPSALKKLQEIFSCVEVVTKKKGYYIIKSKKC"
FT   gene            122087..125659
FT                   /locus_tag="GY4MC1_0102"
FT   CDS_pept        122087..125659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: gwc:GWCH70_0103 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   Rpb2 domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72958"
FT                   /db_xref="GOA:A0A0F6BHQ7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ7"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADP72958.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYKWFLDEGL
FT                   REMFREISPIEDFSGNLSLEFIDYSLGEPKYTVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSEKVDKNGKRGFSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTIENAKNLLISRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEVIAEKGTIVDRRTLNRILPYLENGVGLRVHKPFGGVVEE
FT                   EIALQSIKIYAPNDPDGEQVINVISNGYIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGRVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVVARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLEPEAPIVGTGMEYVSARDSGAAVICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGMPRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEKEINMENFDEEDDVHSA
FT                   DSLVPEVKSAEDEKAGKKGVATKE"
FT   gene            125791..129390
FT                   /locus_tag="GY4MC1_0103"
FT   CDS_pept        125791..129390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0103"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; RNA polymerase Rpb1 domain 5; KEGG:
FT                   gwc:GWCH70_0104 DNA-directed RNA polymerase, beta' subunit;
FT                   SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72959"
FT                   /db_xref="GOA:A0A0F6BHQ8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ8"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADP72959.1"
FT                   /translation="MLDVNKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKKQLLSEKEYRAYREKYG
FT                   QSFQASMGAEAIKKLLQDIDLEKEVATLKEELKTAQGQRRARIIKRLEVLEAFRNSGND
FT                   PAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAHNIKSAKRKIERVHPEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFK
FT                   DTDEALLAYHNGYVHLHSRIAVHAGSLKNETFTEEQNNKLLITTVGKLIFNEILPNSFP
FT                   YINEPTTENIEGRTPDKYFLDKGVNVKEEIRKRELVPPFKKKVLGQIIAEVFKRFKITE
FT                   TSKMLDRMKDLGFQYSTKAGITIGVADIVVLPEKQEILEEAQTKVDTVLKQFRRGLITD
FT                   EERYERVISIWSAAKDKIQDRLMKSLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREEDCGTDRGILARALTDGTEVIVKLEERLVGRYAQKTVRHPETGEILVRKDEMITED
FT                   IANAIVKAGIKEVWIRSAFTCNTRHGVCKKCYGRNLATGAEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVISEIDGIVTSISETRDRQY
FT                   EIVVKGEVETRSYIAPYNARLKVEEGQQVERGQELTEGSIDPKQLLKVRDVTSVQEYLL
FT                   REVQKVYRMQGVEISDKHIEVMVRQMLRKVRIIDAGDTDVLPGTLLDVHQFTDVNEKAL
FT                   LEGKRPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMARYRKVKPVVKKEENEDAVTSK"
FT   gene            129524..129772
FT                   /locus_tag="GY4MC1_0104"
FT   CDS_pept        129524..129772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0104"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   gwc:GWCH70_0105 ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72960"
FT                   /db_xref="GOA:A0A0F6BHQ9"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ9"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ADP72960.1"
FT                   /translation="MSYEKVLQAGKIVVGTKQTIRALKEGKALEVIVAEDADSSIIEKV
FT                   MEAAKDANVPVTKVDSMKKLGKACKIQVGAAAVAIIR"
FT   gene            129875..130297
FT                   /locus_tag="GY4MC1_0105"
FT   CDS_pept        129875..130297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0105"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gwc:GWCH70_0106 ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72961"
FT                   /db_xref="GOA:A0A0F6BHR0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR0"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADP72961.1"
FT                   /translation="MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKVQTNVPSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDTAGVANRMQGRSKYGAKKPKESKK"
FT   gene            130335..130805
FT                   /locus_tag="GY4MC1_0106"
FT   CDS_pept        130335..130805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0106"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: gwc:GWCH70_0107 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72962"
FT                   /db_xref="GOA:A0A0F6BHR1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR1"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADP72962.1"
FT                   /translation="MPRRGPVPKRDVLPDPIYNSKLVTRLINKIMIDGKKGKAQKILYT
FT                   AFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVTLGLRWL
FT                   VQYARLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            130948..133026
FT                   /locus_tag="GY4MC1_0107"
FT   CDS_pept        130948..133026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0107"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain IV; elongation
FT                   factor Tu domain 2 protein; elongation factor G
FT                   domain-containing protein; KEGG: gwc:GWCH70_0108
FT                   translation elongation factor G; SMART: elongation factor G
FT                   domain IV; elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72963"
FT                   /db_xref="GOA:A0A0F6BHR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR2"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADP72963.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVNTLHERLQANAHPVQ
FT                   LPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIEIPEEYRDMAEEYHNKLIEAVAELD
FT                   EELMMKYLEGEEITVEELKAAIRRATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   VDIPPIKGIVPDTEEEVVRESSDDAPFAALAFKIMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   MNSTKRKRERIGRLLQMHANHRQEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVVLES
FT                   MEFPEPVINVAIEPKSKADQDKMGQALQKLQEEDPTFRAWTDPETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASLALKNAAEKCDPVLLEPIMKVEVIIPEEYLGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFTMVFDHYEEVPKNIADEIIKKNKGE"
FT   gene            133163..134350
FT                   /locus_tag="GY4MC1_0108"
FT   CDS_pept        133163..134350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0108"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: translation elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain-containing protein; elongation
FT                   factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72964"
FT                   /db_xref="GOA:A0A0F6BHR3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR3"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADP72964.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAK
FT                   AYDQIDAAPEERERGITISTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDEVPVIKGSALKALEGDPQWEEKIVELMNAVDEYIPTPQREIDKPFMMPIEDVFSIT
FT                   GRGTVATGRVERGTLKVGDAVEIVGLSDEPKSTTVTGVEMFRKLLDQAEAGDNIGALLR
FT                   GVSRDEVERGQVLAKPGTITPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVT
FT                   GIITLPEGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE"
FT   gene            134649..134957
FT                   /locus_tag="GY4MC1_0109"
FT   CDS_pept        134649..134957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0109"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: gwc:GWCH70_0110 ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72965"
FT                   /db_xref="GOA:A0A0F6BHR4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR4"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADP72965.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTE
FT                   RTVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            134978..135613
FT                   /locus_tag="GY4MC1_0110"
FT   CDS_pept        134978..135613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0110"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: gwc:GWCH70_0111 ribosomal protein L3; TIGRFAM:
FT                   50S ribosomal protein L3; PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72966"
FT                   /db_xref="GOA:A0A0F6BHR5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR5"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADP72966.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEATPNVVLQKKTIEKDG
FT                   YEAIQLGFEDLSEKRANKPQIGHAAKANTAPKRFIREIRGANIDEYEVGQEVKVDIFSE
FT                   GDIVDVTGISKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGAIAPNRVFKSKELPGR
FT                   MGGQRVTIQNLKIVKVDPERNLLLIKGNVPGPRKGLVIVKSAVKAKAK"
FT   gene            135643..136266
FT                   /locus_tag="GY4MC1_0111"
FT   CDS_pept        135643..136266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0111"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG:
FT                   gwc:GWCH70_0112 ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72967"
FT                   /db_xref="GOA:A0A0F6BHR6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR6"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADP72967.1"
FT                   /translation="MPKVALYNQNGETIGEIELNDSVFGIEPNKHVLFEAVIMQRASLR
FT                   QGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKK
FT                   VRRLAIKSALSSKVLENNIVVLDNLTLEAPKTKEMVKILNNLSVDRKALIVTDVANENV
FT                   ALSARNIPGVTVVTANGINVLDLLNHDKLVITKAAVEKVEEVLA"
FT   gene            136266..136553
FT                   /locus_tag="GY4MC1_0112"
FT   CDS_pept        136266..136553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0112"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: ribosomal
FT                   protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72968"
FT                   /db_xref="GOA:A0A0F6BHR7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR7"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADP72968.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLISQKKYTFEVDVNANKTEVKDAVEK
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
FT   gene            136581..137411
FT                   /locus_tag="GY4MC1_0113"
FT   CDS_pept        136581..137411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0113"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: gwc:GWCH70_0114 ribosomal protein L2; TIGRFAM:
FT                   ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72969"
FT                   /db_xref="GOA:A0A0F6BHR8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR8"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADP72969.1"
FT                   /translation="MAIKKYKPTSNGRRGMTVLDFSEITTDKPEKSLLAPLKKKAGRNN
FT                   QGKITVRHQGGGHKRLYRIIDFKRDKDGIPGRVATIEYDPNRSANIALIHYADGEKRYI
FT                   IAPKNLKVGMEIMSGPDADIKVGNALPLENIPVGTLVHNIELKPGKGGQLVRAAGTSAQ
FT                   VLGKEGKYVIVRLASGEVRMILGACRATVGEVGNEQHELVNIGKAGRARWLGIRPTVRG
FT                   SVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGFKTRKKNNKSDKFIIRRRKK"
FT   gene            137469..137747
FT                   /locus_tag="GY4MC1_0114"
FT   CDS_pept        137469..137747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0114"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: gwc:GWCH70_0115 ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72970"
FT                   /db_xref="GOA:A0A0F6BHR9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR9"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADP72970.1"
FT                   /translation="MGRSLKKGPFCDEHLMKKIEKLNETGQKQVIKTWSRRSTIFPQFV
FT                   GHTIAVYDGRKHVPVYITEDMVGHKLGEFAPTRTFRGHAGDDKKTKR"
FT   gene            137766..138107
FT                   /locus_tag="GY4MC1_0115"
FT   CDS_pept        137766..138107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0115"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: ribosomal protein L22; TIGRFAM: ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72971"
FT                   /db_xref="GOA:A0A0F6BHS0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS0"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADP72971.1"
FT                   /translation="MEAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDVNNLVITKAYVDEGPTLKRFRPRAMGRASAINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            138111..138767
FT                   /locus_tag="GY4MC1_0116"
FT   CDS_pept        138111..138767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0116"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: gwc:GWCH70_0117 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72972"
FT                   /db_xref="GOA:A0A0F6BHS1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS1"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADP72972.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWDSRWYAEKDYADLLHEDLKIREYINKR
FT                   LQDAAVSRIEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALTQLTGKRVHINIVE
FT                   IKKPDLDAKLVAENIARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYATAEADTTYGKIGVKVWIYRGEVLPKKKKTEEGGK"
FT   gene            138770..139204
FT                   /locus_tag="GY4MC1_0117"
FT   CDS_pept        138770..139204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0117"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: gwc:GWCH70_0118 ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72973"
FT                   /db_xref="GOA:A0A0F6BHS2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS2"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADP72973.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEYGLQALESAWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EVGGVSEEVAREALRLASHKLPIKCKFVKREESGGEANES"
FT   gene            139194..139400
FT                   /locus_tag="GY4MC1_0118"
FT   CDS_pept        139194..139400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0118"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: gwc:GWCH70_0119 ribosomal protein L29;
FT                   TIGRFAM: ribosomal protein L29; PFAM: ribosomal protein
FT                   L29"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72974"
FT                   /db_xref="GOA:A0A0F6BHS3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS3"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADP72974.1"
FT                   /translation="MKAKEIRELTTAEIEQKIKALKEELFNLRFQLATGQLENTARIRQ
FT                   VRKDIARMKTIIREREIAANAKK"
FT   gene            139424..139687
FT                   /locus_tag="GY4MC1_0119"
FT   CDS_pept        139424..139687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0119"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: gwc:GWCH70_0120 ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72975"
FT                   /db_xref="GOA:A0A0F6BHS4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS4"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADP72975.1"
FT                   /translation="MSERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDENNIAKVGDIVKIMETRPLSATKRFRLVEIVEKAVIV"
FT   gene            139736..140104
FT                   /locus_tag="GY4MC1_0120"
FT   CDS_pept        139736..140104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0120"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: gwc:GWCH70_0121 ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72976"
FT                   /db_xref="GOA:A0A0F6BHS5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS5"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADP72976.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKE
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRSDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
FT   gene            140142..140450
FT                   /locus_tag="GY4MC1_0121"
FT   CDS_pept        140142..140450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0121"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: gwc:GWCH70_0122 ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72977"
FT                   /db_xref="GOA:A0A0F6BHS6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS6"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADP72977.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHA
FT                   KPSQANPQGGIITKEAPIHVSKVMPLDPKTGLPTRIGYKIVDGKKVRYAKRSGEILD"
FT   gene            140481..141020
FT                   /locus_tag="GY4MC1_0122"
FT   CDS_pept        140481..141020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0122"
FT                   /product="ribosomal protein L5"
FT                   /note="KEGG: gwc:GWCH70_0123 ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72978"
FT                   /db_xref="GOA:A0A0F6BHS7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0123"
FT                   /protein_id="ADP72978.1"
FT                   /translation="MNRLKEKYLKEVTPALMSKFNYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQKPVVTRAKKSIAGFRLRAGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTAETD
FT                   EEARELLALLGMPFQK"
FT   gene            141055..141240
FT                   /locus_tag="GY4MC1_0123"
FT   CDS_pept        141055..141240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0123"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: ribosomal protein
FT                   S14"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72979"
FT                   /db_xref="GOA:A0A0F6BHS8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS8"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADP72979.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQLPGIKKASW"
FT   gene            141273..141671
FT                   /locus_tag="GY4MC1_0124"
FT   CDS_pept        141273..141671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0124"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: gtn:GTNG_0119 SSU
FT                   ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72980"
FT                   /db_xref="GOA:A0A0F6BHS9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS9"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADP72980.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIA
FT                   ILSTSQGILTDKEARQKGTGGEVLAYVW"
FT   gene            141703..142239
FT                   /locus_tag="GY4MC1_0125"
FT   CDS_pept        141703..142239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0125"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: gwc:GWCH70_0126 ribosomal protein L6; TIGRFAM:
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72981"
FT                   /db_xref="GOA:A0A0F6BHT0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT0"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADP72981.1"
FT                   /translation="MSRVGKKPIEIPSGVTVTVNGNTVTVKGPKGELTRTFHPDMTIKV
FT                   EDNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRAAKQGKKLV
FT                   LNVGFSHPVEIEPEEGLDIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIR
FT                   YEGEVVRLKEGKTGK"
FT   gene            142272..142634
FT                   /locus_tag="GY4MC1_0126"
FT   CDS_pept        142272..142634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0126"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: gwc:GWCH70_0127 ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72982"
FT                   /db_xref="GOA:A0A0F6BHT1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT1"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADP72982.1"
FT                   /translation="MITKVDRNAVRKRRHARVRKKIFGTAERPRLNVFRSNKHIYAQII
FT                   DDMKAVTLVSASTLDKEFDLASTGNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   gene            142654..143154
FT                   /locus_tag="GY4MC1_0127"
FT   CDS_pept        142654..143154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0127"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: gwc:GWCH70_0128 ribosomal protein S5; TIGRFAM:
FT                   ribosomal protein S5; PFAM: Ribosomal protein S5 ;
FT                   ribosomal protein S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72983"
FT                   /db_xref="GOA:A0A0F6BHT2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT2"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADP72983.1"
FT                   /translation="MRRIDPNKLELEERVVSVNRVAKVVKGGRRLRFSALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGKIILKPASEGTG
FT                   VIAGGPARAVLELAGISDILSKSIGSNTPINMVRATVDGLKQLKRAEDVARLRGKTVEE
FT                   LLG"
FT   gene            143168..143356
FT                   /locus_tag="GY4MC1_0128"
FT   CDS_pept        143168..143356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0128"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: ribosomal protein L30; TIGRFAM: ribosomal
FT                   protein L30; PFAM: ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72984"
FT                   /db_xref="GOA:A0A0F6BHT3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT3"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADP72984.1"
FT                   /translation="MAKKLAITLTRSVIGRPQDQRITVKTLGLRKLHQTVVHHDNPAIR
FT                   GMINKVAHLVKVQEIEE"
FT   gene            143379..143819
FT                   /locus_tag="GY4MC1_0129"
FT   CDS_pept        143379..143819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0129"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: gwc:GWCH70_0130 ribosomal protein L15;
FT                   TIGRFAM: ribosomal protein L15; PFAM: Ribosomal protein
FT                   L18e/L15"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72985"
FT                   /db_xref="GOA:A0A0F6BHT4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT4"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADP72985.1"
FT                   /translation="MKLHELQPAPGSRKERTRVGRGIGSGKGKTSGRGQKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAIVNLEKLNRFEDGTEVTPELLLETGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSSSAKEAIEAAGGKTEVI"
FT   gene            143819..145111
FT                   /locus_tag="GY4MC1_0130"
FT   CDS_pept        143819..145111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0130"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: gwc:GWCH70_0131 preprotein translocase, SecY
FT                   subunit; TIGRFAM: preprotein translocase, SecY subunit;
FT                   PFAM: SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72986"
FT                   /db_xref="GOA:A0A0F6BHT5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT5"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADP72986.1"
FT                   /translation="MFRTISNFMRVGDIRKKIIFTLLMLIVFRIGTFIPVPNVNADVLK
FT                   VQDQMNAFGVLNIFGGGALQNFSIFAMGVMPYITASIIVQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTVVLGFIQALGMSYGFNNLASGMLIKNPSIPTYLLIATVLTAGTAFL
FT                   MWLGELITAKGVGNGISIIIFAGIVSGIPTVLNQIYAQQFENAGDDLFLRIAMLLLLAA
FT                   AVVVVIVGVIYIQQAFRKIPIQYAKRLEGRSPVGGHSTHLPLKVNPAGVIPVIFAVSFI
FT                   IAPPTIASFFGSNDVTLWIRNTFDYTQPVGMVIYVVLIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGIRPGKNTQEYVTKILYRLTFVGSLFLAAVAILPVFFVKFANLPSSARIGG
FT                   TSLLIVVGVALETMKQLESQLVKRHYKGFIK"
FT   gene            145164..145814
FT                   /locus_tag="GY4MC1_0131"
FT   CDS_pept        145164..145814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0131"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: gwc:GWCH70_0132 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72987"
FT                   /db_xref="GOA:A0A0F6BHT6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT6"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADP72987.1"
FT                   /translation="MNLVLMGLPGAGKGTQAEKIVETYGIPHISTGDMFRAAIKEGTPL
FT                   GLQAKEYMDRGDLVPDEVTIGIVRERLSKDDCHKGFLLDGFPRTVAQAEALENILAELT
FT                   RSIDYVIHIQVDKDILMERLTGRRICKNCGATYHLVFNPPANPGVCDKCGGELYQRADD
FT                   NEETVANRLEVNVKQMQPLLEFYEKKGYLRHIDGQQDIEKVFADIRELLGGLQ"
FT   gene            145814..146560
FT                   /locus_tag="GY4MC1_0132"
FT   CDS_pept        145814..146560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0132"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: gwc:GWCH70_0133 methionine aminopeptidase,
FT                   type I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72988"
FT                   /db_xref="GOA:A0A0F6BHT7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT7"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADP72988.1"
FT                   /translation="MIICKTPREIEIMREAGKIVALTRQELEKHIRPGITTKELDQIAE
FT                   AVIRKHGAIPSFKGYNGFPGSICTSVNEELVHGIPGDRVLKEGDIISIDVGAQYNGYHA
FT                   DSAWTYPVGEIAEETKKLLEVTEKSLYIGLEEAKPGARLTNISHAIQTYVESHHFSIVR
FT                   EYVGHGIGQNLHEDPQVPHYGPPNKGPRLKPGMTLCVEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKMCAHFEHTIAITENGYEILTTL"
FT   gene            146659..146877
FT                   /locus_tag="GY4MC1_0133"
FT   CDS_pept        146659..146877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0133"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: afl:Aflv_0128 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72989"
FT                   /db_xref="GOA:A0A0F6BHT8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT8"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADP72989.1"
FT                   /translation="MAKDDVIEVEGTVVETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            146912..147025
FT                   /locus_tag="GY4MC1_0134"
FT   CDS_pept        146912..147025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0134"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: ribosomal protein L36; TIGRFAM: ribosomal
FT                   protein L36; PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72990"
FT                   /db_xref="GOA:A0A0F6BHT9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT9"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADP72990.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQRQG"
FT   gene            147049..147414
FT                   /locus_tag="GY4MC1_0135"
FT   CDS_pept        147049..147414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0135"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: gwc:GWCH70_0136 ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72991"
FT                   /db_xref="GOA:A0A0F6BHU0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU0"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADP72991.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKSTAKKILAEAGVSEDTRV
FT                   RDLTEEELGRIREIVSRLKVEGDLRREVSLNIKRLIEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            147440..147829
FT                   /locus_tag="GY4MC1_0136"
FT   CDS_pept        147440..147829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0136"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: gwc:GWCH70_0137 ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72992"
FT                   /db_xref="GOA:A0A0F6BHU1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU1"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADP72992.1"
FT                   /translation="MARKTNTRKRRVRKNIETGIAHIRSTFNNTIVTITDVHGNTIAWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
FT   gene            147999..148943
FT                   /locus_tag="GY4MC1_0137"
FT   CDS_pept        147999..148943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0137"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase alpha subunit domain protein; RNA
FT                   polymerase insert; RNA polymerase dimerisation; KEGG:
FT                   gwc:GWCH70_0138 DNA-directed RNA polymerase, alpha subunit;
FT                   SMART: RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72993"
FT                   /db_xref="GOA:A0A0F6BHU2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU2"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADP72993.1"
FT                   /translation="MIEIEKPRIETVEISEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIDGVVEDVTAIILNIKKLALKIYSDEEKTLEIDAQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLAEGGRLRMRMTAKRGRGYVPAEANKREDQPIGV
FT                   IPIDSIYTPVSRVAYQVENTRVGQVTDYDKLTIDVWTDGSIGPKEAIALGAKILTEHLN
FT                   IFVSLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLAELGLSLRKDD"
FT   gene            149052..149414
FT                   /locus_tag="GY4MC1_0138"
FT   CDS_pept        149052..149414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0138"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: gwc:GWCH70_0139 ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72994"
FT                   /db_xref="GOA:A0A0F6BHU3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU3"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADP72994.1"
FT                   /translation="MSYRKLGRTSAQRKALLRDLATDLIINERIETTEARAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRKEVANNETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
FT   gene            149540..150379
FT                   /locus_tag="GY4MC1_0139"
FT   CDS_pept        149540..150379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0139"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_0140 ABC transporter related; PFAM:
FT                   ABC transporter related; Cobalt ATP-binding cassette-like;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72995"
FT                   /db_xref="GOA:A0A0F6BHU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP72995.1"
FT                   /translation="MEDTILSVEKLYFRYPNQSDYAVQNVTFQVKRGEWLAIVGHNGSG
FT                   KSTIAKLLIGLLKPESGVIKLFHHVLDEQTVWEIRRRIGMVFQNPDNQFVGTTVEDDVA
FT                   FALENNGIPRDEMVKRVHEAIRQVQMEEFLHHEPHHLSGGQKQRVAIAGILALRPDLII
FT                   LDEATSMLDPKGRQEVLDTVRNLNKKQRITVLSITHDLEEVAKADRVIVMNKGEMMAEG
FT                   TPKQIFALGTKLERIGLDLPFAVKVRERLKQRGIPLSSSYFTIEELVEELWTLYLKR"
FT   gene            150355..151230
FT                   /locus_tag="GY4MC1_0140"
FT   CDS_pept        150355..151230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0140"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_0141 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72996"
FT                   /db_xref="GOA:A0A0F6BHU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP72996.1"
FT                   /translation="MDIIFEKVEHVYNANSPFARRALYDVDIMIESGSYVAVIGHTGSG
FT                   KSTLLQHLNGLLQPTSGIVKVGNQTITNKKRQRNLKPLRKKVGIVFQFPEHQLFEETVE
FT                   KDICFGPMNFGIPEEEAKKKARELIKLVGLPEDVLAKSPFDLSGGQMRRVAIAGVLAME
FT                   PDVIVLDEPTAGLDPRGRKEIMEMFYRLHQEKRLTTVLVTHSMEDAAAYADYMIVMHKG
FT                   TVWKTGTPQQIFQDSDALAEIGLHVPETVRLKQELEKKLGIAVPSPCLTIEETVDAIQK
FT                   LFSKVSAHDE"
FT   gene            151223..152017
FT                   /locus_tag="GY4MC1_0141"
FT   CDS_pept        151223..152017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0141"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   gwc:GWCH70_0142 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72997"
FT                   /db_xref="GOA:A0A0F6BHU6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU6"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADP72997.1"
FT                   /translation="MNSMIIGKYVPGDSVIHRMDPRAKLLVIFLYVFIVFLANNSITYA
FT                   VLSIFTFSLVALSRIPFSFVLKGLKPIIWIVAITFLLHIFMTKEGDVLYQIGSFSIYES
FT                   GVKQGIFISLRFLLLIMITTLLTLTTTPIEVTDGVESLLGPLKKVHVPVHELALMMSIS
FT                   LRFIPTLMEETEKIIKAQTARGVDFTGGPFSERIKAIVSLLVPLFISSFKRAEELAIAM
FT                   EARGYRGGEGRTKFRQLVWKWTDTAFLAAVLVLAVVLFILRS"
FT   gene            152032..152778
FT                   /locus_tag="GY4MC1_0142"
FT   CDS_pept        152032..152778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0142"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: gwc:GWCH70_0143 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72998"
FT                   /db_xref="GOA:A0A0F6BHU7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU7"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADP72998.1"
FT                   /translation="MSKRIKCTLSYDGTHFFGYQIQPGKRTVQGELEQALEQIHKGKAI
FT                   RVTASGRTDAGVHAYGQVIHFDTFLSLSPEQWKKALNALLPDDIVIKDAQEAAPSFHAR
FT                   FSATAKEYRYKVRIAQERDVFLRHYCYHYPYPLDMEAMGRALRLIEGTHDFTSFCSAKT
FT                   DVDDRVRTIYKADMTVRDDLLEFRFIGNGFLYNMVRIIVGTILEVGQGKRSVDSISSAL
FT                   AAKDRRFAGKTAPPQGLYLWKVYYDN"
FT   gene            152933..153370
FT                   /locus_tag="GY4MC1_0143"
FT   CDS_pept        152933..153370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0143"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: gwc:GWCH70_0144 ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72999"
FT                   /db_xref="GOA:A0A0F6BHU8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU8"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADP72999.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAAILRGKHKPTF
FT                   TPHVDCGDHVIIINAEKIELTGKKLTKKLYYRHSLHPGGLKVRTALEMRTNYPEQMLER
FT                   AVRGMLPKGRLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
FT   gene            153393..153785
FT                   /locus_tag="GY4MC1_0144"
FT   CDS_pept        153393..153785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0144"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: gwc:GWCH70_0145
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73000"
FT                   /db_xref="GOA:A0A0F6BHU9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU9"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADP73000.1"
FT                   /translation="MAQVQYYGTGRRKTSVARVRLVPGDGRIVINDRDIRDYIPSEALI
FT                   EIVKQPLVLTETLGNYDVLVNVKGGGFSGQAGAIRHGIARALLQVDPDYRPILKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
FT   gene            153897..154337
FT                   /locus_tag="GY4MC1_0145"
FT   CDS_pept        153897..154337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0145"
FT                   /product="Protein of unknown function DUF2521"
FT                   /note="PFAM: Protein of unknown function DUF2521; KEGG:
FT                   gwc:GWCH70_0146 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73001"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV0"
FT                   /inference="protein motif:PFAM:PF10730"
FT                   /protein_id="ADP73001.1"
FT                   /translation="MNVITSFKKKKQEKQMLYERKMLRELSLERLKTQAIEHFSPLYRI
FT                   YRAFSSVIEEGCIDIAIEAYLLGANYSRFGYYGEPAEFVKRRCAQEEKYLIDALFDFLC
FT                   FWGNIGDGLADESLYLACEHYIAYWWMEGFEKGKKRRRLKLH"
FT   gene            154404..155111
FT                   /locus_tag="GY4MC1_0146"
FT   CDS_pept        154404..155111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0146"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: gwc:GWCH70_0147
FT                   N-acetylmuramoyl-L-alanine amidase CwlD; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73002"
FT                   /db_xref="GOA:A0A0F6BHV1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV1"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ADP73002.1"
FT                   /translation="MKTKWLAALMSSIIVIVLFQYIFANTTSTKSWNLPLSGRIIVLDP
FT                   GHGGPDGGAVGGDVVEEEVALKVAEKLRDYLQQQGALVLMTREMDSDLADKDTRGYRRR
FT                   KVEDLRKRVALINESEADLFISIHLNAIPSPRWRGAQTFYYGSLLENERLAKFIQAELR
FT                   RNLENTDRVAKRIDTVYLLKYAKKPGALVEVGFLSHPEERELLASDRYQTKLAAAVYKG
FT                   VLRYFSNEKNPPE"
FT   sig_peptide     154404..154478
FT                   /locus_tag="GY4MC1_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            155202..156221
FT                   /locus_tag="GY4MC1_0147"
FT   CDS_pept        155202..156221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0147"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: gwc:GWCH70_0148
FT                   chromosome partitioning ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73003"
FT                   /db_xref="GOA:A0A0F6BHV2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV2"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADP73003.1"
FT                   /translation="MMLTESDVKGLLENIKDPFLNKTFKETNAIQEIKIKEDKKHVSVK
FT                   IALAKTGTADQLRVQTTIVQLLKDAGAASVGLRFAQLPEEVVAKYQGEKAKTTYIAIAS
FT                   GKGGVGKSTISVNLAISLARLGKKVGLVDADIYGFSVPDMMGIVERPTVRGDKIIPVER
FT                   FGVKVISMGFFVEDNAPVIWRGPMLGKMLNNFFKEVEWGDLDYLLLDLPPGTGDVALDV
FT                   HTMLPSCKEIIVTTPHPTAAFVAARAGAMALRTEHEIIGVIENMSYFESKKTGEREYVF
FT                   GKGGGEKLAKELQTELLGQLPLQQPDWNDSDFAPSVYAEDHPIGKIYMDIARKIVEKC"
FT   gene            complement(156277..156873)
FT                   /locus_tag="GY4MC1_0148"
FT   CDS_pept        complement(156277..156873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0148"
FT                   /product="spore germination protein GerD"
FT                   /note="KEGG: gwc:GWCH70_0149 spore germination protein
FT                   GerD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73004"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV3"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0149"
FT                   /protein_id="ADP73004.1"
FT                   /translation="MKKSTLLLLFSYFLILGSCAPQDISPPPPDYDQTKKMVVDILKTD
FT                   EGKKAIQEIMADEKVKQQLVIEQAVVKETLQQVLTSEKGIKFWEKAMQDPKFAESFAKS
FT                   LKTEQEKTIKALMKDPEYQGMMIDILKNPEMEKAMTDVLKSKQFRQHLQQVITETLNSP
FT                   LFQAKIQDILVKSAENIQQETKKQNEDQDETNSNQ"
FT   gene            157030..157635
FT                   /locus_tag="GY4MC1_0149"
FT   CDS_pept        157030..157635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0149"
FT                   /product="KinB signaling pathway activation protein"
FT                   /note="KEGG: gwc:GWCH70_0151 KinB signaling pathway
FT                   activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73005"
FT                   /db_xref="GOA:A0A0F6BHV4"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV4"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0151"
FT                   /protein_id="ADP73005.1"
FT                   /translation="MNSRKWVRLFLTTLAIGGITTAVIGVILNWGEYEKLFLRMDVLEF
FT                   AAVLMWHIGVGFIFSIISQMGFFAYLTIHRFGLGVFRSASLWNSVQIVLILFVLFDLVY
FT                   FRYQVFAVKGESVVGYILIALFILVAGLVVAYVKSAQTNRGAFIPALFFMVVVTVIEWF
FT                   PALRINDKDWLYLMLFPLLICNAYQLLILHKLTGVAKS"
FT   sig_peptide     157030..157107
FT                   /locus_tag="GY4MC1_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.511 at
FT                   residue 26"
FT   gene            complement(157747..158508)
FT                   /locus_tag="GY4MC1_0150"
FT   CDS_pept        complement(157747..158508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0150"
FT                   /product="polysaccharide deacetylase family sporulation
FT                   protein PdaB"
FT                   /note="KEGG: gwc:GWCH70_0152 polysaccharide deacetylase
FT                   family sporulation protein PdaB; TIGRFAM: polysaccharide
FT                   deacetylase family sporulation protein PdaB; PFAM:
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73006"
FT                   /db_xref="GOA:A0A0F6BHV5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV5"
FT                   /inference="protein motif:TFAM:TIGR02764"
FT                   /protein_id="ADP73006.1"
FT                   /translation="MNFFYALNGRSLKNTLIVVLSAFFTAIILYAQGMDNPALSLSTGP
FT                   KAIYKVKKSKEEISLTFDISWGDQNALHILDVLKQNDIKNATFFLSASWAERHPNIVKR
FT                   IKEDGHEIGSMGYNFVNYTELESAKIRQDLMQAKKIFDTLGIKEITLLRPPSGNFNKNV
FT                   LKIADSLGYTVVHWSVDSKDWLNPGVKKIVENVVNDMEAGDIVLLHASDSANQTAKALP
FT                   KIIEAMKKSGYRNVSVSQLIANGEANSQEIN"
FT   sig_peptide     complement(158407..158508)
FT                   /locus_tag="GY4MC1_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.804 at
FT                   residue 34"
FT   gene            158572..158739
FT                   /locus_tag="GY4MC1_0151"
FT   CDS_pept        158572..158739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73007.1"
FT                   /translation="MKHILRFCFSVMAKMLKEFRKRCKKKGVKAIPFFVVQLRNGEGIF
FT                   SIRQNVDKKH"
FT   gene            159028..160574
FT                   /locus_tag="GY4MC1_R0029"
FT   rRNA            159028..160574
FT                   /locus_tag="GY4MC1_R0029"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            160924..163851
FT                   /locus_tag="GY4MC1_R0030"
FT   rRNA            160924..163851
FT                   /locus_tag="GY4MC1_R0030"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            163988..164104
FT                   /locus_tag="GY4MC1_R0031"
FT   rRNA            163988..164104
FT                   /locus_tag="GY4MC1_R0031"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 105.09"
FT   gene            164258..164332
FT                   /locus_tag="GY4MC1_R0032"
FT                   /note="tRNA-Asn1"
FT   tRNA            164258..164332
FT                   /locus_tag="GY4MC1_R0032"
FT                   /product="tRNA-Asn"
FT   gene            164334..164406
FT                   /locus_tag="GY4MC1_R0033"
FT                   /note="tRNA-Thr1"
FT   tRNA            164334..164406
FT                   /locus_tag="GY4MC1_R0033"
FT                   /product="tRNA-Thr"
FT   gene            164428..164499
FT                   /locus_tag="GY4MC1_R0034"
FT                   /note="tRNA-Glu2"
FT   tRNA            164428..164499
FT                   /locus_tag="GY4MC1_R0034"
FT                   /product="tRNA-Glu"
FT   gene            164512..164587
FT                   /locus_tag="GY4MC1_R0035"
FT                   /note="tRNA-Val2"
FT   tRNA            164512..164587
FT                   /locus_tag="GY4MC1_R0035"
FT                   /product="tRNA-Val"
FT   gene            164727..164799
FT                   /locus_tag="GY4MC1_R0036"
FT                   /note="tRNA-Thr2"
FT   tRNA            164727..164799
FT                   /locus_tag="GY4MC1_R0036"
FT                   /product="tRNA-Thr"
FT   gene            164809..164890
FT                   /locus_tag="GY4MC1_R0037"
FT                   /note="tRNA-Tyr1"
FT   tRNA            164809..164890
FT                   /locus_tag="GY4MC1_R0037"
FT                   /product="tRNA-Tyr"
FT   gene            164961..165035
FT                   /locus_tag="GY4MC1_R0038"
FT                   /note="tRNA-Gln1"
FT   tRNA            164961..165035
FT                   /locus_tag="GY4MC1_R0038"
FT                   /product="tRNA-Gln"
FT   gene            165161..165233
FT                   /locus_tag="GY4MC1_R0039"
FT                   /note="tRNA-Lys2"
FT   tRNA            165161..165233
FT                   /locus_tag="GY4MC1_R0039"
FT                   /product="tRNA-Lys"
FT   gene            165241..165312
FT                   /locus_tag="GY4MC1_R0040"
FT                   /note="tRNA-Gly2"
FT   tRNA            165241..165312
FT                   /locus_tag="GY4MC1_R0040"
FT                   /product="tRNA-Gly"
FT   gene            165332..165404
FT                   /locus_tag="GY4MC1_R0041"
FT                   /note="tRNA-Ala4"
FT   tRNA            165332..165404
FT                   /locus_tag="GY4MC1_R0041"
FT                   /product="tRNA-Ala"
FT   gene            165552..166472
FT                   /locus_tag="GY4MC1_0152"
FT   CDS_pept        165552..166472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0152"
FT                   /product="arginase"
FT                   /note="KEGG: gwc:GWCH70_0153 arginase; TIGRFAM: arginase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73008"
FT                   /db_xref="GOA:A0A0F6BHV7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV7"
FT                   /inference="protein motif:TFAM:TIGR01229"
FT                   /protein_id="ADP73008.1"
FT                   /translation="MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERL
FT                   HYEIEDLGDVSIGKMEWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGG
FT                   DHSIAIGTLAGVAKHYQNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTK
FT                   IGGYSPKVKPENVVLIGVRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQ
FT                   GRTDGVHLSLDLDGLDPHDAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNP
FT                   ILDERNKTASVAVGLMGSLFGEKLV"
FT   gene            166631..167194
FT                   /locus_tag="GY4MC1_0153"
FT   CDS_pept        166631..167194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0153"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: gwc:GWCH70_0154 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-W
FT                   factor; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73009"
FT                   /db_xref="GOA:A0A0F6BHV8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV8"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ADP73009.1"
FT                   /translation="MEIFVKKRIKAIKKGDQNAYADIVDLYKDKIYRLCYRMLGNRHEA
FT                   EDTAQEAFIRAYVNIHTYNPNMKFSSWLYRIATNLAIDKIRKKKPDAYLDEEISGTDGL
FT                   TMYSQLSSSEASPEETLESLELQETVQKAIEKLPEKYRSVIVLRYIEDLSLQEISEILD
FT                   LPLGTVKTRIHRGREALRKHLGHL"
FT   gene            167209..167820
FT                   /locus_tag="GY4MC1_0154"
FT   CDS_pept        167209..167820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0154"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: gwc:GWCH70_0155 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73010"
FT                   /db_xref="GOA:A0A0F6BHV9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHV9"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0155"
FT                   /protein_id="ADP73010.1"
FT                   /translation="MKCPHNIVNLMHDYLDGDIEPNDAKILREHLQQCSACADHFNGLK
FT                   KTVAFIQHASHLIPPADFTARVMAKLPKEKKMIRMRRWLQNHPFITAASLFVILTIGSL
FT                   FTTWNEQRQFSVSAHENVIIRGHTVIVPKGEVVKGDIVVRNGSIKIEGKVEGNVTVIHG
FT                   EKYLASAGQVTGELEEINQVFEWIWYNIKERVKDVMEVFE"
FT   gene            167920..168744
FT                   /locus_tag="GY4MC1_0155"
FT   CDS_pept        167920..168744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0155"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   gwc:GWCH70_0156 protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73011"
FT                   /db_xref="GOA:A0A0F6BHW0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW0"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADP73011.1"
FT                   /translation="MPFGELPILNYLGKIVDILVVWYVIYKSIMMIRGTKAVQLLKGII
FT                   LIMLVHIVSNFLGLSTLQWLMDRAITWGFLALIIIFQPELRRALEQLGRGRLFSRSSAN
FT                   DDEEQTKMVEAIIKATEYMAKRRIGALISIERETGMGDYIETGIILNARVSSELLINIF
FT                   IPNTPLHDGAVIIQKNHVAAAACYLPLSESPFISKELGTRHRAALGISEVTDSITVVVS
FT                   EETGAVSITKNGELHRDLTPEQFRELLTKELVPATKATSSSRWQWRGKRHDG"
FT   gene            168734..169972
FT                   /locus_tag="GY4MC1_0156"
FT   CDS_pept        168734..169972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0156"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: gwc:GWCH70_0157
FT                   YbbR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73012"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW1"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADP73012.1"
FT                   /translation="MMDKLMNNHWFIKIFSLLLAIMLYMSANIEKETKSGVITRNTVGQ
FT                   EDTETLTNVPVVVYYDEENLIVSGIPKYVNLTLQGPASIVKPTALQRDFEVYIDLTDLP
FT                   LGTYTVPIKYKDISDKLKVKIHPSTIRVTIQEKVSKNFSVGVDLINKTKVPEGYTIEQP
FT                   LVKPNSVTITGAKQLIDSISSVRARIDLDGATDTVTQESRVTVYDSRGNVLNLDVQPSV
FT                   VEVTVPIKSPSKTVPLKINRTGSLRKGLSIVKIETIPNQVTIFGEKETIDSIEFIDGIT
FT                   IHLDEITKDTTLEMNVPLPKGIKSVDPSKVKIVVDVQEEKTKTLKDVPIHVVGLGDQYT
FT                   VDFIDPQEGEMDVQLYGAPDVLDSIQTDDVTLYVDVSDLGVGEHEVKAELNGPQNIKWE
FT                   LPKKNVKIKINER"
FT   gene            170002..171348
FT                   /locus_tag="GY4MC1_0157"
FT   CDS_pept        170002..171348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0157"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: gwc:GWCH70_0158 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73013"
FT                   /db_xref="GOA:A0A0F6BHW2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW2"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADP73013.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFKIGRCGGYVLTKSEKRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEQEIEALIDSPEDMLPRPIGEALGQVNDYFEGGQKYLQYL
FT                   KQTIDEDFSGIKIALDCAHGATSSLATHLFADLEADVVTMGASPNGININEGVGSTHPE
FT                   ALAAFVKEKGADVGLAFDGDGDRLIAVDEYGNIVDGDQIMYICAKYLKEIGRLKQQTVV
FT                   STVMSNLGFYKALEAQGIQSVQTAVGDRYVVEEMRKNGYNLGGEQSGHIIFLDYNTTGD
FT                   GLLTALQLVNIMKIKEKPLSELASEVKKYPQLLVNVKVADKHKVMENEKVKAVIQEVEK
FT                   EMSENGRVLVRPSGTEPLVRVMVEAPTEETCRNYVERIASVIREEMGTE"
FT   gene            171816..173618
FT                   /locus_tag="GY4MC1_0158"
FT   CDS_pept        171816..173618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0158"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: gwc:GWCH70_0159
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73014"
FT                   /db_xref="GOA:A0A0F6BHW3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW3"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADP73014.1"
FT                   /translation="MCGIVGYIGQHDVKEILLRGLEKLEYRGYDSAGIAMLNEEGIHLF
FT                   KEKGRIADLRAVVDPNTSATLGIGHTRWATHGAPSRINAHPHQSASGRFTLVHNGVIEN
FT                   YAILQQEYLQDVALKSDTDTEIIVQLVEKFVNDGLSVEEAFRKTLTLLKGSYAIAMIDA
FT                   ENQEVIYVAKNKSPLLVGIGNGFNVVASDAMAMLQVTNQFVELMDKEMVVVTRESMTIK
FT                   NLNGDIIERAPFTAELDASDIEKGTYPHYMLKEIDEQPFVMRRIIQKYQDENGQLTIAP
FT                   EVVAEVVNADRLYIIACGTSYHAGLVGKQLIEKWAKIPVEVHVASEFSYNMPLLSEKPL
FT                   FIYISQSGETADSRAVLVQTKKLGHKAITITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAILATAAAKAKGIALDFDLKKELGIIANVMEMLCDAKEEMEKIAREYLS
FT                   TTRNCFFIGRAVDYYVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVVALST
FT                   QEHVNLSIRGNVKEVVARGANPCIISMRGLETDEDRYVIPAVHPMLTPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            173940..174419
FT                   /locus_tag="GY4MC1_0159"
FT   CDS_pept        173940..174419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0159"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: gwc:GWCH70_0160 flavin reductase domain protein
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73015"
FT                   /db_xref="GOA:A0A0F6BHW4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW4"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADP73015.1"
FT                   /translation="MDAKAKKTALRGITYGLYIVGTKDENGAANAFAGNWLTQTSFNPP
FT                   LVAVAVKVGTRSQEQIAKSGVFSVNILETGQKDMVTAFFKSLEPEGNKLAGYEFYTEET
FT                   GCPIFKDALSFFECKVVEKVEKGDHYIYVGEVINAGVHREGDPLTLKETGFYYGG"
FT   gene            174680..175099
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0160"
FT   gene            175582..176475
FT                   /locus_tag="GY4MC1_0161"
FT   CDS_pept        175582..176475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0161"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: gka:GK0170 AraC/XylS family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73016"
FT                   /db_xref="GOA:A0A0F6BHW5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADP73016.1"
FT                   /translation="MRTVNYQRIIQKAINYIEDNLHESLTLENIASYAGFSKYHFLRIF
FT                   QKETGITVGDYVRIRRLASAASMLLYTDESIINIAYYFRFGTQESFTRAFKKVYHMPPG
FT                   QYRRIMSSIINKNGGKNMKQQQQIKGWFLSGSHPFNYEMGIDTKEVHQGKCSGYLKSVT
FT                   VQSADEFATMMQQFKAEKFLGKRVKLSAFVKTKNVEGFCGLWMRVDNALNDVLQFDNMS
FT                   DRPIVKDTNWNLYSIVLDVPENSALISFGVLLSGKGHVWVDQFKFEEVDKSVPTTNLEI
FT                   AYDVLDEPINLSFEEE"
FT   gene            complement(176602..176805)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0162"
FT   gene            177689..178567
FT                   /locus_tag="GY4MC1_0163"
FT   CDS_pept        177689..178567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptm:GSPATT00027155001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW6"
FT                   /inference="similar to AA sequence:KEGG:GSPATT00027155001"
FT                   /protein_id="ADP73017.1"
FT                   /translation="MHSSVSFNYHTLHFKNVQHIPLNPTAPLVKIKNASSITLDKLTLS
FT                   NVIGNVTTSNQKIKVTEVKGEEQQNSDYEQYFSSFFENLEGVSEEEKNQLSELVKAALK
FT                   YNEDYFSSWTSDKASMYYLQTQEKLNLIADNVAGGSIKEQLKAITKQYTNDKLKQIVNT
FT                   SLETYQIIYDRFKGKGGPYSEIAKQMKNAIEEIQNGNHADQISQQQLSQLFSDLNTNSS
FT                   FQIGYEKIMRGYKEIQKRQLGKYWNTFSEADVDKTINMLREDWNNFVSQFQMFEPYRVS
FT                   IGSQSRIDMKI"
FT   gene            179430..179645
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0164"
FT   gene            179748..180401
FT                   /locus_tag="GY4MC1_0165"
FT   CDS_pept        179748..180401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0165"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: bat:BAS4107 HAD superfamily hydrolase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73018"
FT                   /db_xref="GOA:A0A0F6BHW7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADP73018.1"
FT                   /translation="MIKAIIFDFDGLIVDTETAWFEAYKETMSLYKVDLPLERFVECVG
FT                   SDNTALYEFFKQQLGESCDIAEIEAKAKSLYKIKMKTPQAREGVKDYLEEAKKWGYKIA
FT                   IASSSTKEWVTHYLKELGLLHYFEVMITQDDVDKVKPAPDLYLKAVDALNISPNEALAF
FT                   EDSLNGLQAALAAGLKCVIVPNPVTESLPFENYDLRLTSMTEKRFIDVIKQIEQ"
FT   gene            complement(180753..180917)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0166"
FT   gene            181779..182564
FT                   /locus_tag="GY4MC1_0167"
FT   CDS_pept        181779..182564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0167"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bsu:BSU32000 2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73019"
FT                   /db_xref="GOA:A0A0F6BHW8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP73019.1"
FT                   /translation="MEHWGLQGKIALVTGAAQGIGEAVTRSFVKHGVSVAAVDRNGERL
FT                   AALVSDLQSNGYDVQAFCADVANSAEIDEIVAQIEDNMGPIEILVNVAGILRTGLIESF
FT                   MDEDWEEVFKVNTAGVFYVSRSVSRRMIPRRSGAIVTVSSNAATIPRMFMAAYAASKAA
FT                   ATMFTKCLGLELARYHIRCNVVSPGSTETEMQRGLWTDENGANKVITGSMEEFRLGIPL
FT                   QKLAQPSDIADAVLFLVSEQSRHITMHDLRVDGGATLDA"
FT   gene            182588..183826
FT                   /locus_tag="GY4MC1_0168"
FT   CDS_pept        182588..183826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0168"
FT                   /product="isochorismate synthase"
FT                   /note="KEGG: bsu:BSU31990 isochorismate synthase DhbC;
FT                   TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73020"
FT                   /db_xref="GOA:A0A0F6BHW9"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHW9"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ADP73020.1"
FT                   /translation="MKTKTIQHVTAEQLLAEYKEGTSFFLASPHRTLLAQGIFATVPTD
FT                   GYEHKRMQILDHVKKVLQDAKQQGINGNPIVVGAIPFDHMYPAQLIVPSEVKWSGPLPF
FT                   GQWNGQIGQNAANEYEVKPVPSPQEYENAVEQGLSRIKAGDLRKVVLSRSLHLASSEKI
FT                   DVPHLLRKLAVHNPNGYTFAAALPERLDREAGKASGTKKNRTLLGASPELLVSKSGLRV
FT                   IANPLAGSAPRSEDPEEDQRRANALFSSAKDRHEHAVVIEAVANALRPFCKTLSVPEEP
FT                   SLIHTETMWHLSTVISGELSSPSITSLELALALHPTPAVCGTPTPLAKKAIQEIESFER
FT                   GFFTGMVGWCDNEGDGEWIVAIRCAEVEDYSLRLFAGAGVVEGSTPKGELAETSAKFRT
FT                   MLQAIGLNNDILK"
FT   gene            183843..185468
FT                   /locus_tag="GY4MC1_0169"
FT   CDS_pept        183843..185468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0169"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="KEGG: bsu:BSU31980 2,3-dihydroxybenzoate-AMP ligase;
FT                   TIGRFAM: 2,3-dihydroxybenzoate-AMP ligase; PFAM:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73021"
FT                   /db_xref="GOA:A0A0F6BHX0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX0"
FT                   /inference="protein motif:TFAM:TIGR02275"
FT                   /protein_id="ADP73021.1"
FT                   /translation="MLSGCPTWPKEFADFYRKEGCWAGETFGDMLRERALKYGDRIAVT
FT                   SGERQISYKELDRRADQLASGFRQLGIRPADRVVVQLPNRIEFFEVCFALFRLGALPVF
FT                   ALPSHRYSEISYFCEFSEAAAYIIPDQHGGFDFRSLAKQVKAAVPTLKHVIVVGEAGEF
FT                   EPLENLFIDPVQLPLVHSSDVAFFLLSGGSTGLPKMIPRTHDDYIYSLRVSAEICKLHQ
FT                   DSVYLAVLPIAHNYPLSSPGVLGTLYAGGKVVLADSPSPDEAFPLIQQEKVTITALVPP
FT                   LVWIWLDAASSCKYDLSSLQVLQVGGAKFSAEVAKRVKPVLGCTLQQVYGMAEGLVNYT
FT                   RLDDPEELIINTQGKPMSYYDEIRIVDEEDNEVEPGQVGELLTRGPYTIRGYYKAEAHN
FT                   AKAFTADGFYRTGDLVRMTPSGYLVVEGRVKDQINRGGEKIAAEEVENHLLAHPSVRDA
FT                   AVVAMPDEFLGERSCAFIILRDHSVKAAELKAFLQERGVASFKIPDRIEFVDSFPKTAV
FT                   GKINKRALRQIIAEKRQSAGKTNV"
FT   gene            185490..186410
FT                   /locus_tag="GY4MC1_0170"
FT   CDS_pept        185490..186410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0170"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG: bce:BC2305 isochorismatase; PFAM:
FT                   isochorismatase hydrolase; phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73022"
FT                   /db_xref="GOA:A0A0F6BHX1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX1"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ADP73022.1"
FT                   /translation="MAIPAIPAYPMPVSSELPKNKVSWTPAAKRAALLIHDMQNYFLDA
FT                   FPSNASPFVELVRNIQRLKKECKEMGIPVIYSAQPGGQTLEQRGLLQDFWGNGIADDPY
FT                   QKGIIDELAPDAKDIVLTKWRYSAFKKTNLLEILEGHGRDQLIICGVYAHIGCLLTASD
FT                   AFMQDIQVFFVADAVADFSLEHHKMALHYAASRCAFITPTQHLIEALKKEPVPDCQNIL
FT                   PMSLHDVRNQVAELIQESPADLSDHENLVNRGLDSIRMMSLVEKWRRAGAEVTFAALAA
FT                   RPTLFAWWNLLSSQSEKVLSAQDSQ"
FT   gene            186425..193600
FT                   /locus_tag="GY4MC1_0171"
FT   CDS_pept        186425..193600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0171"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; condensation
FT                   domain protein; Thioesterase; phosphopantetheine-binding;
FT                   KEGG: bsu:BSU31960 siderophore
FT                   2,3-dihydroxybenzoate-glycine-threonine trimeric ester
FT                   bacillibactin synthetase; SMART: Polyketide synthase,
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73023"
FT                   /db_xref="GOA:A0A0F6BHX2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PDB:5U89"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX2"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADP73023.1"
FT                   /translation="MSNRQHIRLPLSGAQAGIWFAQQLDPENPIYNTGEYIEINGPVDP
FT                   ALFEKALRHVLVEAESLHARFGEDENGPWQTIDPSPDFPFYFMDVSAAENPQEEAMLWM
FT                   KKDLSKPVDLTCGPLFTEALFKLSDHRFFWYQRIHHIAIDGFGFSLIAQKVAQVYTALV
FT                   DNAPVDGEKFASLHQVIEEEKAYHASKQYEHDREFWMERFRDRPEAVSLSDRAVRTSNT
FT                   FIRQTAYMSPASTEHFKQSAQHLKASWHEVFIAAAALYIHRLTGADDVILGLPMMNRLG
FT                   SSALNVPAMVMNIVPLRLHLHADMRLSELLSQVRQEIQEVRQHQKYRHEQLRRDLKLLG
FT                   ENQRLFGPQVNIMPFDYALHFGGYQGITHNLAAGPIDDLAINVRTDGNGLRIDFDANPE
FT                   IYSMDELAVHQARFLQLLETMESLEEDELIGKMNLLLEEERHQVLKKWNETAHPHPEEN
FT                   FLQLFEKQAERIPEAIAVICEDQALSYTELNQQANRLAHFLMEYGVGPEQYVALALPRS
FT                   AEMVIAMLAVLKTGAAYLPLDLDYPDERIAFMLEDTKPVCIVTSSSVQSKLSHFPSCST
FT                   IILDHPETEQAIKHYPDTNVPKTQSPLHPAYVIYTSGSTGKPKGVVVPFHSLNNFLLAM
FT                   REKFALKEHDRLLAVTTIAFDISALEIFLPLISGASLVVAKKETIQDPQALAAVISDKE
FT                   ITIMQATPTLWHMLVTHHPDCIAGLRVLVGGEALSSGLASALHRLACEVTNLYGPTETT
FT                   IWSTMSPLHPDDARAPSIGRPIWNTQVYVLDEQLQPVPPGVVGELYIAGSGLARGYLRR
FT                   PDLTAERFVANPYGPPGSRMYRTGDLVRWRMDGSLDYIGRVDHQIKLRGFRIEIGEIEA
FT                   VLSQCDLVERALVVAREDQPGDQRLVAYVIPCEQSKGTLDLAELRRYVSERLPDYMVPS
FT                   AFMVLNEFPLTPNGKIDRKALPAPDFTMTVKGRKPRNPQEEILCELFAEVLEIPVVGID
FT                   DHFFELGGHSLLAARLISRIRDVLGVEITIGKLFASPTVASLVKHLEDAENRKPPVKAY
FT                   ACKEDIPLSFAQRRLWFLYHLEGPSPTYNIPVVVHLTGELHYQALQQALYDVIERHEPL
FT                   RTIFPEHSGASRQVILEPHQARPELMIKEISESELSDELNAAVRYRFDLAAEPAIRAQL
FT                   FVLGPNRHVLLLLMHHMIVDGWSLTPLTRDIAAAYNAHCRNQKVEWAPLPVKYADYALW
FT                   QQEILGDETNPDSLIAKQLDYWKKTLAGLPEELELPTDYPRPAESSYEGGIVDFCMDAE
FT                   LHKRLLDLARENKASLFMVLQAGFAAFLTRLGAGTDIPIGSPIAGRNDDSLEHLVGLFI
FT                   NTLVLRMDTSGNPSFRELLGRVREVNLSAYENQDIPFERLVEILNPVRSRAKHPLFQVM
FT                   FVFQNTPEPKLELQGLESRLEIRSVGTAKFDLTLELRERRGEDGSPDGLIGLFEYSRDL
FT                   FDHTTVEAFAKRLCQLLREVVMNPDLPIGQIDMLLPEERKKLLTKADHNARSVPEECLP
FT                   VLFEKQVQKSPDAIAVSFEDQELSYAELNKRANQLAHFLIEKGVGPERVVALALPRSLE
FT                   MVIGILAVLKAGGTYLPLDPDYPEERIAYMMEDAQPMYVITNKGMASKLPHAGVAGHLI
FT                   IDESHVADMLETYAETNPDDSNRIEALSPYHTAYIIYTSGSTGRPKGVMIPHQNVVRLF
FT                   QSTEHWFQFTSDDVWTLFHSYAFDFSVWEIWGPFLYGGRLVIVPHHVSRSPKEFLQLLV
FT                   EQKVTVLNQTPSAFYQLMQADRENIELSRQLSLRFIIFGGEALELSRLEDWYERHADDM
FT                   PKLINMYGITETTVHVSYMELNKNIIAIKGSSLIGRNIPDLEVYVLDVNLQPVPPGVIG
FT                   EMYVAGAGLARGYLGRPDLTAERFVANPFGLPGSRMYRTGDLAKWRADGTLDYIGRSDH
FT                   QVKIRGYRIELGEIEAVLAKHPDIAQVAVVVREDQPGDKRLVAYIVPAKDVESGELRRY
FT                   VAARLPDYMIPSAFVMIEALPLTPNGKLDRKALPAPDWMIEITDRGPRTPQEEMLCDLF
FT                   MEVLRLPRVGIDDGFFELGGHSLLAVQLMSRIRETFGVELSIGDLFEAPTVAGLAEKLE
FT                   IGSSQSALDILLPLRTSGNQPPLFCVHPAGGLSWCYAGLMTAIGADYPIYGLQARGIAK
FT                   AENLPETLDEMAADYINQMKTVQPEGPYYLLGWSLGGNVAHAMATQLQQQGEEVALLVM
FT                   LDAYPSHFLPIAKAPDEQEALIALLALGGYDPDNMDGKPLNLENTMDMLRRDGSALASL
FT                   DESTILNLKDTYVNSVRILSEYVPQRYKGDLLFFRSTIIPEWFDPIEPEAWLPYIDGKI
FT                   IQHDIHCRHKDMCQPGPLAEIGRVLANKLKEKSHLITINGRGGSE"
FT   gene            193597..193836
FT                   /locus_tag="GY4MC1_0172"
FT   CDS_pept        193597..193836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0172"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: sro:Sros_6555
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73024"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="PDB:5U89"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX3"
FT                   /inference="protein motif:PFAM:PF03621"
FT                   /protein_id="ADP73024.1"
FT                   /translation="MTNPFENKEGTYLVLINDEGQYSLWPASIAIPPGWNIAFAENTRS
FT                   ACLDYINAHWIDMRPNSLKDGSLSKRDNDYSGVK"
FT   gene            194235..195026
FT                   /locus_tag="GY4MC1_0173"
FT   CDS_pept        194235..195026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0173"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   bwe:BcerKBAB4_2182 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73025"
FT                   /db_xref="GOA:A0A0F6BHX4"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX4"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ADP73025.1"
FT                   /translation="MTEWQVVNSIPPLSDHTCQVWLSKTTDMQPWHVRMLNDEERKRAQ
FT                   SFRKDQDRARFIVGCALSRLVLATQLNMAPHQVPIDRTCPICHEAHGRPRLPYGFLQWS
FT                   VSHSGNIILVAFTTDAPVGVDVEWMNTAWDFDVVKMADGILTEKEIAHILQMPANDRMR
FT                   GFFIYWTRKEAVLKATGEGLNIPPLNVVVSGPQQAPRLLAFTGRPDGTDDVALHDLDLG
FT                   FNYVAALSIFSKTQKRIEQYDASVLMQQGFGWKDYYISQKS"
FT   gene            195268..196920
FT                   /locus_tag="GY4MC1_0174"
FT   CDS_pept        195268..196920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0174"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bbe:BBR47_03420 probable transcriptional
FT                   regulator; PFAM: periplasmic binding protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73026"
FT                   /db_xref="GOA:A0A0F6BHX5"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX5"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73026.1"
FT                   /translation="MIIHHEAVKQEASDFSWDVSFLRLRDMQFIKGNGNWRMEQQLTVS
FT                   HVLIVVKSGQGRLTLDHDEYQLRPDTVYVCAPGETYGIEAEKASQLKLFLFKFDVFQVT
FT                   EQGYERVQGIKKERLFPLKGEIQISPAGQLVSLCDAIYDHWRSEDGLERFYSQFAFQEL
FT                   LYYIMKNRRLQAKESRTSLELAKEYMERYFNENLTIEQLARIANISPKYFVDLFKKTYG
FT                   ISAIDYLTELRINKAKQLMAQSDAKLRDIAHQVGYNDEFYFSRKFKKKVGVTPTVYMKS
FT                   RRRKIAAYKSPITGQLLALKIIPYAAPLHPKWTAYYYKMYRADISVPLSAYRKNQHWES
FT                   NIETLLHARPDMVISTDELEEREKEMLEQVAPVFYVPWLEKNWREQLLLTAEFLGETRE
FT                   AEHWLEIYERKVKFARDQLKREVGDDTFLIVRISKQNLYVHCNRSMSEVFYHDLQMVPA
FT                   YGGDRFIYDQQITLDQLVQIDADRLLLLVRQEEETLAFWKALQYSMPWQELKAVRNNKV
FT                   YLIPSDPWVEYSAYAHDRIIDESLRLFSGDCPK"
FT   gene            196917..197048
FT                   /locus_tag="GY4MC1_0175"
FT   CDS_pept        196917..197048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73027"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73027.1"
FT                   /translation="MNSGYRPWSGKRACFIIMNDNHYQYKKSEGGLKIYDEEEMALF"
FT   gene            197020..198021
FT                   /locus_tag="GY4MC1_0176"
FT   CDS_pept        197020..198021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0176"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bbe:BBR47_03430 probable iron-uptake ABC transporter
FT                   substrate binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73028"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX7"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73028.1"
FT                   /translation="MMKRKWLYFSLIALLILILTACGTKQSSAPDKATEGNSASSAAEQ
FT                   EKKAGANETRTIQYLGKSYTVPAKAERIVITGSMETMEDALVLGVKPLGGITVGGKFPD
FT                   MFKEITDSTVSIGEKAQPNIETILKLKPDVIFATAKFPPDVIQKLEKIAPTIPVSHIST
FT                   NWEANLRLLAELTGKQDVAEKVLKEYKEELAAAKAKLGDRLKDKKVVVIRIRGGNIMIY
FT                   REDVFFNPSLYMDLGLTAPQEIKNAQTQEMISLEKFSEMNPDYIFVQFSEDENKDQPDA
FT                   LKNLQNNPIWQSINAVKNNKVFVNVVDPLAQGGTAWSKIHFLKAVVEKLGNE"
FT   sig_peptide     197020..197106
FT                   /locus_tag="GY4MC1_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.580 at
FT                   residue 29"
FT   gene            198041..199048
FT                   /locus_tag="GY4MC1_0177"
FT   CDS_pept        198041..199048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0177"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bcy:Bcer98_2408 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73029"
FT                   /db_xref="GOA:A0A0F6BHX8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73029.1"
FT                   /translation="MRSKIVSPAFILWLSPIVVVFTIMASILYGAKNIDWETVWNAIFH
FT                   FDPGNVNHQIVMHSRLPRVIGALLIGAFLAMSGAIMQGMTRNYLASPSIMGVSDGSVFA
FT                   ITLCMILAPGASSLDMIMYSLIGSLFAVGIVFGLASLLPNGMSPVRMAIIGTIIGTFLS
FT                   SVSAAMASYFQVSQNVSFWYNARLHQMDPDMIKLAVPFALVGIALALFISKSITILSLG
FT                   EEVSVSLGQRTTLVKAMAVASVVILTGISVALAGNIGFVGLIIPHITRFLVGVDYRWII
FT                   PCAGVLGAIFLALSDIFSRFLNYPFETPIGVVTSLIGVPFFLYLIYKRGGGKHA"
FT   gene            199041..200063
FT                   /locus_tag="GY4MC1_0178"
FT   CDS_pept        199041..200063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0178"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bbe:BBR47_03450 probable iron-uptake ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73030"
FT                   /db_xref="GOA:A0A0F6BHX9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX9"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73030.1"
FT                   /translation="MLKNSAGRYWTVLLVNFGIVLIAVYVSLTNGVFDMTVMEVLKTLL
FT                   RIHPVPEHDLVIFDFRLPRIIVAALVGFGLGVAGAAIQGISRNGLADPGILGINAGAGA
FT                   AIVIFMFFFEGRITGSGWLSILAMPLFGWIGGLGTAVLIYFFAWRDGRLDPQRLILVGI
FT                   AAGSGLGALSLYLSLKMNPQDFEMATVWFTGSIWNANWQYITSMLPWLVLLIPIIIRKS
FT                   YILDLLQLGEESAKGLGVSTEKEKNILLLTSIGIVSACVSVSGNIGFVGLLAPHIAKRL
FT                   VGIHHYRALPVCGTIGMLLVIVSDFIAKTVFSPVELPVGVVISIIGIPYFVYLLFKTRV
FT                   "
FT   gene            200106..200672
FT                   /locus_tag="GY4MC1_0179"
FT   CDS_pept        200106..200672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0179"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bbe:BBR47_03460
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73031"
FT                   /db_xref="GOA:A0A0F6BHY0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY0"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADP73031.1"
FT                   /translation="MELSQLLRERRSIHVFEDRPVSPELVMELLDTAVWVPNHRMTQPW
FT                   RFILTYGEGRRKIAEAVRKIKESKEPDPSKKKEVGQKFYNKIMSIPMILTVLMREDPNL
FT                   IVREEDYASTSCVIHNFSLLAWEKGIGMVWETYGWLHEPIFRETMGIQPVEKVVGNLHI
FT                   GYPAKIPSAQPRIPAAHLITVFDQA"
FT   gene            200697..201497
FT                   /locus_tag="GY4MC1_0180"
FT   CDS_pept        200697..201497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0180"
FT                   /product="esterase"
FT                   /note="PFAM: esterase; KEGG: bbe:BBR47_03460 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73032"
FT                   /db_xref="GOA:A0A0F6BHY1"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY1"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADP73032.1"
FT                   /translation="MNGTLVTESFAGRELFIYLPPSYGTSRAAFPVVYVQDGGDLFDPR
FT                   QNNSLARLEYMFANGELGELLLVGIEPKNRLDEYTPWHAKALSDKYADFGGQGSDYLSF
FT                   LVEKLKPYIDRKYKTDGRRQQTGIIGASLGGLISIYAAYLYPNVFGKIGSISGSFWYEG
FT                   FIGFMQSKNIDPGLKMYMDVGSIEGIGKQSIQKEMVSKTKEACTILMNNGLASERLRFV
FT                   LEEGAPHGRIFFSKRFPEALKWLYSNETDLPAGGGCPPTSIMHK"
FT   gene            201523..202383
FT                   /locus_tag="GY4MC1_0181"
FT   CDS_pept        201523..202383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0181"
FT                   /product="esterase"
FT                   /note="PFAM: esterase; KEGG: bsu:BSU32010 bacillibactin
FT                   trilactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73033"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY2"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADP73033.1"
FT                   /translation="MAHKKMEQTSMMVKNTTVREFTIPRTEQRIMHSRAGNREYQIFVA
FT                   KPDGDPPPSGFPVIYLLDANAVFGTMVEAMRVQANRSDKTGVVPTVIVGIGYPTEMPFA
FT                   PARFYDFTMPVSVDELPARPDGAAWPELGGAEAFLTFIEEELKPEIEDEFPIDRERQAL
FT                   FGHSLGGLFALSVLFTKPVAFRTYIAGSPSIHWNKRFLREAEQQFVSRLQRETLNVDVL
FT                   LAVGELEKSHKSRISNNAKELAERLSALSDRGVYVEFEEFKGEGHVSVLPALVSRALRF
FT                   ASRRA"
FT   gene            complement(202781..203782)
FT                   /locus_tag="GY4MC1_0182"
FT   CDS_pept        complement(202781..203782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0182"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bwe:BcerKBAB4_0329 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73034"
FT                   /db_xref="GOA:A0A0F6BHY3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY3"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73034.1"
FT                   /translation="MIQSALIKKQRRILVILLILIMATIVIGMGTGYSSLSYDRLIPVL
FT                   FGQGTFKEEFILFSIRLPRIVITLLAGMALALSGAILQGITRNDLADPGILGINSGAGV
FT                   GVAVFFLFFPIQSNSFAYLIPLIAFISALLTACFIYLLSYNRNAGFQPVRLVLIGVGFS
FT                   MALSGAMIVLISSAERTKVDFIAKWLAGNIWGDDWPFILAILPWLIVLIPLTLYKANRL
FT                   NILELNEPMAIGVGLEIQKERILLMITAVALAAAAVSVTGGIAFIGLMAPHIAKALIGP
FT                   RNQLFIPIAILMGGWLLLFADTIGRNIADGIPTGIIVSLIGAPYFIYLLLRK"
FT   sig_peptide     complement(203696..203782)
FT                   /locus_tag="GY4MC1_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.490 at
FT                   residue 29"
FT   gene            complement(203779..204789)
FT                   /locus_tag="GY4MC1_0183"
FT   CDS_pept        complement(203779..204789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0183"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG: fhuB;
FT                   ferrichrome import ABC transporter permease FhuB"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73035"
FT                   /db_xref="GOA:A0A0F6BHY4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73035.1"
FT                   /translation="MTAKTERSIPFIYKFIVAIFALAGMFLIAMVLGAANTTIKDVWLA
FT                   LTSHVKNEQILIIRELRLPREIAAVFVGAALATSGAIMQGITRNPLADPGLLGLTAGAN
FT                   AALAITMAFIPSANYFSITIACFIGAAVGSMMVFGIGAMKKGGFSPLRMVLAGAAVSTF
FT                   LYAISEGVGIYFKISKDVSMWTAGGFIGTSWHQLQVIVPFIAIGMLISLFFSRQLTILS
FT                   LNEEVAVGLGQKTTQIKTILFFAIILLTGASVALAGNMTFIGLMVPHIVRAMVGTDYRF
FT                   ILPMSAILGATLTLLADTLGRTINAPYETPVAAIVAIMGLPFFLFIVHKGGKTLS"
FT   sig_peptide     complement(204685..204789)
FT                   /locus_tag="GY4MC1_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.752 at
FT                   residue 35"
FT   gene            complement(204870..205793)
FT                   /locus_tag="GY4MC1_0184"
FT   CDS_pept        complement(204870..205793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0184"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73036"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY5"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73036.1"
FT                   /translation="MKKLLIPFIVLIVLVMSACGGKTTENKDNSAAKEKEPETITYQSE
FT                   NGPIEVPAHPKRVVVLSSFAGHVMALGVNIVGVDQWSKMNPRFQDKLKNAEVVTDEDIE
FT                   KIIELNPDLIIGLSNTKNVDKLSKIAPTVTYTYGKVDYLTQFLEIGKLLNKEKEAKAWI
FT                   DDFKKRAQQAGEEIRAKIGENATVSVIENFDKQLYVFGNNWGRGTEILYQEMKLKMPKK
FT                   VEEMALKQGYYALSLEALPQFAGDYLIISKNPDGDTSFQQTETYKNLPAVKNHRVFEAN
FT                   AKEFYFNDPITLEYQLDFFKKHFLGE"
FT   sig_peptide     complement(205728..205793)
FT                   /locus_tag="GY4MC1_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.438 at
FT                   residue 22"
FT   gene            complement(205798..206589)
FT                   /locus_tag="GY4MC1_0185"
FT   CDS_pept        complement(205798..206589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0185"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: afl:Aflv_1159 ferrichrome ABC transporter
FT                   (ATP-binding protein); PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73037"
FT                   /db_xref="GOA:A0A0F6BHY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73037.1"
FT                   /translation="MVRLYTKDLNIGYHEQLIVKNLNIQIPDQKITAIIGPNGCGKSTL
FT                   LKTLTRIITPQSGTVVLDGKQIFHENTKILARKMAILPQTPESPGGLTVGELVSYGRFP
FT                   YQKGFGHLTKKDYEVIDWALEVTGTIEFKYRPVDSLSGGQRQRVWIAMALAQETDIIFL
FT                   DEPTTYLDMAHQLEVLELLQKLNVEQGRTIVMVLHDLNQAARFADYIIALKDGKIVKAG
FT                   NGDEVMTRDVLKQVFHIDAEIGRDPRTNKPICLTYHLLKGE"
FT   gene            206772..207821
FT                   /locus_tag="GY4MC1_0186"
FT   CDS_pept        206772..207821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0186"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: afl:Aflv_0174 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73038"
FT                   /db_xref="GOA:A0A0F6BHY7"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73038.1"
FT                   /translation="MEREELYDVTIIGGGPAGLYAAFYSGLRKMKTKLIECQPQLGGKL
FT                   HVYPEKIIWDVGGHAPITGEQLMKQLVKQGLTFHPTVILNEKVVSMKRQNDGIFVLSTA
FT                   SGQQHFSKTVIVAVGSGILKPKKLEIEGAEKFEVTNLHYTVKSLKRFKDKTVIISGGGN
FT                   SAIDWANELVPIAKKVYLTYRNEELKGHESQVTQLLNSSAVCYFNTSITKLIASANHEI
FT                   IDRVELTNHETGEVIYLPVDEVIVNHGYERDTSLLENSELDIKMVDNDYIAGNANCESS
FT                   VPGLYAAGDILKYDGKLNLIIGAFQDAANAVNSAKRFIEPAADPFGMVSSHNEIFKKQN
FT                   QEFIKQMMK"
FT   gene            208627..209481
FT                   /locus_tag="GY4MC1_0187"
FT   CDS_pept        208627..209481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0187"
FT                   /product="rRNA (adenine-N(6)-)-methyltransferase"
FT                   /note="PFAM: ribosomal RNA adenine methylase transferase;
FT                   KEGG: bha:BH0380 rRNA adenine N-6-methyltransferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73039"
FT                   /db_xref="GOA:A0A0F6BHY8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY8"
FT                   /inference="protein motif:PRIAM:2.1.1.48"
FT                   /protein_id="ADP73039.1"
FT                   /translation="MKKQNKRNHRTRKYIEWPNFSGQHLLHNKRIINDLIQIANLTSND
FT                   TVLDLGAGKGALTFPVAEKAGKVIAVEYDPRFVEILKKKAEAYPNIKVIQQDILKLRLP
FT                   KEPFIVVAGIPYAITTPIMKMLLHQPANSLQRAVLVMEKGAAKRFTSYPITNPLILKWR
FT                   MWFDLGYVREISRENFSPPPKVDSAILIIRRKKKLSIPYKYYDSFLGLAEYALKYPQLP
FT                   LYEALKGVFTPPQITRLVRNLGVNRNIAICLLNEIQWGIVFHTMVQYVQRPYWPKAKKH
FT                   KNN"
FT   gene            209510..210385
FT                   /locus_tag="GY4MC1_0188"
FT   CDS_pept        209510..210385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0188"
FT                   /product="rRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="KEGG: pjd:Pjdr2_1632 hypothetical protein; PFAM:
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73040"
FT                   /db_xref="GOA:A0A0F6BHY9"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY9"
FT                   /inference="protein motif:PRIAM:2.1.1.51"
FT                   /protein_id="ADP73040.1"
FT                   /translation="MSKKIICAKLINKFEKIFQCPICSSPMGIVDLKSLICSNNHTFDI
FT                   AKQGYVNLMTRSLATRYDKELFESRKIIAESGFFEPLYRMVSEWIKNDVRLEEETVKIL
FT                   DTGCGEGSHLSRIKQKISSHSTGEVLGVGIDIAKEGILVAAKHHSNMIWCVADLAHSPF
FT                   KSNTFDVILNILSPANYKEFQRLLNDNGIVIKVVPRSDYLKELREVFFDEPEKQSYSNQ
FT                   KIVRRFNANFETVDMFRLCYSISLSKALIPPLIHMTPLSWSATAEKIEALLNMNLSEIT
FT                   IDLDVLIGKK"
FT   gene            210548..211297
FT                   /locus_tag="GY4MC1_0189"
FT   CDS_pept        210548..211297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0189"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: transcriptional activator TipA; PFAM: TipAS
FT                   antibiotic-recognition domain-containing protein;
FT                   regulatory protein MerR; Transcription regulator MerR DNA
FT                   binding; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73041"
FT                   /db_xref="GOA:A0A0F6BHZ0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ0"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ADP73041.1"
FT                   /translation="MAMKVKEVADLVGISVRTLHYYDEIGLLTPEKTTESGYRLYTDDD
FT                   LEKLQQILFFKELGFPLKKVKEIINSPSFDRYEALVLQRKMLLEKRRRLDKMIATIDKT
FT                   IQHMKGEIQMTNKEKFEGFDFRHNPYEQEARKLWGDEAVDNANAKLRNMSKEEQEAIVK
FT                   AMNSIYQKLAALRHGSPESEEAQAAIKEWYDFLNNNFGNYSLEAFKGLGQMYVDDARFT
FT                   KNIDQFGEGLAKFMRDAMAVFADKNKK"
FT   gene            211607..212812
FT                   /locus_tag="GY4MC1_0190"
FT   CDS_pept        211607..212812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0190"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG:
FT                   bcm:Bcenmc03_6803 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73042"
FT                   /db_xref="GOA:A0A0F6BHZ1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ1"
FT                   /inference="protein motif:PFAM:PF01053"
FT                   /protein_id="ADP73042.1"
FT                   /translation="MDKRDHREEMNLEGLRTETLVIHGDDWVIDDRTVAPAIYYTATFR
FT                   AHNSREFAEMAGTPRHPRYYTRYGNPVHERVAKIMAELEGTETALVTGSGMGAIATTIL
FT                   TLVSAGDHVIAQTRHYMSTAKIMDEMLPRFGVEVTLVEQADINAFAEAIRPNTKLIMVE
FT                   TPANPTLVLTDLAAVVELARPRGIIVVADNTFASPINQRPHDLGVDVVIHSATKYLGGH
FT                   HDLTAGVICTSKELAERIWQTHISIGSVLSPMDAWLLLRGLRTLPIRMERINANALALA
FT                   EFLEEQPQVERVYYPGLPSHPQHELAKRQMRGFGAVIAFAIKGGYEETQRFVSALKLPP
FT                   NAVSLGGVDSLVVHTAAMWEGVMTEEQMKTAGIPANFVRFSVGLEHIDDLKADVWQALQ
FT                   VV"
FT   gene            212934..213383
FT                   /locus_tag="GY4MC1_0191"
FT   CDS_pept        212934..213383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73043"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ2"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1311"
FT                   /protein_id="ADP73043.1"
FT                   /translation="MKSSAANEVIALYQRLLDGWNDRNAAAMAEQFTEKGELIGFDGTQ
FT                   AIGREEIFAHLHPIFENHPTPPYVSKVKDVRFLASDIAILRAIAGMVPPGQSDVDPKLN
FT                   AHHTLVAVKNEECWRIELFQNTPVQFHGRPELAEQMTEELRQLLK"
FT   gene            213955..215124
FT                   /locus_tag="GY4MC1_0192"
FT   CDS_pept        213955..215124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0192"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: gka:GK0345
FT                   transposase of IS654-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73044"
FT                   /db_xref="GOA:A0A0F6BJ82"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ82"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73044.1"
FT                   /translation="MSKRSIPNVDWANQLENAIRQFVKEKLELIMREEIKNFLEIEQAG
FT                   TPNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSG
FT                   MSTREIGKFIERILGSTYSPATISRITDVVKEDIEKWHARPLHQRYSVLYLDGLYVKLR
FT                   RDTVEKEVIYVVLGVNEEGYREILDFFVGGQESAYVWQEILQQLYQRGVKEVLLGVFDG
FT                   LPGLEEAFKAVYPKADVQRCVVHKVRNTLSRVRKKDQFEMAEDLKLIYRSPNKEIALEM
FT                   FQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKP
FT                   MNSLSSLEAAEKVVYLTVQDFNEKWAERKLRGFAEAQEALERMFEERYH"
FT   gene            215287..216513
FT                   /locus_tag="GY4MC1_0193"
FT   CDS_pept        215287..216513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0193"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gyc:GYMC61_2573 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73045"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ4"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADP73045.1"
FT                   /translation="MPFSYVSHLYCPKCQKTYGTNKKHQLCECGSPLLVAYHLDALRAD
FT                   LSREIIASREPNLWRYHELLPVENPEHIVSLGEGMTPLVPMPRLGKDMDIEQLYMKDEG
FT                   VIPTGTFKARGAAVGISKAKELGVKKLAMPTNGNAGAAWSLYAARAGIQVTVVMPVDAP
FT                   TITRNECAIAGADLYLVNGLISDAGAIVSKAIQERNLYDASTLKEPYRIEGKKTMGLEI
FT                   AEQFSWQLPDVILYPTGGGVGLIGIYKALKELQDLGWVQGKMPRLVAVQAQNCAPIVKA
FT                   WNERKRVSEFWPNSSTVAFGINVPKALGDFLVLDALYKTDGCAIAVEDDAIINEQRNVA
FT                   NLEGAFICPEGAAAFVAARRLRERGWIRRGERVVVLNTGIGLKYTHTVSIEVPILQPGD
FT                   HLPERKDYS"
FT   gene            217065..217397
FT                   /locus_tag="GY4MC1_0194"
FT   CDS_pept        217065..217397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0194"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: gwc:GWCH70_0175 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73046"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ5"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP73046.1"
FT                   /translation="MSLRSQLLKGVLEGCILAIIKKESVYGYELSVKLQKFGLNDVSEG
FT                   SIYPLLLRLQKAGLIKGEMRDSPSGPKRKYYHLTEKGEEALQDFIAEWESIRKPVEKIL
FT                   RGGNME"
FT   gene            217394..218086
FT                   /locus_tag="GY4MC1_0195"
FT   CDS_pept        217394..218086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73047"
FT                   /db_xref="GOA:A0A0F6BHZ6"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ6"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0176"
FT                   /protein_id="ADP73047.1"
FT                   /translation="MNAKDLVALNNEKRKQLNEHNRNYYENMLVYIRSQLLLSEQQSEE
FT                   LLMELLDHLLEAQKHGKMAEDIFGTDAKAYCDELIRQLPKEKKRNIYAFIGYLAVRLFA
FT                   LGVLVTGAVELVAEWFTDVDDTVYLGKASVLFVIDFAVILLAVALVMRWIRKSAFHDDS
FT                   STFGGKVKEFLGIWFACCLVIGMFVLAEKLVPEFGYRIEAGGMVRILFGLFVFAVTWRL
FT                   NKKFRITK"
FT   gene            218228..218938
FT                   /locus_tag="GY4MC1_0196"
FT   CDS_pept        218228..218938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0196"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: gwc:GWCH70_0177
FT                   DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73048"
FT                   /db_xref="GOA:A0A0F6BHZ7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ7"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADP73048.1"
FT                   /translation="MKIEVWSDFVCPFCYIGKRRLEKALEQFPHKDQVEVVFRSFELDP
FT                   DAKKHYDMSIHEIIAKKYGISVEEAKRVNADIGRQAESVGLTFRFDTMKPTNTFDAHRL
FT                   AKYAEERGKLPEVAERLFQAYFTDSQQISDHNVLIDLAGEAGLDREEARQVLESSRYGD
FT                   EVRKDEAEAARLGVRGVPFFVLNRKYAISGAQPIEVFMQALEKVWEEEKTTSPLQPLAS
FT                   DGGGQCTDGSCQVQ"
FT   gene            218958..219219
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0197"
FT   gene            219502..220827
FT                   /locus_tag="GY4MC1_0198"
FT   CDS_pept        219502..220827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0198"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73049"
FT                   /db_xref="GOA:A0A0F6BHZ8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73049.1"
FT                   /translation="MFEYSIVQLARHYAHKLDRPLRHFLVSIYKPFLYTPCIIHKQLER
FT                   WMKKMKRIPVIIQFHEENGVFALKEVEKQHFRMKIHHQFRYIPSCSAEVTPQALEQILQ
FT                   RHDVKKVYLNRKVSALLNNAVPSANAKNVAVNGTALSGKGVTIAIVDTGIYPHPDLEGR
FT                   IAGFVDFVNGRTEPYDDNGHGTHCAGDAAGNGSVSSGLYRGPAYEANVVGVKVLNKVGA
FT                   GRLDTIIRGIEWCIQYNETSKDEKIDIISLSLGGESQPFPEENDDPLVQAAEKAWDKGI
FT                   VVCAAAGNAGPEYRTISSPGISDKIITVGALDDRDTAETREDDEIANFSSRGPTYYGVS
FT                   KPDIVVPGVNIVSLRAPKSFLDKYQKQNRIGQYYMSMSGTSMATPICAGIVALMLQYKP
FT                   DATPDEIKRALKEGAGLWKDRDPNIYGAGYVDAQRAIGLLAK"
FT   gene            complement(220841..222802)
FT                   /locus_tag="GY4MC1_0199"
FT   CDS_pept        complement(220841..222802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0199"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: gwc:GWCH70_0182 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73050"
FT                   /db_xref="GOA:A0A0F6BHZ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ9"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADP73050.1"
FT                   /translation="MKRIGGKLLEKYRSLPDQYISFFIFAIFLFWMKTYAAYQAEFHLG
FT                   ISNSMQEFLLFINPVSSAVFFFGLALLAKGKRTYTWLIIINFVLSFILYANIVYYRFFS
FT                   DFITLPTLTQTKNFGDLGSSIWELIKWYDIFYFLDTVILIAIVTSKRFSLPAVQVGRYK
FT                   KSIVFAIAALIFSVNLALAEMDRPQLLTRTFDRNYIVKYLGVYNYLIYDAVQSMKSSTQ
FT                   RAFANKSDITTVLNHVQATYAKPNPQYFGVAKGMNVIYIHLESFQNFLINYKLHGQEVT
FT                   PFLNSLVRDPNTFYFDNFFHQTGQGKTSDAEFMLENSLFGLPQGAVFTTKGQNTYHAAP
FT                   ALLHQHGYTTAVFHGNYKTFWNRDEIYKSFGFDHFFDASYYDMSDENVLNYGLKDKPFF
FT                   RESIPLLESLREPFYVKFITLSNHFPYPISEEDATIEPANTGDGSVDRYFQTARYLDES
FT                   LKEFFDYLKKSGLYDRSVIILYGDHYGISENHNKAMSQVLGKEITPFEHAQLQRVPLFI
FT                   RVPGVKGGIMHQYGGQIDLLPTVLHLLGIDTKNYVHFGTDLLSPEHQEIVPFRNGDFVT
FT                   PTVTAVNGKYYDSKTGEPIPETPEVKQLEQIVRTKLDLSDKVVYGDLLRFYTPKGFKPV
FT                   DPTKYDYNNRDEEKKGSK"
FT   gene            223266..224606
FT                   /locus_tag="GY4MC1_0200"
FT   CDS_pept        223266..224606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0200"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   KEGG: gwc:GWCH70_0431 potassium uptake protein, TrkH
FT                   family; PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73051"
FT                   /db_xref="GOA:A0A0F6BI00"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI00"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADP73051.1"
FT                   /translation="MKKARKYYLDPPKVLVAGFAVIILVGTALLMLPIATNDGKGLPFL
FT                   DALFTATSATCVTGLVVVDTGTAFTLFGQLVILALIQVGGLGFMTFATLFAFLLGKRIS
FT                   LKERLLLQEAMNNLTIEGIVRLVKRVLIFTVVIELIGGLLLAVRFSFDMPLLKAFYFGM
FT                   FHAVSNFNNAGFDLMGNFRSLTGYVEDPVVTLVICALITLGGIGFIVMNEVYEYRQTRR
FT                   FSLHTKVAVATSGILLASSILLIFLLEFHNPNTLEPLSPLGKFLATLYQAVTPRTAGSN
FT                   TLNISDLTQPTLFLIIFLMFVGASPGSTGGGIKTTTFAILLGAVWSQIRGKEDVVFFKK
FT                   RIMYDTIYKSLTVTISGLFIVIFVTMLLTITEQGKDFLMILFEATSAFSTVGLSMGLTP
FT                   ELSPFGKVIIMCTMFAGRVGPLTIAYAVTLHRKPDPFRYPKGKIMIG"
FT   gene            225037..226872
FT                   /locus_tag="GY4MC1_0201"
FT   CDS_pept        225037..226872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73052"
FT                   /db_xref="GOA:A0A0F6BI01"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI01"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1068"
FT                   /protein_id="ADP73052.1"
FT                   /translation="MASLKRLLIGSPMETKRLQHEKLPKWKALAVFSSDALSSVAYATE
FT                   EILLVLMLLGTSVFFYSLPIAVAILVLLLLVTLSYRQIIYAFPSGGGAYVVARDHLNTT
FT                   TSLVAGAALMIDYVLTVAVSISSGVAALTSAFPGLLPWKVEIAVALVLLLMILNLRGIT
FT                   ESATVFAYPTYLFIISVLVLIVAGGWQLWHEGWHGFNYKEHASAAHFFASGYSMFILLR
FT                   AFASGCSAMTGIEAISNGVPAFKPDSSKNAAITMGWMSLLLGTMFLGITVLAAGFGVTP
FT                   VEHKTVISQIGHHVFGNSIFFYLFQMITMFILVLAANTSFAGFPQLASIIANDRFLPRS
FT                   LSARGDRLVFSNGIILLSILAIVLIVAFHGETHSLIPLYAVGVFLSFTIGQSGLLKKIW
FT                   KEKEKRNITTLVIVMTGMTVTGLVTVITVVAKFTQGAWLVIVAIPSLVWLFYRIHDHYV
FT                   KLGEQLKLDEQEWTRREKMLKPKVIIPISGVSKVVAQSVQYARSISNDITAVSVIFYEE
FT                   EEQKLRAKWEKFYPDIPLRVIYSPYRTILSPILDYINEVEKQANSSPITILMPQFVVKK
FT                   WWHALLHNQTAVVLRFFLIMKKDIVIATLPYHLKE"
FT   gene            226982..227641
FT                   /locus_tag="GY4MC1_0202"
FT   CDS_pept        226982..227641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0202"
FT                   /product="sporulation protein YtaF"
FT                   /note="KEGG: gwc:GWCH70_0184 sporulation protein YtaF;
FT                   TIGRFAM: sporulation protein YtaF; PFAM: protein of unknown
FT                   function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73053"
FT                   /db_xref="GOA:A0A0F6BI02"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI02"
FT                   /inference="protein motif:TFAM:TIGR02840"
FT                   /protein_id="ADP73053.1"
FT                   /translation="MWKYISMIMLAFVVSMDSLSVGVTYGIRKIQFPLRSKLVIACMSG
FT                   AMLLLSMCVGSVFLLFLPGQAERWLASAILIALGIWAIYNVVKKETDKEEKMEPLAPPP
FT                   RIKAWRFQLKRFGIVVQVLKCPAMGDLDSSGSISMKEAMLIGFALSMDAFGAGISASFL
FT                   KYPPLLLALLVCTLNIIFIGLGLKAGNLLSKIKAVRKVTVIPGTILICLGIMKIFF"
FT   gene            227751..228710
FT                   /locus_tag="GY4MC1_0203"
FT   CDS_pept        227751..228710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0203"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: gwc:GWCH70_0185
FT                   SpoOM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73054"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI03"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ADP73054.1"
FT                   /translation="MWKKLLSKLGVGAAKVDLVLHHPRVRVGEQLKGEFLIEGGTVEQH
FT                   IRKLEVELQLMVQADGKAYRRTVAVIPVSSSFTIQPGERKALPFSYVLPLHLPITRPRV
FT                   RYAFVTRLDIADGVDAFDQDAIDILPPLPLEKLFHALGNIGFREKPSSGKITAYGQEFA
FT                   FFPTKEWMGVVEEVEFSAQIEENGIRLYLEVDVRSGFGGFHETELKREIFFSNEEIENV
FT                   EEMSGKLRAVIGEMIQQPRSYVGPSHVPYSSYPSQHVSHHHGGHGMMGAIGGFAAGMLA
FT                   GMVAEELLEDVVEDALDDGIEDVMDDIGDWFDGGDDIL"
FT   gene            229318..230637
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0204"
FT   gene            230790..232019
FT                   /locus_tag="GY4MC1_0205"
FT   CDS_pept        230790..232019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0205"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: gwc:GWCH70_3176 amidase, hydantoinase/carbamoylase
FT                   family; PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73055"
FT                   /db_xref="GOA:A0A0F6BI04"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI04"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADP73055.1"
FT                   /translation="MINGDRLWNRLLELGTIGKQPSGGITRLSFTKEERAAKEKVVSYM
FT                   KEAGLAVYEDAVGNLIGRKEGKEKDAPAVLVGSHIDSVYNGGMFDGPLGVLAAVEVLQT
FT                   MNERGVKTKHPIEVVAFTDEEGARFSYGMIGSRGMAGTLSEEELVHQDKHGISLAAAME
FT                   EAGLDPGKIGKAARRKGSVKAYVELHIEQGRVLEQANLPVGIVTGIAGLIWAKLTITGK
FT                   AEHAGATPMPIRRDPLVAAAQIIQVIEQEAKKTGTTVGTVGQMQVFPGGINIIPERVEF
FT                   SLDLRDLDAAVRDSVFLSIIERAKQIGNERNVDVAVELLQKMPPVLCSELVQNAAKEAC
FT                   RQLGFDVFTLPSGASHDGVQLAGLCPIGMIFVRSKDGVSHSPEEWSSKEDCAAGANVLY
FT                   HTVLSLAMTA"
FT   gene            232044..233228
FT                   /locus_tag="GY4MC1_0206"
FT   CDS_pept        232044..233228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0206"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: gwc:GWCH70_3175
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73056"
FT                   /db_xref="GOA:A0A0F6BI05"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI05"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADP73056.1"
FT                   /translation="MTNEEIKRLVDEVKEEVIAWRRHLHANPELSFQEEKTAQFVYETL
FT                   QSFGNLEISRPTKTSVMARLIGPQPGRVVAIRADMDALPIQEENTFAFASKNPGVMHAC
FT                   GHDGHTAMLLGTAKILSQLRDQIKGEIRFLFQHAEELHPGGAEEMVQAGVMDGVDVVIG
FT                   THLWSPLERGKIGIVYGPMMAAPDRFFIRIHGKGGHAALPHQTIDAIAVGAQVVTNLQY
FT                   IVSRNVDPLEPLVVSVTQFVAGTTHNVIPGSVEIQGTVRSFDETLRKSVPKLMERIIKG
FT                   ITEAHGATYEFEFEYGYRPVINNNEVTRVIEETVREVFGEEAVDHIKPNMGGEDFSAFQ
FT                   QKAPGSFFYVGAGNKEKGIVYPHHHPRFTIDEDALEIGVRLFVHAAFKLLAEVS"
FT   gene            233278..233478
FT                   /locus_tag="GY4MC1_0207"
FT   CDS_pept        233278..233478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0207"
FT                   /product="Protein of unknown function DUF3311"
FT                   /note="PFAM: Protein of unknown function DUF3311; KEGG:
FT                   gwc:GWCH70_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73057"
FT                   /db_xref="GOA:A0A0F6BI06"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI06"
FT                   /inference="protein motif:PFAM:PF11755"
FT                   /protein_id="ADP73057.1"
FT                   /translation="MKGIRWLMVLPFLGILGGIPFANKVTPYVLGMPFILFWLVAWVIM
FT                   TSIIMAVVYRFDPDVREEERT"
FT   sig_peptide     233278..233346
FT                   /locus_tag="GY4MC1_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.507 at
FT                   residue 23"
FT   gene            233475..234797
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0208"
FT   gene            complement(235071..236078)
FT                   /locus_tag="GY4MC1_0209"
FT   CDS_pept        complement(235071..236078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0209"
FT                   /product="NLP/P60 protein"
FT                   /note="KEGG: gwc:GWCH70_3172 NLP/P60 protein; manually
FT                   curated; PFAM: NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73058"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI07"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADP73058.1"
FT                   /translation="MKKWKWYLTAFLCFCMVFGFLSPANAKTDNDEAAYVDVSVATLWT
FT                   EPNIARDIDSPSLSNPVDMWKWTKSMTYEEKLWLVGNLETQALYGMKVTILEKRGDWAK
FT                   VVVHGQPTPRHPLGYPGWMPIRQLTKGKVFAPFQAKPFAQVTSPTAWLYKDPKGNHKFM
FT                   EISFNTRLPVVHSTKNAVKVRTPSDGAKWLKKEDVQIFRTEADIPSPTGEDLVNTAKQF
FT                   LGLPYLWAGTSGFGFDCSGFTHTIYKAHGITIPRDSSVQAQFGIPVPESELQPGDLLFF
FT                   AYNNGKGRIHHVGMYIGNGKMIHSPNSSTTVRIDDYRAPGYGEEFAGARRYIQK"
FT   sig_peptide     complement(235998..236078)
FT                   /locus_tag="GY4MC1_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(236100..237176)
FT                   /locus_tag="GY4MC1_0210"
FT   CDS_pept        complement(236100..237176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0210"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: gwc:GWCH70_3171 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73059"
FT                   /db_xref="GOA:A0A0F6BI08"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI08"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ADP73059.1"
FT                   /translation="MKIKDATIAVQSTPLIKPFKTALRTATQIESIVVKITLDNGMEGY
FT                   GAAVPTEAITGETKQGIIGVLENVLIPKIIGREIEEINKNDKDIQTSCIGNTSAKAALE
FT                   MAMYDALCKLLNIPLYQLFGGKMNHHVNDMTISVNNVEEMVNDAKKVTEKGFSILKIKV
FT                   GKEAEKDIERIERIYDEVGPNISLRIDANQGWTAKDAVKIIQSLEQLHLPIEFIEQPVS
FT                   KHDIKGLQFIRERVNVPIMADESVFSARDALELIRHHAVDLINIKLMKTGGLREAYKIA
FT                   SLAEAAGIECMIGSMMEPTLSVLAAAHLAMAHPNITKVDLDAPLWINDDSSRSFFQESK
FT                   INVPDLPGIGYVPSMPNH"
FT   gene            complement(237195..238358)
FT                   /locus_tag="GY4MC1_0211"
FT   CDS_pept        complement(237195..238358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0211"
FT                   /product="protein of unknown function DUF819"
FT                   /note="PFAM: protein of unknown function DUF819; KEGG:
FT                   gwc:GWCH70_3170 protein of unknown function DUF819"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73060"
FT                   /db_xref="GOA:A0A0F6BI09"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI09"
FT                   /inference="protein motif:PFAM:PF05684"
FT                   /protein_id="ADP73060.1"
FT                   /translation="MIQDGVVYLSILLAYVALIAFAEQKSKSKLFKVVPGIIFIYVGGA
FT                   LMQTFGVFGKTNSIDNTYNTVRNVLLPAMLILMLLHCDLRKIIKMGPKILLTFFAASFT
FT                   IIIGFTVTYLLLKEFYAKDTWKAFAALSSSWTGGSANMVILQKILDVPENIFGYALIMD
FT                   TVNYSIWVMFMFWLVPFADRFNRWTKAKAIEVPVAADEVATTTENHQGKMGFTELIVLL
FT                   GFSILLSTICTEIGNALPELGAVFNGTTWTIVFASVIGLLLAMTKAAKIPGANDVSKVM
FT                   LYVIIALIASKADFSQLFQAPIYIISGFLILLIHALLMLIIAKVCKLDLFTMGVTSLAN
FT                   IGGVASTPILAGAYHQSLIPVGILTALLGNLLGTYYGLLTARILSSL"
FT   gene            complement(238438..238785)
FT                   /locus_tag="GY4MC1_0212"
FT   CDS_pept        complement(238438..238785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73061"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI10"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3169"
FT                   /protein_id="ADP73061.1"
FT                   /translation="MFENNTVYIIGDAKAPSNNPITQQYKAFFIGLVVNKENSMIVDAD
FT                   CSATIELTKSFVKSLLVGRSILDIDTVTKEIQTRYFGSSQKAFIVAFKNASLKYQNIVS
FT                   SAASSVLSSRR"
FT   gene            239106..240092
FT                   /locus_tag="GY4MC1_0213"
FT   CDS_pept        239106..240092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0213"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: gtn:GTNG_3175 transcriptional repressor of the
FT                   ribose operon; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73062"
FT                   /db_xref="GOA:A0A0F6BI11"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI11"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73062.1"
FT                   /translation="MMATIRDVAKLAGVSVATVSRVLNQNGYVNEETEKRVRQAMKELN
FT                   YKPSEVARALFKKTSKTIGLIVPDITNPFFPELVRAVEDVMNIYDYTVILCNSDEKTEK
FT                   EKKYIEVLKQKYVDGIILTTNQLELEEVSEWNVPMVVLDRPLSHNYPSVIADNYGGARL
FT                   ATKHLYDIGCRKIAHIQGPSHVVNAMERFHGYRDEMMELGLWDERLVILGNYQLKKAKE
FT                   AVIEALNKYDIDGIFAGNDAMAVGALKAVQQMGFRVPEDIAIIGYDGIPLTEMTTPELS
FT                   TISQPIYDMGAIAARILIKQIEGKPLEKLHYVLPVELVVRQSTRRGE"
FT   gene            240095..240991
FT                   /locus_tag="GY4MC1_0214"
FT   CDS_pept        240095..240991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0214"
FT                   /product="ribokinase"
FT                   /note="KEGG: gwc:GWCH70_3167 ribokinase; TIGRFAM:
FT                   ribokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73063"
FT                   /db_xref="GOA:A0A0F6BI12"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI12"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ADP73063.1"
FT                   /translation="MTKPVITVVGSINMDLVTIASRFPSQGETILGEEFHLIPGGKGAN
FT                   QAVAAARLGAEVHMIGAVGTDPFGNELLRSLEREGVHIDNVKPVTHKGTGIASITILEQ
FT                   DNRIIVVPGANHALRPEDIDRYEEIIAKSDVCVLQLEIPLSVVERAVFLAKKHHVRVIL
FT                   NPAPAQPLPQKLIEQADFLTPNEHEREIIFEQVDVDVFADKVIVTEGARGVTIRKDGKQ
FT                   VLIPSFCVPVVDTTGAGDTFNGALAVALSKGMSLEDACRFANAAAALSVTKLGAQGGMP
FT                   TEEEVKKFLQEKAGCSS"
FT   gene            240988..241386
FT                   /locus_tag="GY4MC1_0215"
FT   CDS_pept        240988..241386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0215"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: RbsD or FucU
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73064"
FT                   /db_xref="GOA:A0A0F6BI13"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI13"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ADP73064.1"
FT                   /translation="MKKRGILNKDLSMLLASLGHTDTIVIADCGLPIPNGTDRIDLSLV
FT                   KGFPPFLSVLDAVLEELEVEALTLAEEIKKENPIMYENIQQRLSDVPMQFVPHEQLKEM
FT                   TKSAKAVIRTGEATPYANIILRSGVNFS"
FT   gene            241414..242910
FT                   /locus_tag="GY4MC1_0216"
FT   CDS_pept        241414..242910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: afl:Aflv_2670 ABC-type ribose transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73065"
FT                   /db_xref="GOA:A0A0F6BI14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI14"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73065.1"
FT                   /translation="MTKPFVEMRGIKKAFHQHVVLNDVDFEVRAGEVHALMGENGAGKS
FT                   TLMKVLTGIYERDAGTVLVDGREVHYRHPKEAERDGISVIHQELTIIPTLTVAENIFLG
FT                   RESTIGRTGIIRGKDMEKQAKVYLEKLGIHIDPNELAGNLSVGKQQIVEIARALSTNAK
FT                   CLIMDEPTAALTEREIQTLFEVIRTLKQQGVAIVYISHRMEEIFTICDRISVLRDGQFI
FT                   GTKRIAETNFDEIVHMMVGRQIGERFPKRNTIIGEERMRVEGLTQEGVFENVSFSVRAG
FT                   EILGVAGLMGSGRTEIMEAIFGARKMNAGTIYIDGQPVHITSPRRAIEHGIAMITEDRK
FT                   QKGLILDMSVRENLTLPKSEQLAAAGVIQATKEQELVSSLIKKLNIKTASPELEVKALS
FT                   GGNQQKVVFGKWLAMEPRILILDEPTRGVDVGAKKEIYEIMNELTAQGVAIIMVSSELP
FT                   EVLGMSDRIMVVHEGKVRAILENEGIDQETIMRAATGGKA"
FT   gene            242910..243851
FT                   /locus_tag="GY4MC1_0217"
FT   CDS_pept        242910..243851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0217"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73066"
FT                   /db_xref="GOA:A0A0F6BI15"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI15"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP73066.1"
FT                   /translation="MENKWNFDVKKLGPLIGFFLLCIVLSILSDSFLTVNNWMNVLRQV
FT                   SINALIAFGMTFVILTGGIDLSVGSVLALSSAITAGIMASGTNGFTAIIIGLLAGFLMG
FT                   ALNGVVITKGRIAPFIATLATMTMFRGLTLVYTDGRPITGFASDDILFQMMGRGYFLGI
FT                   PVPVVFMIVVYVALYFVLKKTTFGRHTYAIGGNEEASRLSGIRVDRLKIWIYSLTGGLS
FT                   ALAGIILTSRLNSAQPTAGTAYELDAIAAVVLGGTSLSGGRGWIFGTLVGALIIGVLNN
FT                   GLNLLNVSSFYQQVIKGLVILLAVLLDRRKEA"
FT   gene            243884..244822
FT                   /locus_tag="GY4MC1_0218"
FT   CDS_pept        243884..244822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0218"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73067"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI16"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73067.1"
FT                   /translation="MKKLASMWLSFLLVIGVLAGCSLDNGATSGKKEEAKKDGSMKIGL
FT                   SISTLNNPFFVTLKEGAEKAAKEEGVELIVVDAQNDSAKQINDIEDLIQQDVDLILVNP
FT                   TDSSAVTSAIESANSANIPVITVDRSADGGNVATHIASDNIAGGKMAGEFLLEQLKNGG
FT                   NIVELEGIPGSSAARERGEGFHQVIDKASNVKVVAKQAADFDRAKGLSVMENILQSHKD
FT                   IQAVFAHNDEMALGALEALEARGMKDVLVVGFDATEDAVKAVKEGKMAATVAQKPELIG
FT                   ENAIKTALKVLNGEKVDKFIPIPLELVTENQ"
FT   sig_peptide     243884..243964
FT                   /locus_tag="GY4MC1_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.704 at
FT                   residue 27"
FT   gene            244920..245375
FT                   /locus_tag="GY4MC1_0219"
FT   CDS_pept        244920..245375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0219"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: gwc:GWCH70_3166
FT                   VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73068"
FT                   /db_xref="GOA:A0A0F6BI17"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="InterPro:IPR018103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI17"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADP73068.1"
FT                   /translation="MKGKIQRWSFVVLWCIVIYCFSEFPLFTGENTKRILEAVLGYLPF
FT                   GHGGDGASSPLNFIVRKLAHLTEFGILAVLVWRALEPMRLAYAGAWLFATMYAVTDEWH
FT                   QSFEPGRTATPKDVAIDSCGALLALIGVFLYMRWKKNAHDPAKRDVS"
FT   gene            245719..247269
FT                   /locus_tag="GY4MC1_0220"
FT   CDS_pept        245719..247269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0220"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73069"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP73069.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
FT   gene            complement(247400..248383)
FT                   /locus_tag="GY4MC1_0221"
FT   CDS_pept        complement(247400..248383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0221"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   gwc:GWCH70_3164 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73070"
FT                   /db_xref="GOA:A0A0F6BI19"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI19"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADP73070.1"
FT                   /translation="MIRFATIGTNWITEAFIEAAKKTEDFALAAVYSRTDEKAKQFAAK
FT                   TGAERTFTNLEELAKSKDIDAVYIASPNSLHAEQAILLMDHGKHVLCEKSMASNTKEVK
FT                   AMIDAARRNGVVLMEAMKTTLLPNFQAVREHLHKIGKIRRYFASYCQYSSRYDAFKQGT
FT                   VLNAFNPAFSNGALMDIGVYCIYPMVVLFGKPNRLQASSLKLESGVDGEGTIIFTYEDM
FT                   DAVVMYSKITNSYLPAEIQGEDGSILIDAIHTPTKVEIRYRNGRTEDITVPQEQPPMYY
FT                   EVKEFIELIKNGKRESEVNSHEHSLLTIALMEEARKQTGIVFPADQ"
FT   gene            248831..250018
FT                   /locus_tag="GY4MC1_0222"
FT   CDS_pept        248831..250018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0222"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain-containing protein of
FT                   components of various dehydrogenase complexes;
FT                   biotin/lipoyl attachment domain-containing protein; E3
FT                   binding domain protein; KEGG: gwc:GWCH70_3162 catalytic
FT                   domain of components of various dehydrogenase complexes"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73071"
FT                   /db_xref="GOA:A0A0F6BI20"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI20"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ADP73071.1"
FT                   /translation="MRYEFKLPDIGEGLHEAEIVRWFIQEGDEVAADQPIAEIQTDKAM
FT                   VEMTTPVAGKVVALAGPEGMTVKVGEPLIILEQQKAAIAESRPAQQKKRVIAAPSVRKR
FT                   AREMGIPIEEVEGTGEGGRVTLADLERYAKARESALEPVAPALEAAGRKMDRRHGITEH
FT                   EERIPIRGLRKKIAEKMVKSAYTAPHVTGMDEIDVTKLVEIRASLAKQLEAEAIKLTYL
FT                   PFVIKAVTRALKEYPLLNAAIDEETNEIVLKKQYHIGIATATKEGLVVPVIKHADQKSI
FT                   HDLAVEIAELSEKARRHALRIDELQGSTFTITNTGANGGWFATPIINYPEVAILGIHAI
FT                   KRKPVVIGEEIVIRDMMGMSLTFDHRVIDGEPAGRFMRAVSHILEHPEQLLLDVR"
FT   gene            250035..251117
FT                   /locus_tag="GY4MC1_0223"
FT   CDS_pept        250035..251117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0223"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; KEGG:
FT                   gwc:GWCH70_3161 pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73072"
FT                   /db_xref="GOA:A0A0F6BI21"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI21"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ADP73072.1"
FT                   /translation="MFDQDQLQFEMVQLLDENGNGDEKTLASFSDEFLVALYRWMRKAR
FT                   VIDERLLKMQRQGRIGTYAPFGGQEAAQIGSVFALESNDWIFPTYREIAACLAHGLPLA
FT                   QIFRYLRGHLSGGRTPEHLNIFPIQIIIGAQTLHATGCAWATKLKGETQVSVCYFGDGA
FT                   TSQGDFHEALNFASVYQVPVIFFCQNNQYAISVPVHKQTASRTIAQKAVAYGMKGVLVD
FT                   GNDALAVYKTVKEAADAARNGGGPVLIEAFTYRLGPHTTSDDPAKYRNAEEAEKWRRKK
FT                   DPLHRLRVLLEKRGIWTEGEEEEWVAQVNGEVTAAYEEAAADGSGSIVDALSCVYGKPS
FT                   KLLQEQKQEAARRKQGKEGK"
FT   gene            251134..252096
FT                   /locus_tag="GY4MC1_0224"
FT   CDS_pept        251134..252096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0224"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: gwc:GWCH70_3160 transketolase central region;
FT                   PFAM: Transketolase central region; Transketolase
FT                   domain-containing protein; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73073"
FT                   /db_xref="GOA:A0A0F6BI22"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI22"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADP73073.1"
FT                   /translation="MIQAINEAIRQEMERDERVIVLGEDVGKNGGVFRATDGLFEQFGD
FT                   RRVFDTPLAESGIIGTSIGLAVNGFRPVAEIQFLGFAYQAMDQLAAQAARLRFRSAGRF
FT                   TCPLVVRSPYGGGVRTPELHSDALEALFTHSPGLKVVMPSNAFDAKGLLISAIRDEDPV
FT                   LFLEPMKLYRALRMEVPDEPYEIPLGTARVVKEGEDVTIISWGATVPLVAKLAEEMKEK
FT                   GIDAEVIDLRSLQPLDIDAIVQSVEKTGRVMVVHEAVKTNGFGAEIAALISERALFSLS
FT                   APIVRVTGYDTPYPVPSVEDEWLPNAARIVEGVQMLMRY"
FT   gene            252114..253478
FT                   /locus_tag="GY4MC1_0225"
FT   CDS_pept        252114..253478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0225"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   gwc:GWCH70_3159 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73074"
FT                   /db_xref="GOA:A0A0F6BI23"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI23"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADP73074.1"
FT                   /translation="MGVYEDLLEQIGDRERVTVNETVLEQHSKGIAYHAPRKPDVVVFP
FT                   KTAAEVSAVLAYANERRIPVTPFGAGSSLEGHIIPVQGGITLNLTMMNHIIDIRPDDFL
FT                   AIVEPGVTRMQLNQALKKYGLFFPVDPGADATLGGMAATNASGTNSVKYGVMRDQVLGL
FT                   EVVLADGKIVHTGGMAAKSSAGYDLTGLFVGSEGTLGVFTKMIVRLQGIPEATNAIKAS
FT                   FPTLTAAAQAAALLLKAGVSPGKIELVDEQTIQAVNQYKQTNYPEAPTLFIELSGSAAS
FT                   VKDGTEVVKEWCAAENAVSFETEDDPAGRAKLWEARHHAAFAIQAAHPGKTMLSTDVCV
FT                   PVSKLPEAIAETRKLVDEYGITAAIFGHVGDGNYHTVLTFDPADAEEVKRVEEINARIV
FT                   RYALSHGGTCTGEHGIGIGKRHFLYEEHRDSVPLMQGIKRLFDPNGIMNPGKIFL"
FT   gene            253670..255106
FT                   /locus_tag="GY4MC1_0226"
FT   CDS_pept        253670..255106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0226"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="KEGG: gtn:GTNG_3135 beta-glucosidase-like protein;
FT                   PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73075"
FT                   /db_xref="GOA:A0A0F6BI24"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI24"
FT                   /inference="protein motif:PRIAM:3.2.1.86"
FT                   /protein_id="ADP73075.1"
FT                   /translation="MEHKQLRPFPDRFLWGSASAAYQVEGAWNEDGKGLSVWDVFAKQP
FT                   GRTFKGTNGDVAVDHYHRYKEDVALMAEMGLKAYRFSVAWSRVFPNEKGEINEKGLQFY
FT                   DNLINELLKHNIEPIITLYHWDVPQALMDEYGAWESRQIIDDFHDYAVTLFQRFGDRVK
FT                   YWVTLNEQNLFITFGYRLGLHPPGVKDAKRMYEANHIANLANAKVIQAFRHYVPDGKIG
FT                   PSFAYSPMYPYDCRPENVLAWENAEEFQNHWWMDVYVWGTYPQAAWNYLEQQGWAPTIK
FT                   SGDMELLKAGKPDFMGVNYYRSQTVQYNPLDGVGEGVMNTTGKKGTSTESGIPGLFKIV
FT                   RNPHLEATNWDWEIDPVGLRIGLRRIANRYGLPVFITENGLGEFDKLEDGDIVNDDYRI
FT                   DYLRRHIQEIQRAITDGVDVIGYCTWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRR
FT                   IKKKSFYWYKQVIASNGKEL"
FT   gene            complement(255131..255865)
FT                   /locus_tag="GY4MC1_0227"
FT   CDS_pept        complement(255131..255865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0227"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: gyc:GYMC61_3311 transcriptional regulator,
FT                   RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73076"
FT                   /db_xref="GOA:A0A0F6BI25"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI25"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ADP73076.1"
FT                   /translation="MFTPEQIARFSELDYIIYNYVTKHANEVVYMRIRELAEEVHVSPP
FT                   TILRFCRKVGCDGFSEFKTKLKLYLQQNERSFITNAQDTLTEFFERTLKIDYQQTIREA
FT                   AAAIARADNVIFVGSGSSGILAEYGSRYFSALKKFSVYIKDPFFPIYGHYFNNCVVIAL
FT                   SVSGETSYTLSQVHRFKEKGSTIISITNRKHCSLANMSDYNLTYYVNTEFVEQTNITTQ
FT                   IPVIYLLESLAKEMYRMLNKPT"
FT   gene            256107..257123
FT                   /locus_tag="GY4MC1_0228"
FT   CDS_pept        256107..257123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0228"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: gwc:GWCH70_3158
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73077"
FT                   /db_xref="GOA:A0A0F6BI26"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI26"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73077.1"
FT                   /translation="MSRTWWKWVIYAGSIAALIVSASFTIYCAWKVYAYHQPGEGAAAE
FT                   AEKNAFHFVLVPEELDNDYWRLVEQGAKAAAKETGVYLEYAGPRQANIDEHIHILEKAA
FT                   ASKVDGIMTQGLTEKEFTPVINHIVEKNIPVVTIDTDAPTSKRTAYIGTDNYYAGFIAG
FT                   RALEEDMHGKANVAIITGSFTASNQQLRVQGFKDAVKEEKGIHIVAVEESHITRVQAAE
FT                   KAYNILKKHPEVNAFYGTSALDAIGIAKVVEQFHREKGTYIIGFDTLPETIRYLQKGTI
FT                   HATVVQEPYEMGYRAVKMMVDIRKGNNVPSVINTETKVIRKQDLPLRPSRNYEVNHD"
FT   gene            257116..258573
FT                   /locus_tag="GY4MC1_0229"
FT   CDS_pept        257116..258573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0229"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: integral membrane sensor signal transduction
FT                   histidine kinase; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73078"
FT                   /db_xref="GOA:A0A0F6BI27"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI27"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADP73078.1"
FT                   /translation="MIKIRTKALFYFGIFIVLLNGTVFFFYQSSEDIVTDYDYSMRRLL
FT                   LFNEISQRTNRMVEQLNAYLTEKDGRYFREYERQYRWLQQHRRQVGETLSNRNNRLLVK
FT                   NYEHMIESLLEEGALTVYHFQAGNISLYSSHLHEAMKIASFIQETTLSLIDEELTTYQH
FT                   FYNEVEARNRYFRYMGIGLSMTTFLLGVLLAVWFSGGLTRPIARLSRAAREIASGKLDG
FT                   PDVISTTNDELKLLTDTFNDMRRNLKRLIEEMKQKSELDRLVKELELKSLQSQMNPHFL
FT                   FNTLNAVAKMAYLEEANQTSRLIEAIAAILRYNLGDLQRTVTLADEVRIAHEYFFIQQT
FT                   RFFDRIKFSMDVEESCLSLPIPPLTLQPLIENAFIHGIESYEKGAVLSLTVEKRKNLVV
FT                   IEIRDNGVGMSEEVKEKLTAFIKGEEAGSISHGQTRGHSTGIGMYNVIRRLQLFYGMQD
FT                   VIEIESAAGKGTTIRLLLPITKGGRGE"
FT   gene            258570..260120
FT                   /locus_tag="GY4MC1_0230"
FT   CDS_pept        258570..260120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0230"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: gwc:GWCH70_3156 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73079"
FT                   /db_xref="GOA:A0A0F6BI28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI28"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP73079.1"
FT                   /translation="MKIAIVDDEALERKALQKMIRGHLPTMEVIAEAANGREAVEVADQ
FT                   YKPDVMLMDIKMPGIDGLEAIELIRRKHPEIKFIIVSAFDTFDYAKQAMRHGVKEYLLK
FT                   PSRKEEVVGALQRVYDELMEERRKEEENRELQQRVRQLQKLVEKEWLSVLMLEEVSSQE
FT                   WKQWETLLPFSIDTGMFMVIQFPSGEKREDWKNWIEQVLSEKETTHYIIGKMVDGQMPV
FT                   LFFHDVAVKAFSWKPVIQSLSLELIQQFERQYGTALYIGLGSPASRLEELRHSYYEALA
FT                   AAQYYASQKKAKSGFLPKKSVLAAASGHIEKEKRLLDAVRQGDLEQALLQCYTYIEEEA
FT                   AHHPLSVVQQKLEETFVLLGRMFADFGIAYERTATFHSCRSFEELKKTAAEQLRHMTCH
FT                   ILAWRHQQANGKLGKAKDYIDEHYHHPLTLEEVAEYVDISPCYFSKLFKDRFGMTFIDY
FT                   VTDVRIARAKKEMADPNKSLKEICFLVGYNDPNYFSRVFKKHTGMSPSEYRKKLHAAT"
FT   gene            260265..261557
FT                   /locus_tag="GY4MC1_0231"
FT   CDS_pept        260265..261557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0231"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gwc:GWCH70_3155 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73080"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI29"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADP73080.1"
FT                   /translation="MKKKRLWLSLALVAGLALSGCNSDSASNSKEDQGGSKGHEKLEIF
FT                   SWWTGAGEEDGLKALLKLFQEKYPDIPVENAAVAGGAGTNAKAVLASRMQGNDPPATFQ
FT                   VHGGAELNEGWVAAGKMEPLNDLYEKEGWMDKFPKSLIDMVSKDGKIYSVPVNIHRGNV
FT                   LWYNKKIFAENGLEPPKTFDEFFQVADKLKAKGITPLALGDKEPWTATHIFETVLLGTL
FT                   GTEDYKKLWTGELPFDDPKVKEAVNTFKKMLDYVNEDHSSRNWQDAAQLVGKGEAAMNI
FT                   MGDWVKGYFVNDLKLKVNEDFGYVPTPNTEGKFMVITDTFGLPKGVKNPDDVKKFLSVL
FT                   GSVEGQDAFNPLKGSIPARIDADTSKYDEYGKQTMEDFKTAELAPSLAHGSAAPEGFVT
FT                   KVNQAVNIFVTQKDAKTFIDTLVSASAELKK"
FT   sig_peptide     260265..260345
FT                   /locus_tag="GY4MC1_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.536 at
FT                   residue 27"
FT   gene            261622..262593
FT                   /locus_tag="GY4MC1_0232"
FT   CDS_pept        261622..262593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0232"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_3154
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73081"
FT                   /db_xref="GOA:A0A0F6BI30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI30"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73081.1"
FT                   /translation="METVKTVSERSVTAVPAPRKKRKWTADHWLAIAFLTPSVVLIFIF
FT                   VYGFIGWTGYVSLSNWNSLVPDLSFAGLKNYVYLFHDFRFQADLRNTLVFTILFIGVVI
FT                   VLGQLLAVLLDQKLRGESLFRNIFFFPMALSFVVTGVVWQWLLNPSTGVNLFLKKIGLD
FT                   SKWYTDTTIFGGFHLGKIEFGVPVAIVAVVIAAVWQMTGFAVAMYLAGLRAIPEEVREA
FT                   ARIDGATELQIYRKIIIPLLRPITVSVIIIMAHISLKIFDLIYAMTGPGANFVTDVPGV
FT                   YMFETTFRGNYYANGAAIAVIMLLSVAIFIVPYLISGRKGGA"
FT   gene            262593..263414
FT                   /locus_tag="GY4MC1_0233"
FT   CDS_pept        262593..263414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0233"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_3153
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73082"
FT                   /db_xref="GOA:A0A0F6BI31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI31"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73082.1"
FT                   /translation="MWQRAWSRLFLYAICIFMSLFFLMPVYVMLVTSVKPLDEVTLADM
FT                   WKLPSAFDWSSYQTAFAKLAPNFWNSVYLVVPATLLSAILGALNGYVLSKWKFKGADTI
FT                   FTLILFGMFIPYQSILIPLIQFLREIGLYNTIPGLIFVHVVYGIPITTLMFRNFYAAIP
FT                   DEMIESAKIDGAGFLRIFRYIMLPLSVTGFVVVAIWQFTNIWNEFLFAVTITTSSQQPI
FT                   MVALQNLSGSQIVQWNVQMAGALLAALPTLLVYIFLGKYFVRGLLAGSVKG"
FT   sig_peptide     262593..262685
FT                   /locus_tag="GY4MC1_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.641) with cleavage site probability 0.463 at
FT                   residue 31"
FT   repeat_region   263676..264506
FT                   /rpt_unit_range=263676..263706
FT                   /note="CRISPRS"
FT   gene            complement(264609..264848)
FT                   /locus_tag="GY4MC1_0234"
FT   CDS_pept        complement(264609..264848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73083.1"
FT                   /translation="MPYSHFAEDFVKPSKAKSRETPAMLRLPENKKCKPQPLSGIFRIV
FT                   LNHGRLSYPLLTFVLHLPMEEKILGSTSIKAAKS"
FT   gene            complement(264900..266288)
FT                   /locus_tag="GY4MC1_0235"
FT   CDS_pept        complement(264900..266288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0235"
FT                   /product="Nitrilotriacetate monooxygenase component
FT                   A/pristinamycin IIA synthase subunit A"
FT                   /note="TIGRFAM: Nitrilotriacetate monooxygenase component
FT                   A/pristinamycin IIA synthase subunit A; KEGG: gtn:GTNG_3499
FT                   alkane monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73084"
FT                   /db_xref="GOA:A0A0F6BI33"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI33"
FT                   /inference="protein motif:TFAM:TIGR03860"
FT                   /protein_id="ADP73084.1"
FT                   /translation="MAKQIILNAFEMASAMHNSHGLWKHPESKRQRGYKDIEYWIKMAK
FT                   LLERGKFDAVFFADVLGVYDTYRQSKAPSIRDGLQFPVNDASLVIPVMASVTKHLSFAL
FT                   TVSTTYEHPFNIARRFSTLDHLTKGRIAWNVVTSYLPNAARNFGLPEMIKHDQRYDIAD
FT                   EFLEVTYKLWEGSWEDDAFIEDKQNGILIDPDKVHEIHHAGKFFAVEGPHLCEPSPQRT
FT                   PVIYQAGTSERGREFAAKHAECVFVGGPTPERIKYYTNDIKRRAEKYGRNPDNIKVFAF
FT                   LTVIVGKTTEEAEQKFAELNHLWSPDASKAQFSGASGYDLAEYETKDLNAPFEFKNTEH
FT                   GHYKAASLTKDASKKLSIGEALSKLEQLDRESIIVGNPEEVADAIQHRFEESGVDGFNL
FT                   NHLITPSSLEDFIELVIPILQKRGLYKTEYKPGTLREKLFNYGSSLLPEDHPGSAYRSK
FT                   SFIV"
FT   gene            complement(266336..267166)
FT                   /locus_tag="GY4MC1_0236"
FT   CDS_pept        complement(266336..267166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0236"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bxe:Bxe_B1551 putative
FT                   outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73085"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI34"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADP73085.1"
FT                   /translation="MKAHKILFSFIALAFLVLSGCSSLTQNTNSSATKTIKLGATAGPY
FT                   SDQIKKVIKPYLEKKGYKVELIEFNDYVQPNISLDQGSIDANVFQNEVYMKNFEKTRNM
FT                   ELYEVIKIPTAPIGIYSKKHKSLDEIKDGTTIALPNEPVNQARALTMLEQLGLIQLKKG
FT                   VDPIKVSERDIEKYHKKIVLKPLEPAQLPRSLGDVDYSLINGNFAISSGLKLKDAVALE
FT                   KTPPYYLNGVTVREKDKDAAFVKDIVEAYKSKEFRKLMKEDEEYQGYAWPDWFK"
FT   sig_peptide     complement(267089..267166)
FT                   /locus_tag="GY4MC1_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.653 at
FT                   residue 26"
FT   gene            complement(267211..267876)
FT                   /locus_tag="GY4MC1_0237"
FT   CDS_pept        complement(267211..267876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0237"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gtn:GTNG_1346 ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73086"
FT                   /db_xref="GOA:A0A0F6BI35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI35"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73086.1"
FT                   /translation="MLLDALIRLIPELNKAFLETIYMVAISLFAAVVAGLPLGILLFVT
FT                   DRGLFLENIAVKSVLGFIVNMIRSIPFIILLVGLLPLTKLITGTTIGPTAASVSLSVAA
FT                   VPFFARIVETSLREIEKGVIEAAIAVGATPWMIIKDVLLPETRPGIVHGITITTISLVG
FT                   YSAMAGIVGGGGIGDLAIRFGYYRYDNTIMITTIVILICLVQIIQFIGDRIARLVDKR"
FT   gene            complement(267866..268879)
FT                   /locus_tag="GY4MC1_0238"
FT   CDS_pept        complement(267866..268879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0238"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_1347 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; NIL domain; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73087"
FT                   /db_xref="GOA:A0A0F6BI36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI36"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73087.1"
FT                   /translation="MIEIKNVTKIYSTKKKQVVGVDNISLTIQDGEIFGIIGYSGAGKS
FT                   TLLRCLNLLERPTSGQVIIDGVDLTSLNDKQLRQARLKIGMIFQHFYLVSSKTVFENVA
FT                   FALKAAKKPKEEIEKRVNELLEMVGLSDKRDAYPSQLSGGQKQRVGIARALANDPTVLL
FT                   CDEATSALDPSTTKSILALLKKINRELGITIVLITHEMEVVKEICDRVAVMQNGRIIEL
FT                   GTVYDIFTNPQEELTKSFINSVLRFEIPDHLLQKRTGTMVKIHFKGEIAEEAVISDMLQ
FT                   SFKVKGNILHGKIEYIQEIPLGIFVMELIGEQEEIQRAIDYISQRTNALEVIAYAA"
FT   gene            complement(268957..270282)
FT                   /locus_tag="GY4MC1_0239"
FT   CDS_pept        complement(268957..270282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0239"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
FT                   dehydrogenase domain-containing protein; KEGG:
FT                   gwc:GWCH70_1626 acyl-CoA dehydrogenase type 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73088"
FT                   /db_xref="GOA:A0A0F6BI37"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI37"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADP73088.1"
FT                   /translation="MLRNSQSSGTSFLLPLFNWAHAKECIAGQKYKKGEIMLSIASKKT
FT                   HRSYLSDELSRKFVQNERQEFLLHLASELAEQFHETADIIDQEGRFPFENFQKLKDCNY
FT                   QSLTVPKQYGGEEISLYEFLLMQERLSQGDASTALCIGWHLGVIYDLRERQTWDSEKFK
FT                   WLCHEVVQNKVLINRVATENGTGSPTRGGKPETVAVKRNGKWVITGRKSFASMAIALDY
FT                   SLVTATIQESGKVGSFLVDHRLQGVSVEETWDMIGMRGTRSDDLVLDQVELPEDALVEL
FT                   DQLESPKGNMGRAWLLHVPACFLGIAIAARNYAISFASEYQPNSLPGPIKDVPEVQRKI
FT                   GEIDLELLKARHTLYSVAHRWDTYPEKRMEMSGELAAAKHIAVNSANKVVDLAMRIVGA
FT                   RSLQKSSPLQRYYRDVRAGLHNPPMDDAVISLLAKQALQSFH"
FT   gene            complement(270380..271708)
FT                   /locus_tag="GY4MC1_0240"
FT   CDS_pept        complement(270380..271708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0240"
FT                   /product="Nitrilotriacetate monooxygenase component
FT                   A/pristinamycin IIA synthase subunit A"
FT                   /note="KEGG: bay:RBAM_003900 YxeK; TIGRFAM:
FT                   Nitrilotriacetate monooxygenase component A/pristinamycin
FT                   IIA synthase subunit A; PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73089"
FT                   /db_xref="GOA:A0A0F6BI38"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI38"
FT                   /inference="protein motif:TFAM:TIGR03860"
FT                   /protein_id="ADP73089.1"
FT                   /translation="MKKKQMKLGVFLMGTGHHIASWRHPHVQADGCEDFAFFHKIAKIA
FT                   EKGKLDMLFLSDGLSFNELSHPAELVRFEPITLLAALSVVTSHIGLAATATTTYNEPFH
FT                   IARKFSSLDHLSKGRAAWNVVTSYYEDEAKNFSQDAHLDHHLRYERAKEFVEVVKGLWD
FT                   SWEKDALVRDKQSGVYFDPKKLHPLNHKGKYFSVKGPLNSSRSPQGRPVLIQAGSSEDG
FT                   VNFAAQIADVIFTAQQTLEEAQHFYRKVKKKAAEFGRNPDEVIIMPGVSPYIGNTEQEA
FT                   REKYEQLQELIVPEIGLAFLSDYLGGIDLSRYSLDDPLPDEIPETNGNKSRRKLIIDLA
FT                   RREHLTIGELYKRIAGSRGHRIIFGTPEQIADQLEEWIIHEGADGFNLMFPYYPDGLSE
FT                   FVDQVIPILQERGLFRKEYEGTTLREHLGLPEPESRYSPAPSQ"
FT   gene            complement(271739..272515)
FT                   /locus_tag="GY4MC1_0241"
FT   CDS_pept        complement(271739..272515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0241"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gtn:GTNG_2610 putative
FT                   transport system permease protein of aliphatic sulfonates
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73090"
FT                   /db_xref="GOA:A0A0F6BI39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI39"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73090.1"
FT                   /translation="MKKIRKIYDQIAPWIVPILLLIAWQLFSAIGWISERVLPSPLEVL
FT                   LAAITLTKNGELFTNIGVSFTRAFIGFVIGGGIGLILGLLNGIYPVAEKYLNTTIQMFR
FT                   NIPHLALIPIVILWFGVGEEAKIFLVIIGVFFPIYINTYHGVISVPKDLIEMGKVYGLS
FT                   KWILFSNVIFPSALPSILVGLRYALGVMWLTLIVAETVAASSGIGYMAMNAREFMQLDV
FT                   VVLSILLYALLGKLADSLAKCLERYFLKWNPAYQKK"
FT   gene            complement(272544..273512)
FT                   /locus_tag="GY4MC1_0242"
FT   CDS_pept        complement(272544..273512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0242"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: bcl:ABC3394 nitrate/sulfonate/bicarbonate ABC
FT                   transporter substrate-binding protein; TIGRFAM: aliphatic
FT                   sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73091"
FT                   /db_xref="GOA:A0A0F6BI40"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI40"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ADP73091.1"
FT                   /translation="MRSMKQSKHILWIIHFLVFSLLLSSCGKAEETGGKNKEIHIGYQK
FT                   NGTTLLLKHKQELQKELEKEGYKVTWSEFNTGSSILEALNAGSIDFAGAGDIPSIFALE
FT                   KGSNFNYIASEPSSPSSEGILVRKDSGIQSLEDLKGKRIAFNKASIAQYLLTKALDSAG
FT                   LSMDDVEPVYLNPPEASIAFEQGEVDAWVVWDPYMTVAESKGHIILKDATGIVPYRTFY
FT                   FSTPEIAKEHPEIVKKFVEHLSNIGKQINHDPTEAAALLQKATNIPAETWEKVLNNKKS
FT                   DVHFMDEKAVRDLQTEADDLLKIGLIKKQVQIEDYVWYPEK"
FT   sig_peptide     complement(273423..273512)
FT                   /locus_tag="GY4MC1_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.727 at
FT                   residue 30"
FT   gene            complement(273578..274696)
FT                   /locus_tag="GY4MC1_0243"
FT   CDS_pept        complement(273578..274696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0243"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="KEGG: bcl:ABC3395 alkanesulfonate monooxygenase;
FT                   PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73092"
FT                   /db_xref="GOA:A0A0F6BI41"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI41"
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /protein_id="ADP73092.1"
FT                   /translation="MVEFITMAPTSGDSTLVGLANNSSKLNSWTGTDENAERPPTQEYI
FT                   KAIAQAAEKGGFSTLLLPTGTGCLDSLAVAANLIAYTSKLKFLFAIRPGFIAPTTFAKQ
FT                   FATVDYWSNGRALVNIVTGGSPVELASEGDYLDHDTRYKRTREYMQILKKLFTEESVDY
FT                   EGEFFTLKGASLFPKPVKTPPIYFGGASEIAKEVAAEEADVYMMWGETFENTKQRLEEM
FT                   KQRAAKHNRTLSYSVSFQVILGNTEEEAWEKANKLISKVSASILAKKEEMIVKGDSIGA
FT                   KRLHQLMESSKERNFQIGPNLWAGLTQVLSGNSIALVGTPEQIAERIVELVELGFDKVL
FT                   LRGFPHLETIEQLGELVIPKVREKLAQKQLVK"
FT   gene            complement(274807..275586)
FT                   /locus_tag="GY4MC1_0244"
FT   CDS_pept        complement(274807..275586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_2609 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73093"
FT                   /db_xref="GOA:A0A0F6BI42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI42"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73093.1"
FT                   /translation="MPETSGVALSIHQLEKSFGHLHVLRKIDLQIASGEFVAIVGKSGC
FT                   GKSTLLRLIAGLEKATSGEIRQNGKTIKELNPQARIMFQEARLLPWRSVLENVGVGLRL
FT                   QKDWKQRAIWALKQVGLEERAHDWPSVLSGGQKQRVSLARALAAQPQLLLLDEPLGALD
FT                   ALTRMEMQALIEEIWQQQKFTALLVTHDVNEAITLADRVVLIEKGTIKMDLPIPLPRPR
FT                   NRSDSAFIELEENVLAHVLEKTSLKKETENLKSAANE"
FT   gene            complement(275624..275992)
FT                   /locus_tag="GY4MC1_0245"
FT   CDS_pept        complement(275624..275992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC3397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI43"
FT                   /inference="similar to AA sequence:KEGG:ABC3397"
FT                   /protein_id="ADP73094.1"
FT                   /translation="MRSMIIALVLDHDENIVPIIDGTIVRIYDTESGKYQDYPNPALHL
FT                   KEGRRGAVLRFAQEKGAAVFASPPKTFCELSYAKAQENHIQFCQLDGPITFTTFQELFN
FT                   NGKILIKDHLPAQEIVPS"
FT   gene            complement(276126..277028)
FT                   /locus_tag="GY4MC1_0246"
FT   CDS_pept        complement(276126..277028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0246"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bcl:ABC3400 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73095"
FT                   /db_xref="GOA:A0A0F6BI44"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI44"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP73095.1"
FT                   /translation="MDLRTIKTFKTVVKYGSFQRAAEELNYAQSTVTTHIKNLEDELGV
FT                   TLLKRGKTLQLTEAGRLLSEKGEFLLKGFENLQSSLQELVQGESGIIRIGVMEPTASYR
FT                   LPPLLASFRKKYPKIQLNIQIHSSQSLVEMVMKDEVDLAICPAPETATNTVFDPLFSEE
FT                   VVLLVPVEHHLSQKETIYLENLKNEQLLMTSSSCPFRNNLEKKMIELGINPVYGIEISN
FT                   MLALKHYVQSSLGIAVVPRITVNNPPEGTVIKPIADFRKGLTVGILRNSERFYNNKSIE
FT                   RLMDVLYANLAGSLEKQDL"
FT   gene            complement(277093..277323)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0247"
FT   gene            complement(277404..277940)
FT                   /locus_tag="GY4MC1_0248"
FT   CDS_pept        complement(277404..277940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0248"
FT                   /product="FMN reductase"
FT                   /note="KEGG: gym:GYMC10_0654 FMN reductase; TIGRFAM: FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73096"
FT                   /db_xref="GOA:A0A0F6BI45"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI45"
FT                   /inference="protein motif:TFAM:TIGR03567"
FT                   /protein_id="ADP73096.1"
FT                   /translation="MSNVVIINGNPSLTSRLNGMIQYVEQRLAQAGIEIGHIRVAELPP
FT                   EDLIKAKFDSEAILHANKKVEEADGIIIASPVYKAAYTGVLKTYLDLLPQKGLSGKIIL
FT                   PLFIGGTIAHLLSIDYALKPVLSALGGRYILGGVYAVDTWITRNEQEGYSLSEELIHRL
FT                   DEAAAEFADLLQRKN"
FT   gene            278452..279327
FT                   /locus_tag="GY4MC1_0249"
FT   CDS_pept        278452..279327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0249"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: gwc:GWCH70_3152 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73097"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI46"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADP73097.1"
FT                   /translation="MYLGAIEAGGTKFVCAVGDRNGKIKERVMFPTTEPEETMRHVVEF
FT                   FRQYELEAIGIGSFGPIDLRPGSATYGYITSTPKQKWVNFNFVGEMKRHFSVPIGFDTD
FT                   VNAAALGERRWGAAKGLQSCIYITVGTGIGVGAIVEGSLLHGLMHPEMGHILVRRHPED
FT                   AFAGVCPYHGDCLEGMASGPAIEKRWGKKGAELAGRAEVWELEAFYLAQAIANYILILS
FT                   PEKVIIGGGVMKQKQLLPSIRRNVQELLNGYIQQEAVLHDIDQYIVLPGLGDNAGICGA
FT                   LALAEQALAP"
FT   gene            279495..279644
FT                   /locus_tag="GY4MC1_0250"
FT   CDS_pept        279495..279644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI47"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3149"
FT                   /protein_id="ADP73098.1"
FT                   /translation="MKKETDYRRIVQWLLQRGVRAELVKPRVLLPSYRKCMEIVGGIGD
FT                   ETRR"
FT   gene            279641..280582
FT                   /locus_tag="GY4MC1_0251"
FT   CDS_pept        279641..280582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0251"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gwc:GWCH70_3148
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73099"
FT                   /db_xref="GOA:A0A0F6BI48"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI48"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP73099.1"
FT                   /translation="MTNERRVQFIETAMKLFAEKGYYSTSIQDIVDAWGISKGAFYHHF
FT                   SSKEDLMLAIIQHYFEKMLASFTAIPQDSGSEKERFIQQIAAHFANMHEHKDFLQMMMT
FT                   EQFPKISSDIHHYLLKQQTYIFSWYCDRLIEVYGTEIERYVFDVATMLNGMIRQYMFCV
FT                   FLQANKLHAEELARFLVRRLDAIIASFSHEEAPILNKEMLKPLMELEEKEWRILQEKIS
FT                   AHIAHLQKKLLSLSLDKKMQHKIHAALDALEAELMNEESAPKEYVVQGILLYIEKQHIP
FT                   AFADDLASLAKAVQQYMTTNRWERRKWKKKMN"
FT   gene            280561..282189
FT                   /locus_tag="GY4MC1_0252"
FT   CDS_pept        280561..282189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0252"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: gwc:GWCH70_3147 drug resistance transporter,
FT                   EmrB/QacA subfamily; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73100"
FT                   /db_xref="GOA:A0A0F6BI49"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI49"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADP73100.1"
FT                   /translation="MEKENELAMQSSTIRHRNILITGLIIAMLFGALDGTIVGTAMPRI
FT                   VGELGGLRLMTWLTTAYMLTSTAVVPIAGKLADLLGRRVIYVTGLVIFMVGSALCGMAD
FT                   KMTELVIYRGLQGIGGGIMMPMAMIVIGDVFTGKERAKWQGVFGALYGLASVLGPQIGG
FT                   FIVDHLNWRWVFYINLPIGILATIFIAMGLSKYKAEGPVKFDLAGMFTMIVGVVSLLLA
FT                   LTFGGDKYEWASWQIVTLFAVALVFLTVFVFVEMKAEEPILPMHLFRHRTFIVLNGIGF
FT                   LMSVGMFGAIMFVPFFMQGVIGVSATQSGTIMTPMMITMIIGSIVGGRTVYKIGVKSQI
FT                   FIGMVIMAAGFSLLSTMGVDTSKWTATLYMIILGLGMGLVMPILTLALQESFPKSELGV
FT                   VTSSSQFFRSIGGTFGMTILGAVMNHRSSQLLDDRFMPVLQSLPAQAKGMADRFAHMIH
FT                   DDPQGLYSILFSPEVLEKIPPQMRETFVPILKQSLVDSLHSVFLFGLIFVIGGTALVFG
FT                   MKKIKLSDKQRPLQTSGKNEKLPQS"
FT   gene            complement(282308..282643)
FT                   /locus_tag="GY4MC1_0253"
FT   CDS_pept        complement(282308..282643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0253"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   gwc:GWCH70_3146 protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73101"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI50"
FT                   /inference="protein motif:PFAM:PF05610"
FT                   /protein_id="ADP73101.1"
FT                   /translation="MSDQPKVIATEAALELIEKLKAKYGPLMFHQSGGCCDGSSPMCYP
FT                   QGDLIIGDSDVLLGEIGGCPFYISKAQYEYWKHTQLIIDVVPGRGGMFSLEGPEGVRFL
FT                   TRSKVFG"
FT   gene            complement(282710..284230)
FT                   /locus_tag="GY4MC1_0254"
FT   CDS_pept        complement(282710..284230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0254"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gwc:GWCH70_3145
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73102"
FT                   /db_xref="GOA:A0A0F6BI51"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI51"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADP73102.1"
FT                   /translation="MIYAQPGQPGSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGK
FT                   PYCEVPRSKAADIELALDAAHAAKDAWGRTSPAERARILNKIADRIEENLEMLAVAETW
FT                   ENGKPIRETLNADIPLAIDHFRYFAGCIRAEEGTLAEIDNDTVAYHFKEPLGVVGQIIP
FT                   WNFPLLMATWKLAPALAAGNCVVLKPAEQTPTSILVLMELIEDLLPPGVVNIVNGFGLE
FT                   AGKPLASSNRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVAAKDDE
FT                   FFDKAIEGFTLFALNQGEICTCPSRALIQESIYDQFIERALERVKQIKQGNPLDTETMI
FT                   GAQASSEQLEKILSYIDIGKQEGAELLIGGERNFLEGDLRDGYYVKPTVFKGHNKMRIF
FT                   QEEIFGPVVSVTTFKDVNEALEIANETLYGLGAGVWTRDINTAYRVGRGIQAGRVWTNC
FT                   YHIYPAHAAFGGYKLSGFGRETHKMMLEHYQQTKNLLVSYSPKKLGLF"
FT   gene            complement(284421..284990)
FT                   /locus_tag="GY4MC1_0255"
FT   CDS_pept        complement(284421..284990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI52"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3144"
FT                   /protein_id="ADP73103.1"
FT                   /translation="MNMTKEEVARALSVLFHELTAHWTKEKIHSDVLETIMKLRIESAG
FT                   VEEYMHGLIANVAFATESSYALQQVLGTMLQEQSFLSPAAVEKMMNEAQARIRGHIAEL
FT                   ISRYKTHFEQIHDKTERKKQLERSYSALLIVNRIKTDFLFQFIHESNQNAAKRFFAANP
FT                   NDVLESFHHLSSVYASRWLEGLELHY"
FT   gene            285138..285593
FT                   /locus_tag="GY4MC1_0256"
FT   CDS_pept        285138..285593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0256"
FT                   /product="protein of unknown function DUF1284"
FT                   /note="PFAM: protein of unknown function DUF1284; KEGG:
FT                   gwc:GWCH70_3142 protein of unknown function DUF1284"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73104"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI53"
FT                   /inference="protein motif:PFAM:PF06935"
FT                   /protein_id="ADP73104.1"
FT                   /translation="MKPLRLRGHHLLCVHGFRGMGYSPAFVEKMREVVAKIRDEEQDFL
FT                   IQVVAALDDACMACPHHGETACQAAPDSNEHVLSMDQKVIRHLGIEENGVYLKSELVQR
FT                   TAQKVRPDDLDYLCANCSWLPYGVCKEGIANVQRGNVAQKIEEDGRR"
FT   gene            285541..285699
FT                   /locus_tag="GY4MC1_0257"
FT   CDS_pept        285541..285699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0257"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: vap:Vapar_0593 PAS/PAC sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73105"
FT                   /db_xref="GOA:A0A0F6BI54"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI54"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0593"
FT                   /protein_id="ADP73105.1"
FT                   /translation="MCNAAMSRKKLRRMAGVDAAVVRTIGTVAILLSEFIKNNDAIYEK
FT                   VWYDRQI"
FT   gene            285732..287108
FT                   /locus_tag="GY4MC1_0258"
FT   CDS_pept        285732..287108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0258"
FT                   /product="aspartate kinase"
FT                   /note="KEGG: gwc:GWCH70_3141 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73106"
FT                   /db_xref="GOA:A0A0F6BI55"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI55"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADP73106.1"
FT                   /translation="MKVAKFGGSSVASATQFRKVAHIINSDVERRIIVVSAPGKRFKDD
FT                   IKITDILIQLAQAVMAGKTCDEIVQAVVKRYAEIAKELELPADEFLAELKNDLHRKMNE
FT                   YRDNPSRLLDAIKASGEDHNARLMALYLQEIGLEASYVSPREAGIVVTDEPGNAQILPE
FT                   SYEKLYHLRNRRGVLVIPGFFGYSPEGNIVTFPRGGSDITGSIVAAGVKADVYENFTDV
FT                   DSIYCVNPSIVENPRQLREITYREMRELSYSGFSVFHDEALEPVYKAGIPVCVKNTNNP
FT                   AAPGTWIVAKRNHLDEPIAGIASDTGFCSINISKYLMNREIGFGRKLLQILEDEGISYE
FT                   HAPSGIDNMSVILRANQLKEGKEQRILARIQAELKVDEVHIEHGLALIMVVGEGMERAV
FT                   GMAAKATTALAQANINLEMINQGSSEVSMMFGVKEEAVVDAVRALYQAYFQEAVVGNEV
FT                   "
FT   gene            287321..288286
FT                   /locus_tag="GY4MC1_0259"
FT   CDS_pept        287321..288286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73107"
FT                   /db_xref="GOA:A0A0F6BI56"
FT                   /db_xref="InterPro:IPR030832"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI56"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3140"
FT                   /protein_id="ADP73107.1"
FT                   /translation="MKRFCIAIITCFFFATAHGAAPAFAQVDKRELEQYLSSIGWTMND
FT                   LLNYLDHYHMTVADFQTMAELKQWLGTPIAEENFQQLLKRYQLTQEELEALLGQFGETV
FT                   QDYTFIEDLDAAVAFYLRHNGQMQQINDMLGAIGFTEKEANRLFEHVAALHRQNLPQQL
FT                   EALTARMKPFLQVEDAALLTKQQQQQLLSIWEDVLSVLQIKPKFYLLENGKKQEVSYRR
FT                   LLSLHTLGGRDLLIELYNQKGELLSDVQLSEEILASGYVFRAGEKFIHASMLASEMKET
FT                   MRGDKMPDTASPYLANALLGLLLALFGVYVFWRAKSKAVE"
FT   sig_peptide     287321..287398
FT                   /locus_tag="GY4MC1_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 26"
FT   gene            288292..288900
FT                   /locus_tag="GY4MC1_0260"
FT   CDS_pept        288292..288900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0260"
FT                   /product="sortase family protein"
FT                   /note="KEGG: gwc:GWCH70_3139 sortase family protein;
FT                   TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73108"
FT                   /db_xref="GOA:A0A0F6BI57"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR041999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI57"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADP73108.1"
FT                   /translation="MGERWETYKMRGAVLCMAAGLITAVWNGYSYWLGYNAVKPWKEER
FT                   KTPIAPQAADWQTAGTAAKPKIGDQIGTLLIPKLGISIPIYHGTETQQLRKGIGHYPKS
FT                   ALPGETNNMVLSGHRDTVFWQLGQIGIGDKLIVETAAKQFVYRVKKVRIVGENNRTVLV
FT                   EKPRPTLTVTTCYPFRFIGKAKQRYVLVAQLVSTIKKTG"
FT   gene            complement(288919..289371)
FT                   /locus_tag="GY4MC1_0261"
FT   CDS_pept        complement(288919..289371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73109"
FT                   /db_xref="InterPro:IPR025573"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI58"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3138"
FT                   /protein_id="ADP73109.1"
FT                   /translation="MKTFKLVGLSVVHDDLHRQEIPFIDGLIINKEDGQNHWLIETYLD
FT                   KQYEPIFSELQKRNDEFRLQVTITNRSNDPANMIATVRSITRMNNHISVLMDGLLVRSK
FT                   TDLAEVVLASLVEKGLQGEALLKEFKRQLNERRGFKNNEEKTRIQQ"
FT   gene            289680..290024
FT                   /locus_tag="GY4MC1_0262"
FT   CDS_pept        289680..290024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0262"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: gwc:GWCH70_3137 single-strand binding protein;
FT                   TIGRFAM: single-strand binding protein; PFAM: single-strand
FT                   binding protein/Primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73110"
FT                   /db_xref="GOA:A0A0F6BI59"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI59"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADP73110.1"
FT                   /translation="MINQVVLVGRLTKDPELRYTADGAAVVNITLAVTRNFRNAEGGID
FT                   TDFVQCTLWRKVAENTANYCRKGSIIGVMGRIQTRNYEKKDGQRVFVTEVVAESVRFMG
FT                   GKTHAWIEHS"
FT   gene            complement(290175..290594)
FT                   /locus_tag="GY4MC1_0263"
FT   CDS_pept        complement(290175..290594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0263"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: gwc:GWCH70_3135 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73111"
FT                   /db_xref="GOA:A0A0F6BI60"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI60"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73111.1"
FT                   /translation="MKKMRKLGEKLKYLRKQHNWTQEQLAQHLNISRSQISKWENGELL
FT                   PDVQSLEKLSNLYEVSIDFLIGKHTTKKELLREMNLLYQTDRIDEKMLDIIDYFKQNPD
FT                   MEEMIYSLAQLPAKKRKHLETIIITLIQEFSDAVK"
FT   gene            290791..291291
FT                   /locus_tag="GY4MC1_0264"
FT   CDS_pept        290791..291291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73112"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI61"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3134"
FT                   /protein_id="ADP73112.1"
FT                   /translation="MIVNIYLADLIVSERKGLKQNKGTYRIFVKETRNPFSIRLKTIAP
FT                   TNFPDSLRFLKSGEQQSCSSGEETWFRTITCDSDAQLYFVFKSINQLYMFIVKLDLAKR
FT                   KFDISLYEWNQLQQKYLRLHTSELLTIEKQLVYYILQSFYIFENKRISYLFMCPARKNY
FT                   KKL"
FT   gene            complement(291542..291862)
FT                   /locus_tag="GY4MC1_0265"
FT   CDS_pept        complement(291542..291862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73113.1"
FT                   /translation="MENRQKWRSPNFSAKLFIFPAYPLQHLFASFPAAKPAPATMSKKG
FT                   IYESSMGQIPFFDTRKGAPQQSLSFYFSILKLAFRQKEYFVLFFPTYNGSKKQHRPLRM
FT                   TS"
FT   gene            291991..293349
FT                   /locus_tag="GY4MC1_0266"
FT   CDS_pept        291991..293349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0266"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; Peptidoglycan-binding domain
FT                   1 protein; KEGG: gwc:GWCH70_3133 NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73114"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI63"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADP73114.1"
FT                   /translation="MNVKPRHIVLTSAFASALFWMPDDGKAAEWKVGMSAPQVKELQQL
FT                   LKEKGFFTYPAATGYFGTITEQAVKAFQASVRLPVTGVVDDATYAKLKEAAARRTAEMK
FT                   IGSRGNDVKVLQQNLKQLGYFKYPEITGYYGTITQDAVKRFQQNYGLPVTGIADARTVQ
FT                   SIQNEVMNRRPAKIAQEYVLAIGSQGAEVSKLQQNLKQLGYFTYPKITGYYGTVTADAV
FT                   RQFQKRYSLPATGKADSQTLAKINEAVAGSKTPAPKAAIRLTIGSTGPEVKKVQTKLKQ
FT                   LGYFTHSEITGYYGSITAEAVKQFQKSAGIKATGVVDAETYERLMGQAPQKKLDAIALV
FT                   ADAAELLGKPYVWGGETPQVGFDCSGLIVYLFKKQGISLPRTVATIWNAGTPVSAPSVG
FT                   DIVFFATSGSGPSHAGIYIGNQQFIHSGSSTGVTISSLNNSYWKVRYLGAKRY"
FT   gene            293702..294847
FT                   /locus_tag="GY4MC1_0267"
FT   CDS_pept        293702..294847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0267"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   gwc:GWCH70_3132 UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73115"
FT                   /db_xref="GOA:A0A0F6BI64"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI64"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADP73115.1"
FT                   /translation="MADKIKVMTIFGTRPEAIKMAPLVLELKKHPELIEPIVTVTAQHR
FT                   QMLDQVLEIFNIKPDYDLNIMKDRQTLSEITIRSLAGLDDVMKKVKPDLVLVHGDTTTT
FT                   FVASLAAFYNQIAVGHVEAGLRTWNKYSPFPEEMNRQLTGVIADLHFAPTKKAYENLIR
FT                   ENKKPDSIFITGNTAIDALKTTVTDNYKHDILEKIGDDRMILLTAHRRENLGESMRNMF
FT                   RAIKRIVQEHEDVQVVYPVHLNPAVREVADEILGNDPRIHLIEPLGVFDFHNLAARAFL
FT                   ILTDSGGVQEEAPSLGVPVLVLRDTTERPEGIEAGTLKLAGTNEETIYSMARELLNNRS
FT                   EYEKMAKASNPYGDGQASKRIVQAILYYFGKATQPPEPFSV"
FT   gene            294979..295386
FT                   /locus_tag="GY4MC1_0268"
FT   CDS_pept        294979..295386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI65"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2676"
FT                   /protein_id="ADP73116.1"
FT                   /translation="MLKDLPHAVKVGITRSITRTFEAYMRDIEWNEQRFDPQVFMQRWR
FT                   NDIVRHSSWFHSLDDRLKANSVFHQELADKINSVIDKVLSEAPTEEQLAKIKELATLHG
FT                   EKDIPVSCKAEANYHIERLERLGNMDKTENK"
FT   gene            295650..296930
FT                   /locus_tag="GY4MC1_0269"
FT   CDS_pept        295650..296930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0269"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase ;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73117"
FT                   /db_xref="GOA:A0A0F6BI66"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI66"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADP73117.1"
FT                   /translation="MSKKICVIGLGYIGLPTSVMFANHGIQVHGVDINEKAVKMIQQKQ
FT                   LHIEEPGLQERLNKAIDSGKFTVSTQPEEADVFIIAVPSPINEDKTANLDYVRAATKSI
FT                   VPYVRKGNLVVLESTVPPRTVEDVMIPILREADLEIGTELFVSHSPERVIPGRIFEELV
FT                   NNDRIVGGINEESGRLTAELYKTFVKGKIHITDATTAEMVKVIENTYRDVNIAFANELA
FT                   KISEKIGVDVWEAIRLANFHPRVNIHLPGPGVGGHCIAVDPWFLVELQPELAKIVNLAR
FT                   QTNDSMPEYTALKIKQILENENIHHGRVAVFGLAFKGNVDDMRESPSLEVIHHLEKLGI
FT                   DYTAYDPHIKENKLARQTQQIEEAVARADIIAILTDHNEFKTLRPEKIAPLVRTKIILD
FT                   TKNCIDRNEWKKHGFHVLVLGDGKNQS"
FT   gene            296973..297680
FT                   /locus_tag="GY4MC1_0270"
FT   CDS_pept        296973..297680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0270"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.187"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; KEGG: tagA; N-acetylmannosaminyltransferase; PFAM:
FT                   glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73118"
FT                   /db_xref="GOA:A0A0F6BI67"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR034714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI67"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADP73118.1"
FT                   /translation="MKETFLGVDVCTYTYEQLVAKLMEDIDNNRKSFIVAINPEKIMKA
FT                   QQDDRLRELLNQATYPIPDGIGVVLASILKRGRIRSRVTGIDMMLRLCQEAAARGKKIF
FT                   LYGAKPGVADEAKRRLEKMFPGIQIVGTMHGYEKDEQVIKEAINQSGADILFVALGSPA
FT                   QEYWIANHMHSLSPKVYQGVGGSFDVISGRIKRAPLLVQKLGLEWLYRLLKEPWRWKRQ
FT                   LALPKFLIKVIRE"
FT   gene            297691..299208
FT                   /locus_tag="GY4MC1_0271"
FT   CDS_pept        297691..299208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0271"
FT                   /product="virulence factor MVIN family protein"
FT                   /note="PFAM: virulence factor MVIN family protein; KEGG:
FT                   bmq:BMQ_5225 integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73119"
FT                   /db_xref="GOA:A0A0F6BI68"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI68"
FT                   /inference="protein motif:PFAM:PF03023"
FT                   /protein_id="ADP73119.1"
FT                   /translation="MSKLRIASILFLLSTFFLKFSSMFRDIIIAKLFGNSYVTDAYIAA
FT                   MTIPNALILFMLTGMKDAFLPSYYKYSQLGKGFSHLTNIVKGTFWISFVISVAGALLSP
FT                   LFIPKLYPDFNNHGTQIAIWTAVIYFLSVAIVGVNAVYEGYFDAQKMFSFSTFSQTIVV
FT                   LCTIGGALFLHRPMGIYSVPFGYFVGTVFSFLIKLFYLGPRRFIDWKQPMDREEVISFY
FT                   RIFLPIGLTIAVGQVNLFVNTLFAARLGEGAVSTLNYAFRLVSIPQAIFGVTIATIVFP
FT                   LLAEAKAKNDMALFKAGIEKGLTYMFLFLAPTVAGMLVLMKECVQIVYERGAFTASATA
FT                   QTSEYAFLYIGSVLFYSIQAVIAKGFYTLEKGHYMLRAGIVSIIANIIFNAIFSSMIGA
FT                   AGLALSASFVGLVYSLITFTTLYKITGGFRLSVVGKEYGKITISTLAMVAVLLFVKYEL
FT                   HADRLAIIPYLAFMIVLGAAVYFVALWVFKVESVKEILTKKRRKEVS"
FT   gene            299226..300497
FT                   /locus_tag="GY4MC1_0272"
FT   CDS_pept        299226..300497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0272"
FT                   /product="protein of unknown function DUF70"
FT                   /note="PFAM: protein of unknown function DUF70; O-antigen
FT                   polymerase; KEGG: mth:MTH655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73120"
FT                   /db_xref="GOA:A0A0F6BI69"
FT                   /db_xref="InterPro:IPR002760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI69"
FT                   /inference="protein motif:PFAM:PF01901"
FT                   /protein_id="ADP73120.1"
FT                   /translation="MKRLGMLKKWNNEIDSFSPYFFFPFILILYFFVSLFDFGKIEYFE
FT                   ADRNILWAILAGLLSYLAAVHLVQKKNWMFPSMGLAFLKGKTKYFLYVLGAVGLASYVM
FT                   MLATGQIGITDESVRRHLDPKLNFFSSFLWFSVLFLLCDRAVREHPLTKKQMRTYFVVL
FT                   VIILLLLVLMGYRTPIVVMCFTVLIVFHYTIRRIKLSWLLAFLFVVGLSLSLFGFFRVI
FT                   TEDQTKEFNSHEGPNVELSEEQANKDEVLLRKINETPKWVRGLTEVSVTGRIVLSKLME
FT                   YTDKHGYMYGKLHEGIFSTVLPGEQLSPRMMITEMVNSLTVDKGKYVTRPGRTTTPTLL
FT                   GQFYVEAGYWAIIIGFALYGVILSMLYNQMKQTGFASFQTIAYAFITTIFMISIHTGLL
FT                   DLLFLLMIGYAIVSSAIERTRANT"
FT   gene            complement(300758..301657)
FT                   /locus_tag="GY4MC1_0273"
FT   CDS_pept        complement(300758..301657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73121"
FT                   /db_xref="InterPro:IPR030910"
FT                   /db_xref="InterPro:IPR030911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI70"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3048"
FT                   /protein_id="ADP73121.1"
FT                   /translation="MFPFFKKQKQQKDEHDSVVEANELSENSEADSDEEEVKTELSFHP
FT                   SWNVSIEERYYYQFLHNQQRPLKKNQISLSGIDLKQVPRGYVVTAFVRNSLSRPVAFTP
FT                   APLLLLGPNNEVLARKVFDLSELGEVPPRSSRPWKFLFEQETLRTSELPLVDWKLAFEL
FT                   PKQKHHSLDLAESWEKSLAAEDKQKLQALVQSLQPPKPGEVNFMGLQAQQTEQGDLHVT
FT                   LLIRNGSDKNIHIEQLALQVHDASGDIVASGAFSLDHFEVKANTSKPWTFIFPKSLVTK
FT                   ENPDLRSWKVSLPSSQPS"
FT   gene            complement(301678..304053)
FT                   /locus_tag="GY4MC1_0274"
FT   CDS_pept        complement(301678..304053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0274"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: afl:Aflv_2639 preprotein translocase subunit
FT                   SecA; TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73122"
FT                   /db_xref="GOA:A0A0F6BI71"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030908"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI71"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADP73122.1"
FT                   /translation="MLSYVKKLLNSDERRLKRYYKIVDHINALEPKFAKLSDQELREKT
FT                   AYFKNELANGKTVFDIQAEAFAVVREAAKRVLGMRHFDVQLIGGLVLAEGNIAEMATGE
FT                   GKTLVASLPSYLRALEGKGVHVITVNEYLARRDRELIGQIHEFLGLTVGLNLPMMETEE
FT                   KKAAYQADITYGIGSEFGFDYLRDNMVYDISQRVQRPFHYAIIDEIDSILIDEAKTPLI
FT                   IAGKTGVSSELSYLCARIVKTLERDVDYYYDEETKATNLTEEGIAKIERGFGIDNLYDV
FT                   EHQTLYHYIIQALRAHVLFQRDVDYIVRDGKIVLIDMFTGRPMEGRSLSHGLHQAIEAK
FT                   EGLELTEENKTQAAITIQNYFRLYPILSGMTGTAKTEEKEFQTLYGMDVVQIPTNKPVI
FT                   RVDEPDRVFLTIDQKYKAVAKEVKRVHETGQPVLIGTTSILQSEKVAKYLEAENLPFRL
FT                   LNAKTIEQEAQLIALAGQKGQITIATNMAGRGTDIMLGEGVAELGGLFVLGTERHEARR
FT                   IDNQLKGRAGRQGDPGRSQFFISLEDDMFRRFAKEETEKWMKKAKTDENGEILNKEIHE
FT                   FVDRVQRICEGNSFSIREYNLKLDDVLNDQRTAVYRLRNRILEGDRLIPLVIDMLHSYV
FT                   PYEIEQHCPADMLPEEWDLEKLTEQLREIIPFPAVQLSGNINDIEDVKSNVQHSLEQYI
FT                   HYLETMNDAEQVKAEIRPSLLSIVDYYWLNHLDAMERLKEGIGLRFYSQEDPIRQYQRE
FT                   GFELFVYMYHQIEADICRRLAQAVAPKAAASESAGKTS"
FT   gene            304441..307920
FT                   /locus_tag="GY4MC1_0275"
FT   CDS_pept        304441..307920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0275"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: afl:Aflv_2637
FT                   secreted subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73123"
FT                   /db_xref="GOA:A0A0F6BI72"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI72"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73123.1"
FT                   /translation="MKKWKKTAVSLGLASALVLPSFAQASTMPPLEQWKKQHAQQHAAK
FT                   ARLAYQRLKEAKDQISEDTLIVKYKEKIPASVHRSLGATLKKSFPQLGYDVVTVQKGKT
FT                   AKEVIRAYAKLKAVKSVTPSFTYKKVSTNDPKNDKMYPLSLLQIDKALQLAGKHSVTVA
FT                   VIDSGVDTKHPDLKAQLLPAYNAVNPAGPVVKDIHGTHVAGIIGATANNGVGAHGINPN
FT                   VKILPIDVFNGEWGASDYVIAQGILYAIEKGAKVINMSLVGYFNSPILEDAVKKAIDAG
FT                   VTVVASAGNEATDEYAVPASYEGVISVGATDSKNHLANFSNYGPSVDIVAPGVDVYSTV
FT                   YDPTKGASFAELSGTSMASPVVAGVASLILSKYPDLKPYEVEAILEKTATDLGEKGYDL
FT                   KYANGLVNPVAALNFDIKKLPKKETWSDETILAKAAPLQLTEETTTKTGSLTAPEQIDW
FT                   LKVDVNAGESIQAVLEGAEDYDYKLILRFYPEGKKQSEKPINVNDTRAGEIEGKLFTAK
FT                   ENGTLVIGVTDANGNYSTQGKSEYTLTLQKLTTLAEDNSTKDNPVAIEQLPFDSDKSEF
FT                   APFTFIPEKEGEVDHDYFTFKVEEPTTVKLNLSPVPGINSTISVYLAEDFYHPADPENG
FT                   PYPIVPPVNNNGSGKGETVTFEADPEMEYVIEVASEPPLDFWYYGLSPQSSGANGDTPA
FT                   SAIPYRLTVEPVTMPPDEDGYPLTDDEEEPAPSEETTPAEEAQLNKKAKEKKDIIIIIE
FT                   DNVPLSFEKEDIQHIKENALPYSLGDKQSAHIQFGEDRDFYKLSSVDDTAVYRFTFDVP
FT                   DDMQPEAVVYEYDPKQDDLYPISEFNGYDYFTGQKTNTFTLFLEKGKQYYLSVANGRYQ
FT                   PSADPYTFTSEKLMDAPKDVNENNNEPIRATVVQPNKAVTGNFALNNDEDIYYYKHRAN
FT                   DDIFTFFARPDKLANKASLPAELQGTLIPIVTVVEDTNGNMSIDDEEVGKMVEFWPTGL
FT                   NPLYDVNGSFKAKKNTGYFFIINSYLYDGLTLQSYRFGIETLPKKDEDAGSVVKNNVPS
FT                   KPLSLKQSGNTFKATGYLNASVDYGDKDYYVFTAAKDGKFTVQLAGGVTMDGVISIYNE
FT                   KGGLVQTFDYYGEGDSEIATVTLKKGKYYIVVEDSFARPSAQPYTLSVSPVK"
FT   sig_peptide     304441..304518
FT                   /locus_tag="GY4MC1_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.905 at
FT                   residue 26"
FT   gene            308043..309650
FT                   /locus_tag="GY4MC1_0276"
FT   CDS_pept        308043..309650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0276"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   afl:Aflv_2636 predicted metal-dependent hydrolase fused to
FT                   SLH domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73124"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI73"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73124.1"
FT                   /translation="MRKYSFLLFFAIAFIFGGKTVDAHVVDLTNKAQVQSNYEDFYPLI
FT                   ARYKGTSGVTIESYSSKWRTTAQLKALEAELLANKHGPELSLLGKIMIFPDYPAGENVL
FT                   GQYFAEYQIGKTLSLLPNRVIHLYGGNELTTVAQMATTLAHEYGHHFTYYYLINKEQLK
FT                   PADWLRSKYAAARELFRYPSVHADGSGAYEWSLPEILAEDYVQLFGSPLAVKGHMQMNV
FT                   HIPTPFELSSLQAYWKQWLGNNYAVLSPLPLRLTGYMLDPSDASYYHLRLYLYSPKAPA
FT                   YINAQDGNGRYASVNVGTRSAGVSESWYRPSALSDDVSWLFQKDWNDRVLFRAVLPMAK
FT                   GFNRGSETLVVNYRNIAASVSSRPLFPDVEDEETKQAVKLLYDRGIITGYADGTFRPSE
FT                   KLLRRHAASMLVRAFSLTLPEGYKVKATDMKEGDIGYKEMAIAEAHGLLGQGGKLRPNE
FT                   YMTRAQMAVVLARACSDIYKQPEVLRPFRDVPPSFWAYNEIQTLAFNGITVADPFRPNE
FT                   MITRGQFALFLKRTLEKK"
FT   gene            complement(309683..310669)
FT                   /locus_tag="GY4MC1_0277"
FT   CDS_pept        complement(309683..310669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0277"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; S-layer domain-containing
FT                   protein; KEGG: afl:Aflv_2635 cell wall-associated hydrolase
FT                   containing three SLH domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73125"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI74"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADP73125.1"
FT                   /translation="MRRQLVLALLLGGSVFAAGARAEQAEASVNYDHIVPAAKQYIGVP
FT                   YRWGGTTAKGFDCSGFIRHVYQSIGIDTPRTATDMYRMGKRVDKSALRVGDLVFFNTSG
FT                   KGVSHAGIYIGNNRFIHSSSSKGVTISSLNDSYWKKTYIGAKRVLAYRLAPGQFQDVSP
FT                   SHWAFDEVRTLSEQELVIGYEDSYFKPDEPITRAEVAAYLAEYLDLNLSDRSVPFNDVP
FT                   DDYWALGAIRAVQKQGIMNGSNGKFHPEDTLTRAQLAAVLTRAFRLQPPAAAKSFTDVP
FT                   PSFWAFRDIQALAAAGIATGRTDGSFGPNEPVTRVQFAAFLYRAMHQ"
FT   sig_peptide     complement(310601..310669)
FT                   /locus_tag="GY4MC1_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.893 at
FT                   residue 23"
FT   gene            311109..314252
FT                   /locus_tag="GY4MC1_0278"
FT   CDS_pept        311109..314252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0278"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   afl:Aflv_2634 S-layer glycoprotein protein, contains three
FT                   N-terminal SLH domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73126"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI75"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73126.1"
FT                   /translation="MAYQPKSYRKFLAGSVSAALVATAVGPVVANAASFSDVNPNDSHA
FT                   ANINALVELGYIKGFTDGTFKPYQSITRGQVAKIFARILTDQGFQAPDKIEQVFDDVPL
FT                   DAKDQELVKAAAIVKAAGVMTGSQGKLNPAQNITREQMAKVLVEAFDLTKPADFTSKIT
FT                   DLDKADPSFRDYIQTLEANGVTVVTEYRPKDSVTRAAFASFVKRALDVSSVVTADDITE
FT                   VKFVDENTLEVTFNGELKEVKKEDFAIEGVEIDSVSIKAAASAEGKTTVVVIKTKTKLE
FT                   EGKTYTISYKGKTTDKAKVEVPVVTPKVESVSAINAKQIEIKFNTKMDKDSVTDVTKYS
FT                   IKRAGVPAVKLSDVSSANEYATAELSEDGKTLTITFKNALTTPAWGSIAEGDTFNFETA
FT                   KLKAANGKEIDAASYAVKYSDKVAPVFVSAKAVAKTTTNKITLTFSEPIDYSVATVSVD
FT                   GVFGSLSAGSKPNELVVTTNANLEVGKTYNLQILNVKDVAGNLLTPNPVNTTVTVTSDT
FT                   AAPVVTDVKVVRDNLIEVTFDKSMDASTLTANGTVKLMDANFSNTNAISSVTPKDNTDN
FT                   KVFLVALNPVSFNDNGNFLGTLVISDSAKDSLGNAIATTTKAVSLVKDTVKPQAISVKY
FT                   VKATTYGDQTGLTNGALVVKFSEEIQTSTGSIVVVDDQGQTISVGSPVVNGKDKTELII
FT                   PLTAPVAQTAKFYTVSVSAGTVKDLSSQQNSNALATLTADVSAGAVTGKDTAAPSITSI
FT                   SGVAAVKATSTGNQITFTIQDQANAGETASGVDFTTVTDVNNYRLDGAPLPSGSYVKVT
FT                   GSDPSYTVTIQLPFGAISKDKNYSLNINGIKDKAGNVITPVAVNNVELKDDVQPELKTA
FT                   TLNANGTVSLGFSEDVVPVATASSAVLDFTVELNGSTLTKPAASPATDLAYELIDGTGA
FT                   DAGKYVLRVKVSKETQTVTDAATGITINGVKYTVDNDGDNLLFKFIDVNGNKTADNGDI
FT                   ILSATDVDSTTQSFDFDSYYDLTKATSLKVGTVATPTVVTDTSTLANELVGNKKITVK"
FT   gene            314767..316284
FT                   /locus_tag="GY4MC1_0279"
FT   CDS_pept        314767..316284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0279"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3998
FT                   transposase (25)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73127"
FT                   /db_xref="GOA:A0A0F6BI76"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI76"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP73127.1"
FT                   /translation="MLAVAEIHYIRYEANQKGCSYSDIAKRMNRDPRTVKKYAEMEDFN
FT                   PSKVKQTRKAKVMDPVKPILDQWIKEDLTKKKKYRRTAKRMYEILKEEYGFTGSDRSVR
FT                   LYVSKRKQELLEQSESAALPLESKPAMAQVDFGEAPFLYQGKYVDFPYLVVSFPYSNAA
FT                   YVQVMPAQNQECFLEGLKRIFHYMGRVPRVIRFDNLSPAVKTILPNGERELTETFQRFV
FT                   LHYGFECEFCNPASGNEKGNVESKVKYIRNNFFLPEQTIYQLESFNESLWEKCEKDWNR
FT                   PHYEKERLIAELFEEEQALFLQLPAKEFECVRYEQVTADKYGFIHLENNLYSTSPRFAK
FT                   QKVLAKISYHEIAILTEEHELIIKHERLYGTKQKSMKWQPYLTLMAKRPNALKYTDFYE
FT                   KMPEEWKNYFSNCTVQEKKEALQLLAVLLKEHDFEVSTQALRIASQYGHPKVESIKQVF
FT                   YQLINGRGIREPIQPKKHVPDMPEAIRGVRHYDRLFESQGDVASWNK"
FT   gene            316272..316991
FT                   /locus_tag="GY4MC1_0280"
FT   CDS_pept        316272..316991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0280"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="manually curated; PFAM: IstB domain protein
FT                   ATP-binding protein; KEGG: bha:BH3999 transposase (26);
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73128"
FT                   /db_xref="GOA:A0A0F6BI77"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI77"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73128.1"
FT                   /translation="MEQMIKEYAKRLKLSWIPANYHTIHAETNEEFLLKLFEREVQHRD
FT                   ERRINLLLKQATLPKIPNKPYDWREIQLAPGITKDYILEGEFTKNQENLIFYGGVGTGK
FT                   TFLSTLIALNLMKKQGKRVKFYTAASIVNALLEANEKGDLGKFLNQIEKLDLLILDELG
FT                   YIPLHKQGAELLFQVISMCYETKSIIVTTNLPFSQWNNVFGDPILTEAVIDRLIHHSHL
FT                   IIFNGESHRYKDSISQR"
FT   gene            317235..318140
FT                   /locus_tag="GY4MC1_0281"
FT   CDS_pept        317235..318140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0281"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: gwc:GWCH70_3102 integrase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73129"
FT                   /db_xref="GOA:A0A0F6BI78"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI78"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP73129.1"
FT                   /translation="MQNYVTPFIGYLYEEAKDEKTIASYRTTVVHFLTWKEQRDGEYII
FT                   EETRPIDIKEYISYLKHQCKRKPATINKYIAALKVFFAFLLSSGIIKDNPMTRIKVEKL
FT                   DYANGANQTKWLTKEEQDRFISYVQLEPNEFKRLRNLAIIDLMLYSGLRVNEVSSLEIN
FT                   DIITKDKDVQVIIREGKGNKFATVILVQKHAKNLRKWLKYRKGLDKDIHKSSPRLFVSE
FT                   RSPFFTERGIQKMLNKYAELANMDHITPHRFRHSFCKNLANAGTPIELIRRLARHESIQ
FT                   TTAIYLESSQEEQIETLRKV"
FT   gene            318309..318698
FT                   /locus_tag="GY4MC1_0282"
FT   CDS_pept        318309..318698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI79"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3096"
FT                   /protein_id="ADP73130.1"
FT                   /translation="MGVHTLTKEQYPIANTNTLNFLKTNVLSVTDISRTKKLSEILDRF
FT                   SNGVSDEVFVIQNAKKKDALAVVIDIDYFEQLLQIKEVVEEALDQIVMEEAYARKNKPV
FT                   NQTLSDIFDEADINVNELMKLLEED"
FT   gene            318700..319071
FT                   /locus_tag="GY4MC1_0283"
FT   CDS_pept        318700..319071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73131"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI80"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3095"
FT                   /protein_id="ADP73131.1"
FT                   /translation="MKTLEDLQELILEKYNVELRFVEDVKQDIKAINKGHRQTVLLEIL
FT                   RRAKQGPLFKPDGVAESLHGDLHGFAKIKSKSLNIRIIYRPVEGQPIRMEIIAIGPRDK
FT                   KKAYRMAAERLQKFFMEMD"
FT   gene            complement(319323..320522)
FT                   /locus_tag="GY4MC1_0284"
FT   CDS_pept        complement(319323..320522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73132"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI81"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3094"
FT                   /protein_id="ADP73132.1"
FT                   /translation="MKKGKKTNHQFLEELFQVWGNEFEPLEEYKGYDQPIKVRHKQCGR
FT                   ILDKTPKNLITLKLGCRICKNKENGKKRRKNHDWFVNEVKKLVGNEYQVRSEYTRSKDP
FT                   IKMYHTVCNEEFTTTPDAFLGSRNGDGKKGNRCPKCSGKWKRDTEAFKQEVYKMYGDEF
FT                   EVIGEYKGRHENIKILHKVCNNYLYPRPRHFLDGNSYCQYCSKKEKKDTQRFKEQVYEL
FT                   VGDEYIVLGEYVDAKTPIPLYHKKCKTVYRVTPDNFLRGKRCGLCTDIHNSKGYKAIYN
FT                   LLFANQLPFDTQYRDENCRNIKPLPFDFVLYNNWRLDKIIAFIEFDGEQHDKPSNLFGG
FT                   EEGFKERQKNDQIKNDFAKEKGIPLIRIKYKDLNNIESVLQEELKKINIYIDINKTNVI
FT                   "
FT   gene            320700..321482
FT                   /locus_tag="GY4MC1_0285"
FT   CDS_pept        320700..321482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0285"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   gwc:GWCH70_3446 transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73133"
FT                   /db_xref="GOA:A0A0F6BI82"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI82"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73133.1"
FT                   /translation="MTDVVKEDIEKWHNRPLLKRYSVLYLDGLYVKLRRDTVEKEVIYV
FT                   VLGVNEEGYREILDFFVGGQESAYGWQEILQHLYQRGVKEMLLGVFDGLPGLDEAFRAF
FT                   YPKADVQLCIVYKVRNTLHRVRKKDQFEAAEDLKLIYLAPNKEWALQMFQQFQSKWSGK
FT                   YPKEVQSWANELDVLLTFTKYPSSMRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAE
FT                   KVVYLTIQDFIEKWAERKLRGFTEAQKALQRMFEERYN"
FT   gene            321700..322092
FT                   /locus_tag="GY4MC1_0286"
FT   CDS_pept        321700..322092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73134"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI83"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3068"
FT                   /protein_id="ADP73134.1"
FT                   /translation="MVNTNKIVGQNVKKYIESKGIKHSWVMERTGIKKTAYYNFLKGEG
FT                   NVEEYVAKINKLFRIKDPFFFYKSDMEFKEKTFERSRSDSFMNHVALSFHGTVDEELKK
FT                   GMRLFSEFVELIDVLKSVTNSENPRG"
FT   gene            322097..322891
FT                   /locus_tag="GY4MC1_0287"
FT   CDS_pept        322097..322891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0287"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   gwc:GWCH70_3067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73135"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI84"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADP73135.1"
FT                   /translation="MITKDNLEMILEHNKTYLPKMKKAMDRIYSLGDPLAHVKPLDFIK
FT                   TYLYEHANVLQFPIQNADYGGLVYYYNGDYYVHINTAQPRIYENFMWAHEFYHFFFDRE
FT                   KIKNPDQNFIMIDYIYDEKERLPNLFASEFLINDFVLERSFKFLETAHTKQSLPEKIMR
FT                   LINVFQLPYKALVVKLAQNELITINEAKSALDYDYRNRIPHDIDKSFFEPSYTINISGF
FT                   DELYEKAKGLMYEEDLQSIKKSFDKLYEQVLVSVHDQRRTKG"
FT   gene            322888..323730
FT                   /locus_tag="GY4MC1_0288"
FT   CDS_pept        322888..323730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI85"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3066"
FT                   /protein_id="ADP73136.1"
FT                   /translation="MKVLDSPVLESVRPFISDNTEQLYQSLNEHQAFYMFDNMILTKLR
FT                   KQISNLPLLLQAFHQSPVFLIPDVVLEESFRNIPTKERYNDYYFELFKQLSAKKQLYII
FT                   SMETIYQLLEKGMTKKQYIFDVMKQLALEAFRVNRDIINNLERCELSSFSDLPKLRQII
FT                   LHNGNNAGERFICFFALLLVHQYYGPAYICSDDGKGVYTMYNTFVNNESLFRILGVDDF
FT                   LMLKEQYILLSYDCILQLSIKNTGLSSKEIYAFVQSSGRNDVYCKIKIQSSARKTCRA"
FT   gene            323816..325345
FT                   /locus_tag="GY4MC1_0289"
FT   CDS_pept        323816..325345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0289"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   gyc:GYMC61_2738 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73137"
FT                   /db_xref="GOA:A0A0F6BM83"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BM83"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADP73137.1"
FT                   /translation="MLAMPEIHYIKHLRENKDLSISEIARKTGLNWRTVKKYADGNIGG
FT                   QKIMKKKRGMMYELGYGEIIDDWLEEDAKLPRKERRTNRTMFEQLQKEHGFPGSYRTVC
FT                   AYIQERKPHLKAEKEKRYERLEHPPGEAQVDFGTMQVVKDGALEDKKLLILSFPHSNAG
FT                   FAHPLPSENRECFLEGLKQLFHQAGGVPRRLRMDNLPAAVVTVGKGDNRQYTEAFLRFQ
FT                   AHYGFEVQPCNPASGHEKGNVERKVYYVRHRCFVPAPVVESDEQLTEWLRVKMIEDRSR
FT                   LHYEKGVPIEELWKEDQKELKALPLDDLPIFSLDTVKVNKYGEITVDGEKWVIHQARVN
FT                   QSLVVQKGWDRFICLSNQGEVVFEAPRPYMNQKQEIPWEEIFNDWEKKPRSVSYSRFFK
FT                   YLPEKVQTYLTFRKEEVKQRVRGVRELLKSHTLKELDEWLNKEQRFDLAPHELKVLLEA
FT                   KQQAYPEKWEETYTPSVFVNYETDLHLYDQRLCPSWEGGANRDDSGHQRDL"
FT   gene            325317..326057
FT                   /locus_tag="GY4MC1_0290"
FT   CDS_pept        325317..326057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0290"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: gyc:GYMC61_2739 IstB domain protein
FT                   ATP-binding protein; PFAM: IstB domain protein ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73138"
FT                   /db_xref="GOA:A0A0F6BMA2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BMA2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73138.1"
FT                   /translation="MTRDIKEICKALHLAYIADRFEEVPYETKEQFLRDVLALEVSSRQ
FT                   EAKRSKLIKKAKFRELKWLKDYEWSDHIHWPSTTTKEELCDLVFLERRQNVLLLGSPGT
FT                   GKTHLATALGLKACEKGHEVRFFRVADLVAQLEEALKNGTLPRLKRQIETCELLILDEL
FT                   GYVPFQKQGSELLFHIIADCYERKSVIVTSNLEFGQWNRVFGDNRLTAALVDRLVHHAH
FT                   IIAFTGESYRLRHALSSVKKISSN"
FT   gene            complement(326307..326510)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0291"
FT   gene            complement(326661..327926)
FT                   /locus_tag="GY4MC1_0292"
FT   CDS_pept        complement(326661..327926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73139"
FT                   /db_xref="GOA:A0A0F6BI88"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI88"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3053"
FT                   /protein_id="ADP73139.1"
FT                   /translation="MVLPDKKRKIIVAIMLLTALAFRLFVLWKYGLSLTLHSDDTAYIR
FT                   SGKILAEKGMIVYHYNHINEPTVHIMPGLPMLLAAIFFIFGTGDMGLYAAKAVMILFGV
FT                   ASVFLIYAIGKDINHEWAGIIAGFSTALFVPLIEIDNLILTEPPFLFGLLLFIRFAVQL
FT                   GRNHSMSAFYGLMFAYLFCLLFRATVALIPFALLGYFLLIKYPLRLAWKQLGIAVLLVI
FT                   IVLGPWWVRNYIHYKEFIPLTGSSGDPLLLGTYQGDGYRYGEPYEEVIKKIDEQYPHIT
FT                   IRKKQELEKEIAIERIKRWYKANPKQFIESYTIKKAKIQWETPFYPVEILDVKKPFIIS
FT                   LHQRIVLLAFASVALTLLLLKRNRKELLFLTFIIAYFTVLNNVFFAYSRYNLPLMPLLF
FT                   LYIGLLVSAVWHMLFRKKAASS"
FT   gene            complement(327943..328311)
FT                   /locus_tag="GY4MC1_0293"
FT   CDS_pept        complement(327943..328311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0293"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gwc:GWCH70_3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73140"
FT                   /db_xref="GOA:A0A0F6BI89"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI89"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP73140.1"
FT                   /translation="MNLINFLLILSNTCILVIGQFLWKYGMMKTSFSLDPFSIIKLLFS
FT                   PFIFSGLVMYGAATILWLFILSRVPLSVAYPVQSIAYVLAVFGAYFVFHEPLSPAKIIG
FT                   VILIILGVSLIGISPNTQ"
FT   gene            complement(328298..328666)
FT                   /locus_tag="GY4MC1_0294"
FT   CDS_pept        complement(328298..328666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73141"
FT                   /db_xref="GOA:A0A0F6BI90"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI90"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3051"
FT                   /protein_id="ADP73141.1"
FT                   /translation="MGKVQIITIAFASLFLIQVVYYSSRNKLRDKQAFLWFLMAFIGIF
FT                   IAVCLDWFNKIAALLGVAYMPALIFTIAFLVILNILIYQSVTLSDHQEKIKTLVQEIAY
FT                   LKHELEEYQRKGEKDESH"
FT   gene            complement(328685..329368)
FT                   /locus_tag="GY4MC1_0295"
FT   CDS_pept        complement(328685..329368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0295"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gwc:GWCH70_3050 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73142"
FT                   /db_xref="GOA:A0A0F6BI91"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI91"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP73142.1"
FT                   /translation="MDILVIIPAYNEEAVIKNTVMNVMKTCPYDYIVINDGSTDRTLDI
FT                   LKENQFHYLDLPVNLGIGGAMQTGYRYALQKGYQYAIQLDADGQHNPKDLENLVSEIKN
FT                   SGCDMVIGSRFVQKTGYKGSLFRRMGILYFYYLLYMIAGIKITDPTSGYRIVNRKVMRE
FT                   FANYYPVDYPEVEVLAKLAKKGYKIKEIKVDMNARQGGKSSITPLKSLYYMTKVTFISV
FT                   IRSIF"
FT   gene            329776..330972
FT                   /locus_tag="GY4MC1_0296"
FT   CDS_pept        329776..330972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0296"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   xbo:XBJ1_4052 conserved hypothetical protein; putative
FT                   exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73143"
FT                   /db_xref="GOA:A0A0F6BI92"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI92"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP73143.1"
FT                   /translation="MKSVLFAFLLFIPFFSFFNHHVKAAELHTYIKAVKHHVPLLDNST
FT                   GSLVEVGYMEKGDILKVYKDQGKNWWQIKFGNSYAYVYKGNVESFKAKAIRGENTSLKN
FT                   SNHTILLMKNQRIYDNSTGKLIPFVTIKGNMRYPIIRKLKDWYQIDVGGRIGYIHHSKA
FT                   NWDHGVPVLMYHHILKRSENKNYRNVSTTISDSQFYEQMDWLKENGYETITLQRLEQYV
FT                   RGKANIPAKAVVITFDDGLKTSFIYAYPKLKKLGFKAANFVITGRIPKAPQKFNPDGLQ
FT                   FLSQSEMAAMSDVFTFESHTHQLHHLNGKKSYVVIKPYNVVKEDIKRSKDILGARYFAY
FT                   PFGQYNSSIIRMLNELDFKLAVTTKEGKVHIGDPLLEIKRLGVYPEYTLKDFSKMVQN"
FT   sig_peptide     329776..329850
FT                   /locus_tag="GY4MC1_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.907 at
FT                   residue 25"
FT   gene            331567..333498
FT                   /locus_tag="GY4MC1_0297"
FT   CDS_pept        331567..333498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0297"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   lsp:Bsph_1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73144"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI93"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73144.1"
FT                   /translation="MFKHFKIWVGVLMAAFICVNVMHSHKAKAEEKVRVGLVVSELSEK
FT                   YAFIKREGGYYNGTYIQPKQIGSSIKNKRIKARLLLENLGYEVEHVNDAQLSDPKQLAK
FT                   FDSLFFPNTVMMSKAQRQAVKEYIKNGGGAIFAFAAARNDSARFPYKETDLDLTPIIYE
FT                   TKTWIWEWDNLSEVFQSAFINDVAIGNYTIRSAGNHPIVANALKRLGKTSILLENRRFG
FT                   KYQPTWIEVIQPYQNNSYVTPILQYETIGYSSVPKHTPPKTGAAYAIEYGKGKAVWFGF
FT                   QLLDYMTVDERLSNEWDEKNPNGQREVKGKAWDFLYGGEDLKILLDECVKWSAQPLAKF
FT                   HPIDRKVTMSLTDVRAYPRASDYVVYGTMKAKNNGNIISRGTMKVELTDPSGKVKASYE
FT                   KYVVGLVPKGESYPEKFVLTLPKNTPVGNYRLTAYYRAGRNNKAGVKVAGNTKIISIKD
FT                   NRKSASILNMPSFKDISSHYWAKEDIDNLISLGVITGYQDGTFKPEAPVSRLQAAAMIV
FT                   RSLGLSTKNRPDPQLEDVKPGQYGYDVIATVVDEGIFSGANGRFHPNAPLTREQMAKIL
FT                   VNAYRLTGEEEVHFRDISSSQWSKPYIATLLANQVTQANGLFRPNERTTRAQFAAFVSR
FT                   SLRAADMD"
FT   gene            333503..334156
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0298"
FT   gene            complement(334315..335223)
FT                   /locus_tag="GY4MC1_0299"
FT   CDS_pept        complement(334315..335223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0299"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   bpf:BpOF4_20104 putative S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73145"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI94"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADP73145.1"
FT                   /translation="MKRTFLHIALSLLAAMLALPAMNASAATRFSDVNANYWAYNEIHY
FT                   LADKQIIKGQNGKFLPENPIKRMQAAEMLVKALGLSTKNRPNPHFKDIKPGDYGYEYAA
FT                   TLADEGIMTGSNGYFKPWDTLTRGQMAKILSEAYDLTYIFGSDFDDIDEDSWLYDYVSC
FT                   LVDNHITTGYDDNTYRPNDKLKRSQFAAFMARVLEDSFKPAVLFKTVGYDWDEDGGLTL
FT                   LVEVRNNFSYPVEATDALIAVTDNGEWIALDWFEFAPNELRLTAKEAKRIQLYFQPDYV
FT                   LTDPGDLTDITLFSKTEVIKK"
FT   sig_peptide     complement(335143..335223)
FT                   /locus_tag="GY4MC1_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 27"
FT   gene            335481..335876
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0300"
FT   gene            336631..337740
FT                   /locus_tag="GY4MC1_0301"
FT   CDS_pept        336631..337740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0301"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: gka:GK1472 hypothetical protein; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73146"
FT                   /db_xref="GOA:A0A0F6BI95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI95"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP73146.1"
FT                   /translation="MEKHCRLAVAITGSGKGIGKYLLSLMTQPPGAFVDKIPIMPPPGI
FT                   LRGVLPLRRLIDKFKDVDKKSGFLAPSLPTDLSYSELSFMTKRGFLGKKLSQYLGFNKD
FT                   EGDFLFYLSLSKPSFTNPDSENKGECILYLSELMLKWSEQKQDIPYQIKRLDVRPDIQN
FT                   AMLKAYDMFKDELFSSSDAAEEREIDACCCGGQWEVYRDVMFAATQGKFLLLTEEEVSK
FT                   YKEGIVLCEGRVKDRSDIPICRNLAKEKLESEGLSQPTIMRWLLVLSEAITNAIKHAEE
FT                   GTMTILKDEKNNEIRFVIEDKGPGFALKDLPKKTLLAGYSTKKSLGQGFTLMMTIAKRV
FT                   LLFTSPKGSVLILSFDIHKKNRDQLGNAG"
FT   gene            337873..337977
FT                   /locus_tag="GY4MC1_0302"
FT   CDS_pept        337873..337977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73147.1"
FT                   /translation="MAKEQTTAATEIAGFAVGIARTGKRMIGNIQPVA"
FT   gene            338018..338335
FT                   /locus_tag="GY4MC1_0303"
FT   CDS_pept        338018..338335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0303"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: bpf:BpOF4_13060 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73148"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI97"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADP73148.1"
FT                   /translation="MSLTVNKKVKGKTLILKVKGVLDISTVHVIASYLKEIDHIETLIF
FT                   DLSDLELIDSTGIGTILNAIYLSQEKHFKLKLQGMDELTDNVFETVGLYQILEAMQGEV
FT                   N"
FT   gene            338335..339165
FT                   /locus_tag="GY4MC1_0304"
FT   CDS_pept        338335..339165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0304"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: bpf:BpOF4_13065 hypothetical protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73149"
FT                   /db_xref="GOA:A0A0F6BI98"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI98"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP73149.1"
FT                   /translation="MYKYRPTFTQRERVIDNQQIMDNMDKTLQREINLARNIQMQLLNG
FT                   KTPEFEGGEVIGSSLPARLIGGDYYDFYPLVNGKIRIVVGDVMGKGIPAAMLMILTRDA
FT                   FRRVAEITDSPAETLTSMNQALYEDLRTLKSFVTLICADYDPKTGIFTYASAGHHLPLY
FT                   INGRDKTIKELPKVSGIMLGGLPDQVYKEMSIQLDEQDIIFFYTDGIVEAQNKDGEQYK
FT                   LERLVQTLLENHEKSVGEIERSVMDSIHQFTQGVPQKDDITMVLLKVSKQKNGY"
FT   gene            339207..341288
FT                   /locus_tag="GY4MC1_0305"
FT   CDS_pept        339207..341288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0305"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   bpf:BpOF4_13070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73150"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI99"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADP73150.1"
FT                   /translation="MQSIVAKGKDINEAIELGLKLLGTEKEKVSIEIIQTETKGFLGIG
FT                   AKPAIVKLTKLEAAEAQQAPDKNDVIEQAVSEINMEEVAVLSDFLPEREHEGEHQIDTK
FT                   EPDALVGKAWVKNGALFCKTSPTHFPTVTIGEGVKLYRNHELVKEKTTIVTENDVYEIK
FT                   VENEKKDTKWKVWMDEKKLKVFLYVEPGYKITRKLPDIEPSQHIELVVEEYKEVYNTLS
FT                   YADVMQKLESLQVAHQFIRQEQIVKALEAKEPGTYEIAAGVSAKDGKNGWIELNVDLQS
FT                   HNGPIANEDGKVDYREIRTIPSVDRGQVIATIHPPVPGQPGVTVTNEPIPPEPAYPVVL
FT                   QAGRGIMEVDGKIVATESGRPQVKQKGRLVKVSVMPKLTHPGNVDLSSGNIRFTGDVEI
FT                   FGEVEKNMVVEAKGDIIVHQTVNMASLIASGAIVSYGNIISSEISAGKHNMLVAELGNL
FT                   LGIIQQNMEKMIGVIRQLLQSPAFKSNDFSRGGLQPLIRILLEKKFQSFPPFVKKYVEM
FT                   VRNGESDLEDDGWKEIADSLTKLFLSLTNEVISLEWMIQLSQKMKELHKTSVSPAEPDS
FT                   YISIPSALNSRIYCGGDVFVTGKGGCINTKIHAGGALKINGVVRGGEVYGGLGAEINET
FT                   GSERGISTVIAVPRDQKIRINKAMEGTVLKIGNAKYTLKETRHYVSARLDQDDRIVFE"
FT   gene            341309..341617
FT                   /locus_tag="GY4MC1_0306"
FT   CDS_pept        341309..341617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0306"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: bpf:BpOF4_13075 anti-sigmaB factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73151"
FT                   /db_xref="GOA:A0A0F6BIA0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA0"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADP73151.1"
FT                   /translation="MEYSLHESDEYLEVKLVGDLDIDGTEIIEEELIPHLEKYRMVNLN
FT                   FAGIQFVDSTGMGLLMNMVQRLKEKGIKVTISDVQQDVMNVFEILQLPEILGEEVFV"
FT   gene            complement(341811..342998)
FT                   /locus_tag="GY4MC1_0307"
FT   CDS_pept        complement(341811..342998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0307"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: gwc:GWCH70_3058 efflux transporter, RND
FT                   family, MFP subunit; TIGRFAM: efflux transporter, RND
FT                   family, MFP subunit; PFAM: secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73152"
FT                   /db_xref="GOA:A0A0F6BIA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA1"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADP73152.1"
FT                   /translation="MKRWKRYIFLVIVLCICANFYMLFHEHSKIPKSVYVNERTKPEKT
FT                   TIKETVRTGGFTAPAERKFVYYDPQLGVIDEILVAKGQEVQVGTPLIRYADADIDREIQ
FT                   RIALKKEQLHAQIEQLAKDIDHYTTLSSSAEEEDSMKIQWEEKAREAEREKTLFEWKIK
FT                   EYEEQQNELTEKKDELVVESKTAGIIEEISYDKSKPLITIASPSAIVRGKAKEGTIEKL
FT                   AIGQAAVVRVPNEKESFAGTIAAIGKIPVKEASFQEKSEYPFTVQLNEQPKQLPFGYHV
FT                   NITVVTKEKSGAITIPAEAVWREKTKSFVYVIHNGKLEKRKVTLGIAHGEKQEIEQGLR
FT                   ENEYIVSHPAKQMKHGMDVIVPLDLEKPTKETIKQLSKWDIVKHFLDGFFRSFHS"
FT   gene            complement(343017..343676)
FT                   /locus_tag="GY4MC1_0308"
FT   CDS_pept        complement(343017..343676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73153"
FT                   /db_xref="GOA:A0A0F6BIA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA2"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3057"
FT                   /protein_id="ADP73153.1"
FT                   /translation="MMYKSNPLKEIVHPKTAFAQLKEAERVKHVAIAVLILLFASVVLS
FT                   LLRAYFGIGTEELTKHLGRYTSEQFAFAQLLFASGHVLGGLFVPLLFLFISSIIYYLFF
FT                   EMDFAKLLTIQLPVLLIFLIEDIVLFPLQLFFGVKDLFSPFSLGVWGPYITKHAFIWAL
FT                   LRNVSVFSVWAVSLQIIALRTLTEKPVQRIAMIVITVYLFFALLITACTEFPFSGS"
FT   gene            complement(344033..345775)
FT                   /locus_tag="GY4MC1_0309"
FT   CDS_pept        complement(344033..345775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73154"
FT                   /db_xref="GOA:A0A0F6BIA3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA3"
FT                   /inference="similar to AA sequence:KEGG:BMD_5208"
FT                   /protein_id="ADP73154.1"
FT                   /translation="MLKNGIFSAIAALASAICTVLFFSPIHWNILAEGGILFLLLFAAY
FT                   YIVLQNKTRFVAPLSRSKRWAAGLFMLLFPLFTVISMKGEQTHLQHSPLAVKFVIYIGT
FT                   YVSIIMLTLFIVSLILSVTPDRPDPGKKWGYIFVYALPPLIVWAFYLIAFFPGAMTADS
FT                   IFQWEQAHTGKFNDWHPLMYTLFIMLVTSVWDSPAAIGIAQIIIISLVIGYCLFELEKA
FT                   GAPKWAVWAVSILFAVSPINGIYSITVWKDILYSTFILLFTTLIGKLIMTNGDWLKRFP
FT                   AFIFFTVTALGVVFFRHNGFVVCLATLIILSAAFRHLWKQWLLVLSLVVAIHYAVTGPL
FT                   FAYLKVTPSDPNEALSIPTQQIARVITYNGKMTEQQAEYIHKIMPLDLWKKLYNPYLTD
FT                   PIKFSRHYNRQAIFPDHLSTYLQTWWEICRQNPRLVIEAMAKQTSLVWQMNEPKDGYTS
FT                   MFVTNVFYGNKFGLKNEVIFQPITKTVGTYLKWSETAGKPFIWRPAVYMFFIILFTFIA
FT                   FLRNDRKALLLPIAVLLNIGTVFIALPAQDFRYLYSNSLVFFIAFLFALVSYRNDGNTL
FT                   SQKR"
FT   gene            complement(346356..349325)
FT                   /locus_tag="GY4MC1_0310"
FT   CDS_pept        complement(346356..349325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0310"
FT                   /product="Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.96"
FT                   /note="PFAM: Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase; SH3 type 3 domain protein;
FT                   KEGG: bay:RBAM_032900 LytD; SMART: Lysozyme subfamily 2;
FT                   SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73155"
FT                   /db_xref="GOA:A0A0F6BIA4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA4"
FT                   /inference="protein motif:PRIAM:3.2.1.96"
FT                   /protein_id="ADP73155.1"
FT                   /translation="MRIGVQIRKFAALLSVLILLVSYAISPAYAANASENTSGQATTYV
FT                   QVSSESAPVKQAETNQLVGELTKETILKAIKLENNHVYIQWGTGLAYLDDADVQNAVLS
FT                   ESPTSYTYEEKTQFSYVLAKEKAPIHTQNGKLIGYLMPDQPYPVFQELDDAFEIIIGNQ
FT                   LGYITKAPFVSVIDTNHQTAVDADTEETKTTNAAPENVSETSQTEVKTKQPETNTTNIP
FT                   ETNTTAVNKSEGANQTGVRAAIASTAETPSSQFTASTKYFRVTDEQTAIYDNSTGQLVQ
FT                   VGTLEKGQEFPRIKDYGNWHQIQFGTKYAYVWKGATVPSTGNSPMKTGSNAGGSTVFTA
FT                   TIDLPVYDNSTGALIHIATIKKGQTYPVIRQFGENWYEVLISGRIGYVHKNGVQIAFKP
FT                   TDRYFRVTVDQLAVYDNSTGKLVQVGTLEKGQEFPRIKDYGNWHQIQFGKGVAYVWKGS
FT                   TEPSSGSSIRNANSAAPTGITFTTLVDVSVYDNSSGALVPFASIKKGVSYPVVKELGNW
FT                   YGVGVSGRIGYVHKSAVKIPFKSTDRYFEVLEDRLPVYDNSTGKLIVVAYLEKGQIFPR
FT                   LRDYGNWHEIKYGKGVAYVWKASTRPPFSVQLKNENKGLQPIDKYFLAKSDTPVYEDPN
FT                   NTKTQFAIIKQGESYPIIREENNSVVIDIGGRIGYVWKEAIQIGPIIRYTTYNLTLDDM
FT                   LNIQMQKNPQTDLYRNSPSYVHSSYVKVDKPGTFPTVGTVTATTLNVREGTSTSHWIVG
FT                   TLKAGDIVQVIRQVGDWYEIKFGPWKNAKPEDVKAYLDPSRFSRDSKEYFQFLVLSESA
FT                   GVPLNELNDKILAGKGILAGKGQAFIEAGQKYHINEIYLISHALLETGNGTSQLANGVL
FT                   VSEVDGKPVTPKVVYNMYGLNAYDSCPVRCGAEYAYKKGWFTPEAAIIGGAEDIANRYI
FT                   NNPTYKQDTLYKMRWNPANPGVHQYATDIGWAVKQVSNISSLYALLDRYTLIFDVPVYK
FT                   "
FT   sig_peptide     complement(349233..349325)
FT                   /locus_tag="GY4MC1_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.889 at
FT                   residue 31"
FT   gene            349759..350016
FT                   /locus_tag="GY4MC1_0311"
FT   CDS_pept        349759..350016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_1008 lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73156"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA5"
FT                   /inference="similar to AA sequence:KEGG:RPB_1008"
FT                   /protein_id="ADP73156.1"
FT                   /translation="MFLYAAVLKIWGWIRVWVDPQHYSTRKTEPMIMNSTPAIFFLVIV
FT                   SFNKIADKRNVQMYVIDVSGNTTVYGSCCNTIMFNIALMP"
FT   gene            complement(350146..350493)
FT                   /locus_tag="GY4MC1_0312"
FT   CDS_pept        complement(350146..350493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0312"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: membrane protein, transporter of
FT                   cations and cationic drugs"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73157"
FT                   /db_xref="GOA:A0A0F6BIA6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA6"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADP73157.1"
FT                   /translation="MNTFIQSIKKNKIGIILILLASVSTASGQMFWKLSGGQWNRHLIL
FT                   GFLFYGIGAILMTIAFRFGSLSVLHPLLSMGYVFALLLGVTFLDEHITATRAMAVVLIV
FT                   TGAVLIGGGDD"
FT   sig_peptide     complement(350407..350493)
FT                   /locus_tag="GY4MC1_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.881 at
FT                   residue 29"
FT   gene            complement(350598..351548)
FT                   /locus_tag="GY4MC1_0313"
FT   CDS_pept        complement(350598..351548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0313"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: family 2
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73158"
FT                   /db_xref="GOA:A0A0F6BIA7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP73158.1"
FT                   /translation="MKIAVLIPCYNEEKTIGKVVSDFKRELPEAEIYVYDNNSKDKTSF
FT                   IAAEHGAIVRKEFRQGKGNVVRSMFREIDADIYVMVDGDDTYPAEFVHQLIEPIKRGEA
FT                   NMVIGDRLSNGTYFQENKRPFHNFGNNLVKNLINFLYKSDIKDIMTGYRAFDKLFVKSM
FT                   PVMSPGFEIETEMSIHALDKKFLIKEVAIDYRDRPEGSESKLNTFSDGWKVLKMIFTLF
FT                   KDYKPFLFFSLWALLFFILGLAVGIPVVVEFIQTKFITRVPSAILAVGLMIFSLLSFAC
FT                   GLILDTVAAAHRKQYELELNRIYEQLRKRESNDVS"
FT   gene            352019..354313
FT                   /locus_tag="GY4MC1_0314"
FT   CDS_pept        352019..354313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0314"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; S-layer domain-containing protein; KEGG:
FT                   afl:Aflv_2606 subtilisin-type proteinase with two SLH
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73159"
FT                   /db_xref="GOA:A0A0F6BIA8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIA8"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADP73159.1"
FT                   /translation="MRNPLLFMCCLLIGFIFLFEKDVHSQSLSEWVVYFQSEKDYSLFM
FT                   EKYRDRVKDQEKEKQWAVKALFTKEEIGGIQKLSIVSKVEPNYQKSLASSFFNDPLVSQ
FT                   QWGINKIDILSVASKFQQRNMLIGKQIATAQGVMAYEGQPLPMLSFSVLSEEEMKLSRL
FT                   SATVDHVENTWTLQVTDKDGKVLAQNSGNLSTLDVLLPKNQTYKTLQIHIQANGWKKPP
FT                   VITNMTAVNHVLVAVIDTGAALHKDFCGNVLHSLGKDYVHPGRLALDDHGHGTHVTGII
FT                   AACANNHEGIVGAAGFAPVDVVPFKVLDREGTGGDFEIAKAVNDAVSMGADVINLSLAG
FT                   KGKTLVLEQAVQNALQHHVVVVAAAGNWGISLQDVYPASYPGVIAVAAVDEHNQIASYS
FT                   DYGWKLDISAPGDNILSTFINNEYRTLSGTSMAAPFVSGVAALLKATDPRLDDIQIRKR
FT                   LFESAEDIQEKGYDIHSGYGVVQAAKAIQLPYSEAVDWLTIKSGQPLSFSEKQILGISK
FT                   GLIGKDVYVFIDDQLVEKRNMDDQWLSFALPDVPSARNEKKLTVVGADHTGKVAAFDER
FT                   WVNSAASASASFSDVPSSFWAYEEIQTAYREKWINGFTDHTFRPNALLTRRHAVMMMNR
FT                   LFQWRPQQIRSPFLDTPLTLAGALPIYAAYGQRIVKGYDDGHFYPERFVTRAQMAVMLA
FT                   RALKLSEDSFSGTPYAFKDMDGSFAYYAVQQLADKGIVTKQPYFRPNEFLTRAQFAAML
FT                   ARTYQYMLDKK"
FT   gene            354445..355995
FT                   /locus_tag="GY4MC1_0315"
FT   CDS_pept        354445..355995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0315"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73160"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP73160.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
FT   gene            356052..356168
FT                   /locus_tag="GY4MC1_0316"
FT   CDS_pept        356052..356168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73161.1"
FT                   /translation="MVRKRNRGYSQKVGLDDLLRQPLYAVCLEKFVGLGLRF"
FT   gene            356249..357778
FT                   /locus_tag="GY4MC1_0317"
FT   CDS_pept        356249..357778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0317"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: afl:Aflv_2605 N-acetylmuramoyl-L-alanine
FT                   amidase containing SLH domains; PFAM: cell wall
FT                   hydrolase/autolysin; SH3 type 3 domain protein; S-layer
FT                   domain-containing protein; SMART: cell wall
FT                   hydrolase/autolysin; SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73162"
FT                   /db_xref="GOA:A0A0F6BIB1"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB1"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADP73162.1"
FT                   /translation="MQPLRLLLLCLLMFFGYSSATYAETNSSAASSQGDLQKIQDFHQP
FT                   SPFNAESASASFSAASTAKTIFADVPADHWAKKEIEFLYGRAIIQGYNENGVLRFHPNE
FT                   NVTRAQAAKMIVKALGQSEKTVTRARFKDVPPSHWAAGWIERAVENGIFQGYSDGTFQP
FT                   DAPLKRSQMSKIIALAFKLPEPGNVGNKQIFRDISPSYWAYPYIVKLYYHGISNGSENQ
FT                   FMPESYTSRAQFSAFVARALNKDFRLPVNSSPVNSSVIATGKVTADTLNVRSSGSTSAS
FT                   VIGQLSYGTVVNVLEINGYWAKISYNGKTGYVHKTYLKLKNVNGNPVQGRIIVIDAGHG
FT                   GTDPGTMNGKTYEKNIVLSVAQKVKQKLASAGAKVIMTRESDVYKTLEERVQIAKNNYA
FT                   ELFVSIHVNSASPSASGTETYYDTSKNPNGYESYLLAKAIQQQIVNNAGMKDRGVKDYG
FT                   FYVVRNNNVPSVLVELGFITNSSDYQKLTSDHYQNIFAQSIYNGIVQYYSQ"
FT   sig_peptide     356249..356320
FT                   /locus_tag="GY4MC1_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            357950..359104
FT                   /locus_tag="GY4MC1_0318"
FT   CDS_pept        357950..359104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0318"
FT                   /product="putative pyruvyl-transferase"
FT                   /note="KEGG: gtn:GTNG_3096 putative pyruvyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73163"
FT                   /db_xref="GOA:A0A0F6BIB2"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB2"
FT                   /inference="similar to AA sequence:KEGG:GTNG_3096"
FT                   /protein_id="ADP73163.1"
FT                   /translation="MKIGIIGNYGHNNNGDEAILTGILKQLIEELSIPNEDIIVFSNNP
FT                   KDTEQRYGVRAVPIFHRKGPLPFSIMKTLKENYLIMRNLDVIIVGGGGILMDLYKWDGP
FT                   LYATLGLLGHYAGCKVIVYGVGVGPIETKLGAFFIKQLSQKACCISVRDEQSKRLLQAL
FT                   GVKRNIHVIGDPALYLAAPNEKQESHFVQKVAVTAVPYYNGKYWPTSNEQKYSNYVTGM
FT                   AKNLDQLIEKKNVAVTFFSTKYPQDVQVTKDIAALMKHRDRVTIIDKNLHPNDIVSLCA
FT                   SHDLVIGTRLHSLILAVVARTPIIGIGYHPKVYHFLSLIRQTDRYVSVETLGMEPASIV
FT                   QIVEKMEKKWLDIQRETRQIAEQMKEKAGEGIELLRLSGEKHVR"
FT   gene            359127..360188
FT                   /locus_tag="GY4MC1_0319"
FT   CDS_pept        359127..360188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0319"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: mth:MTH450
FT                   LPS biosynthesis RfbU related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73164"
FT                   /db_xref="GOA:A0A0F6BIB3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP73164.1"
FT                   /translation="MYPTETAKSFGIFVKNQVEALRGRGLHVDVIAVTNPRTDKVNVLT
FT                   KYILWLLRTLIHCVTKGRNYDVVHAHYVFPTGMLGLWYKKWWKAKLVVTAHGGDIDRMA
FT                   NKSGRIRQWTTTILREADHVIAVGHKLAEQIRNEFGVPEENVSVINMGVNRRIFQPLDK
FT                   EEARKRCGIGEHEIPILFVGNIIRQKGLIELVEAFSKLKKEYHSVSLYLIGAKKDNAFY
FT                   HELIHRVKEAEINDVHILDAMQQKDVAVWMAAAEMFVLPSHLEGFGLVALEAMSCHTPV
FT                   VGSRVGGLAYLLGDGAGVLVEPGNPDSLFEGMKKLLDDAALRKQLVQKGEARAQENDQE
FT                   RIIDQILQLYDRV"
FT   gene            360253..361758
FT                   /locus_tag="GY4MC1_0320"
FT   CDS_pept        360253..361758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0320"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: drm:Dred_3098 integral membrane protein MviN;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73165"
FT                   /db_xref="GOA:A0A0F6BIB4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB4"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADP73165.1"
FT                   /translation="MNRKRLFQIIGVVTVINILSRFFGFVREVMIGYHFGTSSLADSVV
FT                   LAYTIPNFLYLVLGGAVTTAYISIFSKMANDIEKQRFHNTVFTYMLIFLLLITAGLMVF
FT                   AKPIVAFFFSGLAGSQLLMTSQLFMITAPSALFLVFSMWFSGILNAQDQFYGAAVAALV
FT                   NNGMFVLLVVLLYPFCGIYAYGWGAVASAAVMLLILFVQLRKNNLHRFQFQLVTTEPEY
FT                   IARMLKIAVPVLFGGATLQLYIFIQRMFASQLEAGYVAALNYALKFVQLPQVILMTSVT
FT                   TVIYPMLAKKTAEKDYGGISSIFFRGLKSLFMIIVPVSVFVYFYAEEMVKLIFEYGSFT
FT                   AQSTKMTAMMLKIFIIGMFAQAANLFITRFFYAMEKSFVPVATGMISVFGVNILIIKLF
FT                   IGKYGADAVAWGTTVSAIVQFLMLAVASVVQLRLQPEKEAQWLRLILYALCATIAAAII
FT                   HKYIDFHHHIANIFIGGLTFVLVSLLLLKSFRLMSFQRLPMMK"
FT   gene            362067..363134
FT                   /locus_tag="GY4MC1_0321"
FT   CDS_pept        362067..363134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0321"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: gwc:GWCH70_3047 glycosyl transferase family
FT                   4"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73166"
FT                   /db_xref="GOA:A0A0F6BIB5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB5"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ADP73166.1"
FT                   /translation="MLYLWMTLLICFVCSVVLTPIVKKLAFAVGATDKPNYRKVHQKIM
FT                   PRLGGLAIYISFLIGYAILRPWNEDWMYILLGSLVIVVIGVLDDIYELPAKIKFFGQLI
FT                   AAFIVVVIGGLQVTFINLPFGGELHFGILSIPISIIWIVGITNAINLIDGLDGLAAGVS
FT                   AIALITISGMAIIMGDWFVSSVGIIMLGSTLGFLLYNFHPAKIFMGDTGALFLGYMISV
FT                   LALLGFKNVTFISFVIPVLILGVPISDTFFAIIRRIVKKQPLSAPDKSHLHHCLLRLGY
FT                   SHRQTVLIIYGMSALFGLIAIILSQAAVWVSMIILAVVLLALELVAEKIGLVDSNYRPI
FT                   LKIVRVIRYAGGKQN"
FT   gene            complement(363240..364217)
FT                   /locus_tag="GY4MC1_0322"
FT   CDS_pept        complement(363240..364217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0322"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: gwc:GWCH70_3046 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73167"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB6"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADP73167.1"
FT                   /translation="MVDERTTINGRKRYKKKKKKKRRRRILFGLFMLSLLLLVSSLGYA
FT                   SFLLHKAESVMNKSYEMLRYDNAESLDPKKDNFSVLFIGVDDSRTRNFQKDTRSDALIL
FT                   ATFNAKDQSVKMVSIPRDSYVYIPCEDKYDKITHAHAYGGVKCTVETVENLFDIHINYY
FT                   VKMNFYAFMDVVDALGGIEVEVPYNIKEKDSEDHHNAIVLKKGLQKLNGEEALALARTR
FT                   KKDNDIERGKRQQEILKAILKKASQASSITKYDDVIEAVGNNMKTNFTFDQIKSLVYYV
FT                   VSNKNLSIESLHLTGTDSNDGVYYYMLDEQSVQEISETLQNHLR"
FT   sig_peptide     complement(364062..364217)
FT                   /locus_tag="GY4MC1_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.517 at
FT                   residue 52"
FT   gene            complement(364245..364880)
FT                   /locus_tag="GY4MC1_0323"
FT   CDS_pept        complement(364245..364880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0323"
FT                   /product="Uncharacterized protein family UPF0029, Impact,
FT                   N-terminal"
FT                   /note="PFAM: Uncharacterised protein family UPF0029,
FT                   Impact, N-terminal; Uncharacterised protein family UPF0029,
FT                   Impact, C-terminal; KEGG: gwc:GWCH70_3045 protein of
FT                   unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73168"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB7"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ADP73168.1"
FT                   /translation="MLQKYYTVKGYGENEIVIEKSRFICYINRATTEEEAVQFIQQIKK
FT                   KHWDATHNCSAYIIGEHDQIQKANDDGEPSGTAGIPMLEVLKKKGLKDTVAVVTRYFGG
FT                   IKLGAGGLVRAYGKSVSEGLKAAGIVERRLTRVMHVTIDYTWLGKVENELRSSDYTIKD
FT                   IHYSENVEMEIFVEETEKQTFVDWMTELTNGRAEIREGETEYLEIDVP"
FT   gene            365106..366251
FT                   /locus_tag="GY4MC1_0324"
FT   CDS_pept        365106..366251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0324"
FT                   /product="DegS sensor signal transduction histidine kinase"
FT                   /note="KEGG: gwc:GWCH70_3044 sensor DegS domain protein;
FT                   PFAM: Sensor DegS domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73169"
FT                   /db_xref="GOA:A0A0F6BIB8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008595"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016381"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB8"
FT                   /inference="protein motif:PFAM:PF05384"
FT                   /protein_id="ADP73169.1"
FT                   /translation="MSANKNLNVKELDKIVEKMIDTVQHSKDEIFRIGEQSRQEYEWMV
FT                   KELAEVKAAIHRTIEEADKLEVQTRRSRQRLSEVSRNFASHSENEIREAYEKAHELHME
FT                   LAMVREREKQLRLRRDELERRLIGLKETIERADHLVGQVTVVLNYLTSDFRQVGEFIEG
FT                   ARRKQEFGLKIIEAQEEERKRLSREIHDGPAQTLAHVIIRSDLMEKVLKDRGIEAAISE
FT                   IRDFKKMVRSALYEVRRIIYDLRPMALDDLGLVPTLRKYLQTVEDYSKGIDISFVHIGK
FT                   EMRLPPRLEVAVFRLVQEAVQNALKHAEATKIEVKTEMCSGQLLVMVKDDGKGFDTTMK
FT                   KENAFGLMGMKERVDLLEGTLTIRSKIGAGTTIFIRIPLNI"
FT   gene            366284..366964
FT                   /locus_tag="GY4MC1_0325"
FT   CDS_pept        366284..366964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0325"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: gwc:GWCH70_3043 two component transcriptional
FT                   regulator, LuxR family; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; SMART: response regulator
FT                   receiver; regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73170"
FT                   /db_xref="GOA:A0A0F6BIB9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIB9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP73170.1"
FT                   /translation="MKTRIAIIDDHQLFREGMKRILEFEEEFEVVAEGADGSEALAIVE
FT                   QHRPDIVIMDINMPNTNGVEATRQLVEMYPDTKIVVLSIHDDENYVMRALQMGATGYLL
FT                   KDMDADTLIEAVKIVAEGGSYLHPKITHNLIREYRRLSAGKNEKEGEGKREARWPLHLL
FT                   TRRECEVLQLLADGKSNRGIGEALYISEKTVKNHVSNILQKLNVNDRTQAVIVAIKNGW
FT                   VEVR"
FT   gene            367066..367911
FT                   /locus_tag="GY4MC1_0326"
FT   CDS_pept        367066..367911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0326"
FT                   /product="degV family protein"
FT                   /note="KEGG: gwc:GWCH70_3042 DegV family protein; TIGRFAM:
FT                   degV family protein; PFAM: DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73171"
FT                   /db_xref="GOA:A0A0F6BIC0"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC0"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ADP73171.1"
FT                   /translation="MKTAIVTDSTAYIPKDVRDRLRIRMIPLSVAFGGETYREEVDISA
FT                   EQFFEKIKQHKELPTTSQPAVGEFVELFTSLREEGYDAVISIHLSSGISGTYQGALTAG
FT                   NMVDGLNVYAYDSEISCMAQGFYAIEAAKMALDGKTPEEIIARIDEMKKTLRAYFMVDD
FT                   LAHLQRGGRLTGAQAFIGGLLQIKPLLHFENKVIVPFEKIRTRKKAIKRIEELLAEDAA
FT                   KGVPLKAAIIHANRPDEAEQWKQQLSSLYPNVEFSISYFGPVIATHLGEGALGLTWYQP
FT                   "
FT   gene            368182..369678
FT                   /locus_tag="GY4MC1_0327"
FT   CDS_pept        368182..369678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0327"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: gwc:GWCH70_3041 helicase domain protein; PFAM:
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73172"
FT                   /db_xref="GOA:A0A0F6BIC1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC1"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADP73172.1"
FT                   /translation="MRFIVDKGRLIPEALAKTGKNAKPISHIDFTSSLQPTPGFPYSPE
FT                   LLSFLEGRQLLLEELPFSLHLIQTHYEHGYLFYEKGIVKTKHGWRCIRCGNEDGRFFAS
FT                   FPCARCHTVCTYCRKCIMMGRVSECTPLVASRFSFPQPRYLSPLSWNGTLSKGQQRAAG
FT                   AVEDAIVQNSELTVWAVCGAGKTEVLFQGIARALEMGKRVCIATPRTDVVRELAPRLRL
FT                   VFPGVPLIALYGGSEDRGKSAPLVISTTHQLLRFYRAFDVMVIDEVDAFPYSVEPMLEY
FT                   AAAKARKAESSLIYLTATPHPAWQRDIRRGKRKAVTIPARYHGFPLPVPSFEWCGNWRR
FT                   QLKRGRLPRNVAAWVLSRMETKKQAFLFVPQIDVLEQVVHIVKQWHERVEGVHAEDPER
FT                   AEKVQAFRDGRIPLLVTTTILERGVTVPNIDVAVLGAEDDIFTESALVQIAGRVGRSVQ
FT                   HPDGDIRFFHYGKTRGMVAAKRQIERMNKEAAERGLLRTQ"
FT   gene            369675..370382
FT                   /locus_tag="GY4MC1_0328"
FT   CDS_pept        369675..370382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0328"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   gwc:GWCH70_3040 late competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73173"
FT                   /db_xref="GOA:A0A0F6BIC2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC2"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADP73173.1"
FT                   /translation="MNCLLCHTPYNPITSWQHFLTLKKADCLCAKCRNALLKIAGDICD
FT                   ICGRPSAGLKPSHQQKRLCADCIRWQADDEWKDVLTKNRSVYMYNDFMKEVVALWKFRG
FT                   DYAVVQAFQDEFCREFYRHFDNTFLIVPVPLSAERLFERGFNQAKALAELLALPIHELL
FT                   CRRHLEKQSKKSRLERLRTENVFRLSEQTSLQGKPIVLIDDIYTTGTTLRHAAKVLLKA
FT                   GAASVSSLTLARG"
FT   gene            370443..372359
FT                   /locus_tag="GY4MC1_0329"
FT   CDS_pept        370443..372359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_3039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC3"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3039"
FT                   /protein_id="ADP73174.1"
FT                   /translation="MQVRNDFIMSEPAPFSLKEGETFFATVKEKLSNDEAIITVKGQDV
FT                   HVRFQGEIPKEDKVVVRIVGIKDHVLQVQAVPKAAETNGPAAGLFPAGELEKAEQILLA
FT                   QGIRLSKEEKAILRRFFEKAKGTLNEKLETVQALANKKLEVAESHLQAIHEALHGDSFG
FT                   ETLAQLADHLALLPSLRSSVENSLQALMGNGLQTSAEDNLQDWKENNHDFVSNGAKVFH
FT                   SPAETDLMEEQEIPQKNQSAETAESQQTESTYWNEEWMQAFPAPAKNIIVKTITEKLSQ
FT                   AALDFKKLQIEMNKKLENAAFLLDNGQTSARQQAKQLVEAVIRTLDRAILQGEFMLFTD
FT                   MKTEKQMLQASAKLAEAKQLLTEGKQSDALKAVKEVKHLLEGLRFQPADVKVKHFVSAH
FT                   PFSGEDPEAAPKQQLLPQLARILKFPLGEEVSARNTFEQFRQLGFHHEKDVFHALLSKQ
FT                   VAREPQNIKALLLKLSQGEFGVIAAQAEHAVANMTGQQLLSKFDAGNHMQTMFYQVPVL
FT                   LHDQMETVRIYLNARNDGGKLDWQNCSLYFLLDTEKYGKIGILLQALERDLTVTIKTDS
FT                   EKLTEALKALTETAKENLEEIGYNVKGITFAKLNHKYEEEKTAAETRKADERNSGKGYD
FT                   WKV"
FT   gene            372356..372601
FT                   /locus_tag="GY4MC1_0330"
FT   CDS_pept        372356..372601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_2591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73175"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC4"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2591"
FT                   /protein_id="ADP73175.1"
FT                   /translation="MKNGYQHFSALASYQSGADQLTEPKIHTVNEIIKQAQQQRIPMQG
FT                   DSALVKHLVDPENRVPSQLYAVIGEILKLIKNIERQ"
FT   gene            372613..373050
FT                   /locus_tag="GY4MC1_0331"
FT   CDS_pept        372613..373050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0331"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   gwc:GWCH70_3035 protein of unknown function DUF327"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73176"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC5"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADP73176.1"
FT                   /translation="MEIRKITNANMVNVSKKEAAASPSVSFAEVAAKQNEELALERFRQ
FT                   LAKEIEEQGKKLAESSSVEDLRKYKRLVKKLLDDAVQNGLRLSEQHGFNWSGRSRLYKM
FT                   VKEVDKKLIDLTNAVLQKEKQGIDLLGTIGEIQGLIINIYT"
FT   gene            373104..373517
FT                   /locus_tag="GY4MC1_0332"
FT   CDS_pept        373104..373517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0332"
FT                   /product="Flagellar operon protein YvyF"
FT                   /note="TIGRFAM: Flagellar operon protein YvyF; KEGG:
FT                   afl:Aflv_2587 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73177"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC6"
FT                   /inference="protein motif:TFAM:TIGR03826"
FT                   /protein_id="ADP73177.1"
FT                   /translation="MNLANCPNCGRLFVKTSFRDICEDCYKEEEEAFEKVYHFLRKREN
FT                   RMATMAQIVDATGVKESLLIKFIQSGRLKLAQFPNLTYPCARCGALIRQGKLCENCLKD
FT                   LNQQLEELQKEERKKRRQAENIYYTKRNDENKF"
FT   gene            373609..373872
FT                   /locus_tag="GY4MC1_0333"
FT   CDS_pept        373609..373872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0333"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="KEGG: gwc:GWCH70_3033 anti-sigma-28 factor, FlgM;
FT                   TIGRFAM: Anti-sigma-28 factor FlgM family protein; PFAM:
FT                   Anti-sigma-28 factor FlgM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73178"
FT                   /db_xref="GOA:A0A0F6BIC7"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC7"
FT                   /inference="protein motif:TFAM:TIGR03824"
FT                   /protein_id="ADP73178.1"
FT                   /translation="MRIDKFGLPGINPYKRQFDKETQVKKNAIKQDKVEISAAAKELQQ
FT                   LSQWTVEHQEKVRKLKEQVQNGTYKIDAKEIAKSVYRFYFDN"
FT   gene            373936..374418
FT                   /locus_tag="GY4MC1_0334"
FT   CDS_pept        373936..374418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0334"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: bsu:BSU35420
FT                   putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73179"
FT                   /db_xref="GOA:A0A0F6BIC8"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC8"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ADP73179.1"
FT                   /translation="MSAKQLIELLENHVKLHKGLLELANKKTEVLKKGDTEALNEIVKE
FT                   EQKYIAAIGRVEQERIRVVHAMIGEADEPTLTACILQTEGTERAMLEKLQDDLSAVLSE
FT                   LKNVNQLNEQLAKQSLQFVHVMLNMLMPQPKEVNYRKPNVAPSSYEGGSSLFDSKA"
FT   gene            374455..376059
FT                   /locus_tag="GY4MC1_0335"
FT   CDS_pept        374455..376059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0335"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: gwc:GWCH70_3031 flagellar hook-associated
FT                   protein FlgK; TIGRFAM: flagellar hook-associated protein
FT                   FlgK; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73180"
FT                   /db_xref="GOA:A0A0F6BIC9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC9"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ADP73180.1"
FT                   /translation="MLSTFHGLEVAKRGMFTQQAALYVTAHNIANANTPGYSRQRVNFV
FT                   ETEPFPPASMNRPQIPGQMGTGVEAGSIQRIRDSFLDYQYRNEASKLGYWSARSEAIAK
FT                   MEDIMNEPSEFGLSKAMTQFWESLQDLSANPENEGARAVVRQRGIAVAESFNYLYTSLS
FT                   QIRDDLGQEIKTGLLEVNSILKQISELNDQIKAVEPNGYLPNDLYDKRDALVDELSKYF
FT                   QVKVETVPSGGNALDIAEGIYEISLVNQDGSTVKIVTKDGYSKLSVDPPVDPVNDPTNP
FT                   DGYVSEIRIEDALGNITTISYDKFNDLASGRIKSLIESYGYGSDPNNVKGYYPEMLADL
FT                   DKMAYSFATMFNAQHREGYDLNNSNGVDFFEMNVSDNTTGKGAAASIKVSDVIMSDLGK
FT                   IAASSNSEESGNGNNALYLSMIKDVQITNGSAALPSGSGTTVSVPITSGTVQTFYQGLI
FT                   GKIGVDGQQAERMKTNAETLATSVDNKRQSVSSVSLDEEMTNMIKFQHAYNAAARMITA
FT                   IDEMLDKIINDMGIVGR"
FT   gene            376070..376966
FT                   /locus_tag="GY4MC1_0336"
FT   CDS_pept        376070..376966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0336"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: gka:GK3136 flagellar hook-associated protein
FT                   FlgL; TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73181"
FT                   /db_xref="GOA:A0A0F6BID0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID0"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADP73181.1"
FT                   /translation="MRVTQFMLANNMLRNLSNSYERLGKYQEQLVTGKKISRPSDDPVV
FT                   AMKGIAYREDLARVKQYQRNIGEVHNWIDSADDALDKVGLALQRVQELVVQASTDTATP
FT                   EDRKKIADEIDQIQKHIVDVANTKVGGKYIFNGADTKNPLFIGYPDGMGGLGLNPNANT
FT                   SDVEIEVFDGIKLDVNIDGKTLFTGIIEMLDNLKTVLNDPNSTGNTISSHLSQVEAQQD
FT                   ALLAARSELGAKQNRVEMMENRLSTQEVIATKLMSNNEDIEYEKTITDLITQESVHRAA
FT                   LSVGARIIQPTLVDFLR"
FT   gene            376989..377543
FT                   /locus_tag="GY4MC1_0337"
FT   CDS_pept        376989..377543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_1153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID1"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1153"
FT                   /protein_id="ADP73182.1"
FT                   /translation="MNFPQIQIRTTKAILGLNIEKPIQHIKQPKADLSIEQKPATLTID
FT                   SKPARLTIDQSKAWSDMGLLDPFDSTRKLAEEGREALLEGIARRAQEGDQLMKIENGGN
FT                   AIAAIAAEKGFHSYKQLGIKFIPSVHSVDIGYQPGYLDIKVDANKPIIEANVNRPIHEY
FT                   KPGNVSAYMIQYPSIKIDVKY"
FT   gene            377608..378051
FT                   /locus_tag="GY4MC1_0338"
FT   CDS_pept        377608..378051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0338"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   lsp:Bsph_1154 flagellar assembly factor FliW"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73183"
FT                   /db_xref="GOA:A0A0F6BID2"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID2"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ADP73183.1"
FT                   /translation="MKITSKFLGEIEINEKQIIHFPNGIPGFEEEKQFVILPLEEQSPF
FT                   AILQSIHHSHVGFVIAYPFSFYPDYAFDLTEEDIEKLKLNSPDDCLTYTIMTLKEPFAD
FT                   STINLKAPIVINVKEKIGKQLILHDSVYPIRFPLSEARGKEGK"
FT   gene            378051..378278
FT                   /locus_tag="GY4MC1_0339"
FT   CDS_pept        378051..378278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0339"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="KEGG: bpu:BPUM_3186 carbon storage regulator;
FT                   TIGRFAM: carbon storage regulator; PFAM: carbon storage
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73184"
FT                   /db_xref="GOA:A0A0F6BID3"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID3"
FT                   /inference="protein motif:TFAM:TIGR00202"
FT                   /protein_id="ADP73184.1"
FT                   /translation="MLVLTRKKNESIMIGDSIEIKVLAIEGEQIKLGIIAPKHIDVYRK
FT                   EIYTAIQEENKQAADVSTNLLRQLKNNKKN"
FT   gene            378402..379214
FT                   /locus_tag="GY4MC1_0340"
FT   CDS_pept        378402..379214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0340"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: lsp:Bsph_1156
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73185"
FT                   /db_xref="GOA:A0A0F6BID4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID4"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADP73185.1"
FT                   /translation="MRIQHNISALNTYRQLSFNNTQAAKNLEKLSSGYRINRAGDDAAG
FT                   LAISEKMRGQIRGLEMASKNAQDGISLIQTAEGALNETHAILQRMRELAVQAANDTNVT
FT                   ADRKAIQDEINALVSEINRIAANTEFNTQKLLDGTFSGKAFQIGANSGQSITLTIATMN
FT                   ATALGVNALKVTNAASANNAITKINNAIEKVSTERSKLGAVQNRLEHTINNLGATAENL
FT                   TAAESRIRDVDMAKEMMEFTKNNILMQAAQAMLAQSNQMPQGVLQLLR"
FT   gene            complement(379672..380532)
FT                   /locus_tag="GY4MC1_0341"
FT   CDS_pept        complement(379672..380532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0341"
FT                   /product="LAGLIDADG DNA endonuclease"
FT                   /note="KEGG: LAGLIDADG DNA endonuclease; PFAM: LAGLIDADG
FT                   DNA endonuclease; SMART: Myb DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73186"
FT                   /db_xref="GOA:A0A0F6BID5"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID5"
FT                   /inference="protein motif:PFAM:PF03161"
FT                   /protein_id="ADP73186.1"
FT                   /translation="MQEFLQLTPIQQNILIASIIGDGEITKLYKSRRKNHSYREHFSKQ
FT                   QEEYRKWKISFFDGLLYITHKSCCVRSPSMSLFTKLYPYFYDHNGSKHLPTSLLSYCTL
FT                   PHFLSILYMDDGSLCISARVNAQKKKIYLTPHIYLYLQCYSPNELELLKQHILEVFGIT
FT                   FRLSSRTDGQGFILKTTSVKDTFRFLEMIFPITQDCLSMHYKTNWQKRLQQEELKWKNH
FT                   FPEFSIVISNSERTKPYSHEEIQRLKEMKKQGFTINEIAEALQRSYWSVVYKWKEIKKT
FT                   FSHFE"
FT   gene            complement(380825..381073)
FT                   /locus_tag="GY4MC1_0342"
FT   CDS_pept        complement(380825..381073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0342"
FT                   /product="LAGLIDADG family DNA endonuclease"
FT                   /note="KEGG: afl:Aflv_2576 LAGLIDADG family DNA
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73187"
FT                   /db_xref="GOA:A0A0F6BID6"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID6"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2576"
FT                   /protein_id="ADP73187.1"
FT                   /translation="MNHTDILLYNYDHKLLEMLTGNLLGDGNIIIQKNRKPRFRFGHSI
FT                   KDRDWCVHCYQKLAYFLPLNPPKYRRVIDSRIKGGFS"
FT   gene            381209..382993
FT                   /locus_tag="GY4MC1_0343"
FT   CDS_pept        381209..382993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0343"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   lsp:Bsph_1157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73188"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID7"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADP73188.1"
FT                   /translation="MDNELKEYEIVEETAKSGHRIYKVNNYYLHSKYDPIREAAKFAER
FT                   HYKKNHLHILFGVGSGYIAKALSEKMTEEEFLIIVEPIEFLADKHLEEESQLERCIIIK
FT                   GEDQELFEKIYEPFGNTFGKRVSVVCSPNYDKICSSYYHSILKIVKDHIYMQQVNINTI
FT                   KYFSKEWQKNFTLNLFYAYDDVPLKCLEHIYNVPVVVASGGPSLTKQIPLLKKVRNHIL
FT                   LISSGSTINTLLKHDIEPDFIVTIDGGINNYRHFETIELKQARIIYSLSNHEKIRERFN
FT                   RRSLVFISNIDDDLKIYAQKLLNKEIDGILGGASVANFALNIAYMISTGPVALIGQDLA
FT                   YTDNKTHAEHNKNFRKIDETYIKQRGLFYTEGYYGGQVLTDYTFFTMKHNFERLLQTFS
FT                   QPERIYNCTEGGVKLEGYQQLSFQEFCDRYVDTNKNVPMFDIDSYPHRDIQEWEEFLIR
FT                   IENEIRLHDKVQRLAEEAVLLLKRNVSDTAFDAKILKKLDKIDEQLKPIFDEGMMSLIA
FT                   QPIVLDTFNNYLEKENETEQEMYQRVYARSMDLYSRLQEAAIDSKSYFMQLKEKIKNKI
FT                   ISMDKREKDDESHLRNTR"
FT   gene            382962..383324
FT                   /locus_tag="GY4MC1_0344"
FT   CDS_pept        382962..383324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_1158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID8"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1158"
FT                   /protein_id="ADP73189.1"
FT                   /translation="MMNLIYETQDSFYQYIERVASGTQTIADYLREDKVGEAMQLIAQF
FT                   SEGVAWLTKVIVLMREHKYHINIDPSQINEFLLEINDGLERQDYVIVADMFEYEIKPFF
FT                   EEATKERFYQMKEDKN"
FT   gene            383321..384688
FT                   /locus_tag="GY4MC1_0345"
FT   CDS_pept        383321..384688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0345"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   lsp:Bsph_1159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73190"
FT                   /db_xref="GOA:A0A0F6BID9"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID9"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADP73190.1"
FT                   /translation="MSVLDRNLALIKNKQLRERLLHPINEPIDVDIHPSKKGPPTMKLN
FT                   GHYLYSRYDPLKDAERFIDSQIDRDAHVYCLFGFGLGYHVQELLQKEPDKQIVVIEPYL
FT                   SVIRKAAENIDLSNIFLHPNVEILCFEQGQAMIRTLNELAKQQTRWIIPNAWLKAMPQS
FT                   HPLKRFLEDIKIQEMSFQRFSSLMEKNFAENLKYMDADVGKLFAKFNGQKAVLVSSGPS
FT                   LDDTVYSLKWLKNKYFILSVGSALRVLKENSIVPDAVIITDPQEFVYKQLDGMGFAQTL
FT                   IYLSTACHSAVANHKGLRIIAFQKGYPQAESYAGKKKLPLVDTGGSVATTALDILIKMG
FT                   FSEIVLLGQDLAYSKNRSHALHSTSGVEVVSNENLLSVLANDGTMVKTTTILSIYRRWF
FT                   ARKVAETKHVIFKNTAEKGAVIQGMPFVHISEIISESEHLMECNFSEKINQIINQY"
FT   gene            384724..385698
FT                   /locus_tag="GY4MC1_0346"
FT   CDS_pept        384724..385698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0346"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /note="KEGG: bph:Bphy_3011 polysaccharide biosynthesis
FT                   protein CapD; TIGRFAM: UDP-N-acetylglucosamine
FT                   4,6-dehydratase; PFAM: polysaccharide biosynthesis protein
FT                   CapD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73191"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE0"
FT                   /inference="protein motif:TFAM:TIGR03589"
FT                   /protein_id="ADP73191.1"
FT                   /translation="MEFLRNQTILVTGGTGSFGKKFVKKILEYDVKKVIVFSRDELKQY
FT                   EMAQEYTDPRIRFFIGDVRDKDRLYRAFDGVDYVVHAAAMKQVPACEYNPFEAVKTNIY
FT                   GAQNVIEAAIDRGVKRVIALSTDKAAAPINLYGATKLASDKLFVAANSYVGGKETRFAV
FT                   VRYGNVVGSRGSVVPLFKKMAAEGKKLPITDERMTRFWITLDQGVQFVIDSLTRMKGGE
FT                   IFVPKIPSMKVVDLAKAIAPEAEIEIIGIRPGEKLHETMITEDDARHTVEFDNYYVITP
FT                   EFPWCPQEYVKHGRSLPEGFKYTSDTNTEWLTVEELRTLVEEV"
FT   gene            385813..386131
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0347"
FT   gene            386351..386515
FT                   /locus_tag="GY4MC1_0348"
FT   CDS_pept        386351..386515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_1353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73192"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE1"
FT                   /inference="similar to AA sequence:KEGG:Athe_1353"
FT                   /protein_id="ADP73192.1"
FT                   /translation="MQERFHCTRDFAKIPKNNEKIILTIVKTYMISIPSIWRLGSNDRI
FT                   ILIDGDKYI"
FT   gene            387040..387588
FT                   /locus_tag="GY4MC1_0349"
FT   CDS_pept        387040..387588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0349"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: pab:PAB0773 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73193"
FT                   /db_xref="GOA:A0A0F6BIE2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE2"
FT                   /inference="similar to AA sequence:KEGG:PAB0773"
FT                   /protein_id="ADP73193.1"
FT                   /translation="MKPKDVYIHNSAEVSSKASVGKGTKIWNGVQIREGAIIGENCNIG
FT                   KDVYIDKNVIIGNCVKIQNGVSIYDGVEIEDYVFLGPHMTFTNDLYPRSFNTEWRKIPT
FT                   KVRYGASIGANATVVCGVTIGKYAMVGAGAVVTQDVPDHALAVGNPAKVIGYVCKCGQP
FT                   IHYGECCKKCGEVFTGGNE"
FT   gene            387581..388549
FT                   /locus_tag="GY4MC1_0350"
FT   CDS_pept        387581..388549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0350"
FT                   /product="oxidoreductase domain protein"
FT                   /note="KEGG: lbf:LBF_3263 oxidoreductase; manually curated;
FT                   PFAM: oxidoreductase domain protein; Oxidoreductase domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73194"
FT                   /db_xref="GOA:A0A0F6BIE3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADP73194.1"
FT                   /translation="MSKNMKRYSEVLNVGVVGLGQMGKNHVRVLSQIGVLNVVYDISQH
FT                   LTQKVAEQYNVIPATSMDELIELSDAVFVVTPTSTHFDLAKQVLMQNKHVFIEKPITLT
FT                   VEEARELILLAQKNKRILQIGHIERFNPVVMELKKIIQNDQVISVDIKRLSSYDARIKD
FT                   TDVIFDLMIHDLDLLYYLFNEEIQVKGVLKKSIHRPELADHVSVLAETLSGIMITVTSS
FT                   RVTEEKIRSISITTLRSYIHADYLTRNIYIHRRTNLKTQFEEATYRQENIVEKVYVPNY
FT                   EPLYLQNYHFVEAVVSESDPIVSGWDGLRAIQLAQQIQDYS"
FT   gene            388577..389749
FT                   /locus_tag="GY4MC1_0351"
FT   CDS_pept        388577..389749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0351"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cbi:CLJ_B2933 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73195"
FT                   /db_xref="GOA:A0A0F6BIE4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP73195.1"
FT                   /translation="MKKPTISVIMPVYNGEKYLAEAIDSVLSQTFDGFEFIVVNDGSTD
FT                   RTAKILEKYRIEYPWIKIVTLEVNQGISKAINVGLAHANAEYVCFVAADDIQYPNRLED
FT                   SYREMVLKKLDILMFEFDMIDDTGNPLGRSMRIPNFLTETNILLEEFKRNYFFSGACLI
FT                   KFDPKIQFDTNLRTSEDYDWFLRMLMADKKVGFLRKSLLQVRVHKGSLSSNHSYSYEAT
FT                   KYILNKYDFDSLFHFFKIRGFREGEIWLTFAIMCITKEEPYNGLDFIAKIQLEQLNDYE
FT                   LFCKYFYEGVLHGMVDRWDYAYECFNKSSKMKYKNAAVYNNLAVATYWVNRDTSLVTKL
FT                   LQEALLYQPQYFDASENLKIINNAKEIKQLQFTKRLLRDQIIQGDKELIK"
FT   gene            390167..391279
FT                   /locus_tag="GY4MC1_0352"
FT   CDS_pept        390167..391279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0352"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: tth:TTC0284 pleiotropic regulatory protein;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73196"
FT                   /db_xref="GOA:A0A0F6BIE5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE5"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ADP73196.1"
FT                   /translation="MPELIPVFDLKSEINIIYDEVLESIQEVLKSGQFIMGEQVAAFEK
FT                   EVADYLGVRHAIGVNSGTDALVIGLRSVGIGKGDEVITTPFTFFATVEAIHQIGAVPKF
FT                   VDIENCTFNIDSRKIEEAITSKTKAILPVHLFGHAAEMRTIMDLAKAYDLKVVEDTAQA
FT                   FGGEYHGQKLGTIGDVGCFSFFPTKNLGAYGDGGLIVTNDDNVAEIARKLRVHGGKNKY
FT                   NNEMFGYNSRLDEIQAAILRIKLRYVQSWNEKRRKVAKIYSERLKEISNLVLPMEKGGI
FT                   KHVYHQYTVRIVNGNRDNIYEQLLARHVQTMIYYPLPVHHLPVYRAQNIDLNLPVAESI
FT                   SKQVLSLPIWPHIEDKQVEYVCNTLQSLLS"
FT   gene            391312..391989
FT                   /locus_tag="GY4MC1_0353"
FT   CDS_pept        391312..391989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0353"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: gyc:GYMC61_3213 haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73197"
FT                   /db_xref="GOA:A0A0F6BIE6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE6"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADP73197.1"
FT                   /translation="MRYQGFIFDMDDTLYCEYDYVYSGFKVVSKLIAQSQKKITDNIVY
FT                   QYLIDEWKRNGRGKVFNKVCEKLGIDIDISYLVEAYRYHKPTIQMYDDAKKLLLYLKHK
FT                   KVQTGLITDGHPVAQYNKIKSLGLKKWIDCIIITGILGEEYYKPSEVPYKIALNSLGLE
FT                   AKQCVYIGDNPYKDFITAKKLGIKTIRVIRPIGDYMHVKLSSEFEADIVVYSLTDIMKM
FT                   NII"
FT   gene            392058..392975
FT                   /locus_tag="GY4MC1_0354"
FT   CDS_pept        392058..392975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0354"
FT                   /product="protein of unknown function DUF201"
FT                   /note="KEGG: gyc:GYMC61_3212 protein of unknown function
FT                   DUF201; manually curated; PFAM: protein of unknown function
FT                   DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73198"
FT                   /db_xref="GOA:A0A0F6BIE7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE7"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADP73198.1"
FT                   /translation="MRKASLKFQKTKGLATPPLIFGSDIDAECIGRYFVDYFWQMTEID
FT                   CLSIQKFIEYCKEHDIFAVIPTRDGDLLYFSKYADLLADNGIRVMVSQEETVQCSIDKL
FT                   KFSKKLLSLGFPSIPTFENIEDLKEIHYYVVKERFGAGSKGIGLRLTKQQALRHGLNLQ
FT                   NPIFQPYIDGKEFSIDLYVSLNRKVHGIITRTRDYVINGESHISTTQREKKLEDLCTRL
FT                   ALDMGFYGHIVIQVIKDKKGDYHIVECNSRFGGASTLSIEAGLDSFYWFFLESIGESLI
FT                   KYPFNRSKEEKRLIRFVDDLIIDV"
FT   gene            393017..393739
FT                   /locus_tag="GY4MC1_0355"
FT   CDS_pept        393017..393739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0355"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   gyc:GYMC61_3211 acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73199"
FT                   /db_xref="GOA:A0A0F6BIE8"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE8"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ADP73199.1"
FT                   /translation="MKNIIIIQARMGSSRLPGKILKPLGDHDVLTYVVERCKKIKGVSD
FT                   VIVATSTLSQDDKVEDWCKRHGVSFFRGSEEDVLDRYVQCAKIYEPDYVMRVTADCPFV
FT                   DFEMANEIVKLMEQEKVDIIDLDGELPRGLAVELISYQALQYIHQHGHEPRHREHVTYY
FT                   AYEFREKFQRASYSVPVNRQHPELRITLDTEEDYALCKAVADYFKDPLVSSADVINFLL
FT                   KHPEIANLNKHVQQKPVV"
FT   gene            393748..394788
FT                   /locus_tag="GY4MC1_0356"
FT   CDS_pept        393748..394788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0356"
FT                   /product="pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /note="TIGRFAM: pseudaminic acid biosynthesis-associated
FT                   protein PseG; KEGG: gyc:GYMC61_3209 pseudaminic acid
FT                   biosynthesis-associated protein PseG"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73200"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE9"
FT                   /inference="protein motif:TFAM:TIGR03590"
FT                   /protein_id="ADP73200.1"
FT                   /translation="MNILIRTDASMQIGTGHVMRCLTVAHEMRKRGHQTTFAMRNLQGH
FT                   LAAVVEKQGFHVEMLQYEGDFQFEKDVMEVQQLFLRQDYDICVIDHYRIDEKWEKMIRP
FT                   FVKKLIVIDDLANRSHDCDILLDPNVVNNYEHRYDHFVPKHCKKLLGPKYLILREEFTK
FT                   IREKIRPREGVVRNLLIFMGGSDPTGETLKVMKAFESFDGSFHHVDVVVGQANPDKEVV
FT                   RTYCEKFGFAYHCQIDYLASLMAKADFSIGAGGSTMWERCYVGLPSSSTIVADNQIETT
FT                   KMAAQLGVVINLGWHEEVTSKAYEKLLYQIIEQKENIQKMSIKGLQLTENPDGPNPWVT
FT                   PMLEMW"
FT   gene            394793..395839
FT                   /locus_tag="GY4MC1_0357"
FT   CDS_pept        394793..395839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0357"
FT                   /product="pseudaminic acid synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="SMART: SAF domain protein; TIGRFAM: pseudaminic acid
FT                   synthase; KEGG: gyc:GYMC61_3208 pseudaminic acid synthase;
FT                   PFAM: N-acetylneuraminic acid synthase domain; SAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73201"
FT                   /db_xref="GOA:A0A0F6BIF0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF0"
FT                   /inference="protein motif:TFAM:TIGR03586"
FT                   /protein_id="ADP73201.1"
FT                   /translation="MIQIGNRKIGKSEKPFIIAEMSGNHNQSLERALKIVDLAAEAGVD
FT                   AVKLQTYTPDTMTLDIHTGEFFIKSETNLWKGQSLYNLYKEAYTPWEWHEAIFERCKKH
FT                   GLLAFSSPFDETAVDFLETLNVPAYKIASFENIDIPLIKKVAATGKPVIISAGMATVAE
FT                   LYEAVQAVRSEGNDQIILLKCTSTYPATPENSNLATIPHMRELFGVEVGLSDHTMGIGT
FT                   AVAAVALGATVIEKHFTTSRAEGGVDAAFSLEPHEMKMLVEETERAWLSLGMIHYGPTN
FT                   AEKPSLEHRRSLYVTEDLKAGDIITKENVRAIRPGRGLPPKYYDLVLGKAVKKDVKKGT
FT                   PLSWDILL"
FT   gene            395854..396999
FT                   /locus_tag="GY4MC1_0358"
FT   CDS_pept        395854..396999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0358"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /EC_number="2.6.1.50"
FT                   /note="TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase; KEGG: gyc:GYMC61_3206
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73202"
FT                   /db_xref="GOA:A0A0F6BIF1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF1"
FT                   /inference="protein motif:TFAM:TIGR03588"
FT                   /protein_id="ADP73202.1"
FT                   /translation="MKKRESFLSYGQQWITDEDIEAVVTVLKSPFLTQGPKIHEFERKV
FT                   ADYVGAKYAVAFSNGTAALHGACFAAGIGEGDEVITTPITFAATSNAVLYCGGKPVFAD
FT                   IDDRTYNIDPKEIRKHITPNTKAIIPVDFTGQPADMDAIMEIANEHGLVVIEDGAHSLG
FT                   AEYKGRKVGMLAHMTMFSFHPVKPVTTAEGGVIVTDSEEYYEKLKRFRSHGIIKHNLSR
FT                   DEGPWYYEMVDLGYNYRMTDLQAALGISQMDKLDCFIERRREIANMYNEAFKTMDSVIV
FT                   PMQLERTQSGWHLYVLQLKLDKLKRSRREIFESLRAENIGVHVHYIPVYWHPYYQKLGY
FT                   RKGICPKAEQWYEQALTLPIFPKMTDEDVNDVIEAVKRNVY"
FT   gene            397170..398279
FT                   /locus_tag="GY4MC1_0359"
FT   CDS_pept        397170..398279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A1476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73203"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF2"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1476"
FT                   /protein_id="ADP73203.1"
FT                   /translation="MAKNHELTIPAHYNIYTGNNTGRQLTIYFSEPDAGVNEETGLLLL
FT                   IPGFGGNSQSNVYKKMREQFADQYNLVTIQCDYFGSEFMQNTKKAKLNIDISEFKNIIS
FT                   NEDYWKLKEENITWEQFIQIFSKYPIKIPMLEILDENNENFNDMGFMQALDLLAALYAV
FT                   KIILKDNNLSFNQNKVIAYGHSHGAYLGYLCNRLAPNDFTLLIDNSGWIKPAYLYANRY
FT                   IFNIIGKMTLQTEFSYLAKKLNYDKDILYLPYLYKDFHNNSQIWSFHGKDDSLVPYKEK
FT                   EKFCNEVGVTKFFIIDESKVDNKRFYSTDHGLNADFLELFKFVMENVKWTKKDPYCLNR
FT                   KTVFRSSTIEYTVDFDYGLPIMSLKPLYN"
FT   gene            complement(398577..399386)
FT                   /locus_tag="GY4MC1_0360"
FT   CDS_pept        complement(398577..399386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0360"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: chy:CHY_0981
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73204"
FT                   /db_xref="GOA:A0A0F6BIF3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF3"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADP73204.1"
FT                   /translation="MKIQNQSMIAFSTYRYQRNVTNLTKTLEKLSSGLKIYRASDDAAG
FT                   LSISETLRAQIRGLAQSQRNMQDGLSVLKAAEEGLMNVNHLLQRIRELAVQNANDTLDA
FT                   KDRAASQKELDQLLQAIDDTAEKLEFNTKKILGENIPLTLQVGANPGQTITVDMVDTST
FT                   TSLGLNGATLLTRTDAEQLITKVDNALKKVTNDLTNVGADYEAIEHHLNNTMLKEANLT
FT                   TSESMLRDANIAREMMNYISGKIRQQGDYLLISHINRNVEETLKLLT"
FT   gene            399512..399862
FT                   /locus_tag="GY4MC1_0361"
FT   CDS_pept        399512..399862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0361"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   afl:Aflv_2571 flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73205"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF4"
FT                   /inference="protein motif:PFAM:PF03646"
FT                   /protein_id="ADP73205.1"
FT                   /translation="MMKIENSLPLQEAYIPQTSKEGAALMQKIMEQQSGANEETPVSKK
FT                   KVEEITNKLNEFLEIHNRSLKFILHEELNQYYVQVIDDDTEEVIREIPPKKLLDAFYTM
FT                   QKFLGMIVDEKI"
FT   gene            399878..401449
FT                   /locus_tag="GY4MC1_0362"
FT   CDS_pept        399878..401449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0362"
FT                   /product="flagellar hook-associated 2 domain-containing
FT                   protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain-containing
FT                   protein; flagellar hook-associated protein 2
FT                   domain-containing protein; KEGG: gka:GK3114 flagellar
FT                   capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73206"
FT                   /db_xref="GOA:A0A0F6BIF5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF5"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ADP73206.1"
FT                   /translation="MAPMRIGGLASGMDIDQLVNDLMKAERIPLDKLYQKKQIFEWQRD
FT                   AYREINKKLADFDQYLFDNFMLSSNFYKKTATSSNEAAVSVKALSSSYDSTNTITVSQL
FT                   AMAATGVSGEVGNASSATKLSEKGLAAETKITIVALQANGTYKEEEITFSPDDTIADVV
FT                   KKLNQSSLNINAIFDDSSKKMGISTRATGTLDTIDVDKAEVYVKSATGDDIFATIFGFG
FT                   TGNDQNGNSGVTSLANGGQNAKFTLNGLEMERQSNTFTINGIEYTVKAVTSTPVTVTSS
FT                   TDVDGMIAKIEEFVNKYNELIGTLNDKIREKRYRDYPPLTDEQKKEMTEKQIELWEEKA
FT                   KSGLLRGDSIISNGLSQMRRDLYSRVDGIGENVIDTLSEFGITTTSEISSGGKLVIDYD
FT                   KLRKALESDPDKVVKTLTQNGAITKDSATGQVTSDTRGIVQRLRDTIKGIITNIEKKAG
FT                   KPTYTENQYSIGLQLRDVENQISDFQRRLQDIESRYWRQFTAMEQAIQRANQQSMFLMG
FT                   QFGGGM"
FT   gene            401490..401888
FT                   /locus_tag="GY4MC1_0363"
FT   CDS_pept        401490..401888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0363"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: lsp:Bsph_1174 flagellar protein; TIGRFAM:
FT                   flagellar protein FliS; PFAM: flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73207"
FT                   /db_xref="GOA:A0A0F6BIF6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF6"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADP73207.1"
FT                   /translation="MTTQQFHQVYKQNSVSTASPGELTLMLYNGCLKFLNKAKQAMREG
FT                   NIQERNTNLQKAQRIIQELMATLNQKYEIAKQMMIMYEYMNRRLIEANIKNDISIVEEV
FT                   EGFVAEFRDTWEEVIRLTRQKQFKGDQV"
FT   gene            401888..402241
FT                   /locus_tag="GY4MC1_0364"
FT   CDS_pept        401888..402241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0364"
FT                   /product="flagellar protein"
FT                   /note="KEGG: lsp:Bsph_1173 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73208"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF7"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1173"
FT                   /protein_id="ADP73208.1"
FT                   /translation="MDLIEQLVSCSESLLEVLQHSADERDKQVEKVEQLLAEREKIIAR
FT                   LKQGSYENLHQHPQARKIVEMEQDIQKGLRRLYEDIKMDLKRWNEKKRLQQSYENTFSY
FT                   VETYDGRFYDKRK"
FT   gene            402434..402985
FT                   /locus_tag="GY4MC1_0365"
FT   CDS_pept        402434..402985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0365"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: gwc:GWCH70_3010 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73209"
FT                   /db_xref="GOA:A0A0F6BIF8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF8"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADP73209.1"
FT                   /translation="MIYNIRGENIEVTPALREYVEKKIGKLERYFENTENIHVHVNLKV
FT                   YNDKQGKIEVTIPMPQLLLRAEERHDDMYAAIDLVADKLERQIRKHKTKVNRKLRDRDK
FT                   EVKQVATVQTNAPAEDNEEEEFEIVRTKHFSLKPMDSEEAILQMNLLGHNFFIFTNAET
FT                   NRTNIVYRRKDGKYGLIEAN"
FT   gene            403059..403684
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0366"
FT                   /note="uncharacterized conserved protein containing
FT                   internal repeats"
FT   gene            403815..406328
FT                   /locus_tag="GY4MC1_0368"
FT   CDS_pept        403815..406328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0368"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: gwc:GWCH70_3008 preprotein translocase, SecA
FT                   subunit; TIGRFAM: preprotein translocase, SecA subunit;
FT                   PFAM: SecA DEAD domain protein; SecA Wing and Scaffold;
FT                   SEC-C motif domain protein; SecA preprotein cross-linking
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73210"
FT                   /db_xref="GOA:A0A0F6BIF9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF9"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADP73210.1"
FT                   /translation="MLGVLKKVFDPNKRQLSRLEKIADQVDALGPEMAKLSDAELRQKT
FT                   EEFKARYQQGESLDDLLVEAFAVVREGAKRVLGLYPYKVQIMGGVVLHEGNIAEMKTGE
FT                   GKTLTATMPVYLNALTGRGVHVVTVNEYLATRDATEMGKLYEFLGLSVGLNLSGMSREE
FT                   KQAAYNADITYGTNNEFGFDYLRDNMVLYKEHIVQRPLHYAIIDEVDSILIDEARTPLI
FT                   ISGTAQKSTKLYIQANAFVRTLKKDVDYTYDEKTKSVQLTEEGITKAEKAFGIDNLFDL
FT                   KHVTLNHHINLALKAHVAMHRDVDYVVEDGKVVIVDPFTGRLMRGRRYSDGLHQAIEAK
FT                   EGLEIQNESMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVVIPTNKPVI
FT                   REDRPDLIFRTMEGKFRAVVEDIAQRHAKGQPVLVGTVSIETSELLSNMLKKRGIPHNV
FT                   LNAKNHAKEAEIIAQAGQKGAVTIATNMAGRGTDIKLGEGVKELGGLAVIGTERHESRR
FT                   IDNQLRGRSGRQGDPGVSQFYLSLEDELMRRFGSESLMSMMDRLGMDDSQPIQSKMVTK
FT                   AVESAQKRVEGNNFDARKQLLQYDDVLREQREIIYRQRYEVLDAENLRDIIEKMIQSVI
FT                   ERVVNTYTPKEELPEDWNLKGIVDYLNANLLPEGDVTVNDLRGKEPEEMIELIWEKVKA
FT                   RYDEKEQQIPPEQMREFERVIVLRAVDMKWMDHIDAMEQLRQGIHLRAYGQIDPLREYQ
FT                   MEGYAMFENMIASIEEEVAKYIMKAEIHSNLERQEVAKGEAVHPKEGEGETKRKPYRKA
FT                   VRIGRNDPCICGSGKKYKHCCGKNA"
FT   gene            406441..407545
FT                   /locus_tag="GY4MC1_0369"
FT   CDS_pept        join(406441..406515,406517..407545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="GY4MC1_0369"
FT                   /product="Peptide chain release factor 2"
FT                   /note="manually curated; KEGG: gwc:GWCH70_3007 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73211"
FT                   /db_xref="GOA:A0A0F6BIG0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG0"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3007"
FT                   /protein_id="ADP73211.1"
FT                   /translation="MIDLIEIKQELEKMAKRLAEIRGSLDLEAKQARIRELEEQMAEPD
FT                   FWDDQKAAQTVINEANALKDLVGEFQSLEERFENLEVTYELIKEEPDEDLQQELVTEAK
FT                   RLTKDFSEFELQLLLNEPYDKNNAILELHPGAGGTESQDWASMLLRMYTRWAEKKGFKV
FT                   ETLDYLPGEEAGIKSVTLLIKGHNAYGYLKAEKGVHRLVRISPFDASGRRHTSFVSCEV
FT                   IPEMDDDIEIEIRPEEIRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVTCQSERSQI
FT                   KNREKALNMLKAKLYQKKLEEQQAELAEIRGEQKEIGWGNQIRSYVFHPYSLVKDHRTN
FT                   VEVGNVQAVMDGEIDIFIDAYLRSKLK"
FT   gene            407871..408731
FT                   /locus_tag="GY4MC1_0370"
FT   CDS_pept        407871..408731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0370"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: gwc:GWCH70_3006 protein
FT                   of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73212"
FT                   /db_xref="GOA:A0A0F6BIG1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG1"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ADP73212.1"
FT                   /translation="MRRKNRLLHPKTELVIEYLCILIGSAIVAVAFNLFLLPNRVASGG
FT                   VSGISTIAHAVFGWQPAYVQWALNIPLFIAGVVLLGRQFGVKTLVGTLFLPLVVYLTKD
FT                   VEPATRDPLLGSLFGGIGVGLGLGIVFRGKASTGGTDLAAQIIHKYTGLSLGMCVVLID
FT                   GLIVSTAAFVFDIEQALYALIGLYVTSKTIDLVQVGLGSSKMAMIITNEEEKVRRAILH
FT                   EIDRGVTRLSGYGGYTDHERPVLMCVVQQAEFTKLKQLVKTIDPSAFVIVMNAAEVLGE
FT                   GFKRT"
FT   gene            408795..409121
FT                   /locus_tag="GY4MC1_0371"
FT   CDS_pept        408795..409121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0371"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: gwc:GWCH70_3005
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73213"
FT                   /db_xref="GOA:A0A0F6BIG2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR012218"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG2"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADP73213.1"
FT                   /translation="MKWKLASLFIGASLLLAACGGGNDASNNNNDSGGSTASAAEDIFQ
FT                   QNCASCHGQDLSGGAGPNLQKVGSKYSKDDIKKIIENGRGSMPAGIIKGEDADKVAEWL
FT                   ASKK"
FT   sig_peptide     408795..408872
FT                   /locus_tag="GY4MC1_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.354 at
FT                   residue 26"
FT   gene            409315..410001
FT                   /locus_tag="GY4MC1_0372"
FT   CDS_pept        409315..410001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0372"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; KEGG: gwc:GWCH70_3004 cell
FT                   division ATP-binding protein FtsE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73214"
FT                   /db_xref="GOA:A0A0F6BIG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG3"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ADP73214.1"
FT                   /translation="MIEMQDVYKTYPNGVVALNGVNVRIKQGEFVYVVGPSGAGKSTLV
FT                   KMIYREEKPTSGTIMVNGVNLAKLRDSKVPLLRRHIGVVFQDFKLLPKLTVYENVAFAL
FT                   EVIEESPKLIRSKVMEVLELVGLKHKVRSYPDELSGGEQQRVSIARSIVNSPKIVIADE
FT                   PTGNLDPETSWGIMDLFEKINNRGTTIVMATHNREIVNTIRRRVIAMENGKIVRDEAKG
FT                   EYGYEA"
FT   gene            409991..410884
FT                   /locus_tag="GY4MC1_0373"
FT   CDS_pept        409991..410884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0373"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gwc:GWCH70_3003 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73215"
FT                   /db_xref="GOA:A0A0F6BIG4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG4"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADP73215.1"
FT                   /translation="MRLNTLKRHMRESMKSLGRNGWMTFASISAVTVTLLLVGVFLVVM
FT                   FNMNHFAEKIENDVEIRVHIDVAANEQDKQALRTQIEAIPKVKEIRYSSKEQELKNLIK
FT                   SFGEEGSSFRLFEQDNPLSDVYVVKTEKPTDTIKVAKQIEKLQFVHKVNYGQGQVEKLF
FT                   STLKVARNVGIVLIIGLLFTAMFLISNTIKITIFARRREIEIMRLVGATNGFIRWPFFL
FT                   EGLWLGVIGAIFPIVSILVVYYNIYKFLEPKITVPFIELLPLNPFMWQISLILLIFGAC
FT                   IGVWGSMMSVRRFLKV"
FT   gene            410933..412231
FT                   /locus_tag="GY4MC1_0374"
FT   CDS_pept        410933..412231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0374"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gwc:GWCH70_3002 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73216"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG5"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADP73216.1"
FT                   /translation="MALAAATVLSIGVFPHFADAVSDREIQEKRDAINDIRSKQSAVQD
FT                   KINNADQQIQQLQTQQKSLSAEIKKLDLAVEETSGKIRSLSADIQQTEQAVETLKREIA
FT                   EVQARIEKRNEILKERVRSLQESGGVISYLEVLLGSQSFSDFIDRISAVTTIFEADKQI
FT                   IREQQADKALKEKKEKELTDKLSRLQADLKELEQLKQTLNEQINQKNQLMANLKQKEQE
FT                   HYELKMELAEEQELLKKQEAAVKYQLQQLMEKKRAEEAAKRRAAASHTSSSGSGSIYSG
FT                   GSSSSRSESNVPPVTSGAFMRPANGPVTSGFGYRSFGGGEFHAGIDIGKRGAVVPVVAA
FT                   ADGYVFRSYFSSSYGNVIFITHVINGQVYTTVYAHLEARLAGEGQAVRKGQVIGYMGNT
FT                   GRSTGPHLHFELHRGQWNPAKSNAVNPLDYINF"
FT   gene            412451..412852
FT                   /locus_tag="GY4MC1_0375"
FT   CDS_pept        412451..412852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0375"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73217"
FT                   /db_xref="GOA:A0A0F6BIG6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG6"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADP73217.1"
FT                   /translation="MASIGLLLIRFVFGLTFAGHGAQKLFGWFGGHGLKGTAGWMESIG
FT                   LKPGKAMAFAAGASELAGGILFAIGLWTPLAALLMVVPMIVAIAKVHGPNGYWVTQNGY
FT                   EYNLAIIAVAIGVALTGPGQYSLDAIIFG"
FT   gene            412877..413581
FT                   /locus_tag="GY4MC1_0376"
FT   CDS_pept        412877..413581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0376"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: pirin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73218"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG7"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADP73218.1"
FT                   /translation="MMQIYPAQSRYHADYGWLKTYHSFSFGDYYDPNNLQFGPLRVLND
FT                   DFVAPLRGFGAHPHQEMEIVSIVLKGYLKHEDSAGHTATTTFGGVQRMSAGTGIIHSET
FT                   NPSPTEEVNFLQLWFLPEVRGLTPSYERTTFNVEKMKNALLPVVAKNPSSPEIAHIHQD
FT                   LTIYLSDLEAGRELTFAQQEGRRIFFFVIEGDVALNGEAVLHKRDSARITETPALHIAS
FT                   GNGARFMLIDLP"
FT   gene            413852..415294
FT                   /locus_tag="GY4MC1_0377"
FT   CDS_pept        413852..415294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0377"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: gwc:GWCH70_2998
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; Peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73219"
FT                   /db_xref="GOA:A0A0F6BIG8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG8"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADP73219.1"
FT                   /translation="MNKKTTAMLMVLSMLIGAGGTYAGMQLAAPDGDHDVSLVASDKTL
FT                   TDNEEKELKKVEQAYELIKSRYVEKVDDDKLIQGAIQGMISTLNDPYSVYMDEKTTEQF
FT                   NESLDSSFEGIGAEVSMIDGKVTIVAPIKNSPAEKAGLKPNDQILRVNGESLEGLDLYE
FT                   AVLKIRGKKGTTVQLDVLRPGVKDVIKVKVVRDEIPIETVYDSVKTYNGKKVGYLEVTS
FT                   FSENTAQDFKKKLAKLEEDHIDGLIIDVRGNPGGYLQSVEEILKQFIPKDKPYVQIEER
FT                   NGDKQRFYSDLTAKKPYPIVVLIDKGSASASEILAGAMKEAGGYKLVGETSFGKGTVQQ
FT                   AIPMGDGSNIKLTLYKWLTPDGHWIHKKGVKPDVEVKQPDYFHASPLHIEKALSFDMNN
FT                   EQVKNAQQMLKGIGFDPGRTDGYFSKETEAAVKAFQKANKLPPTGKIDKNTADVLQAKV
FT                   MEAIRNEDNDVQLKTAMKVLFQ"
FT   sig_peptide     413852..413938
FT                   /locus_tag="GY4MC1_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.503 at
FT                   residue 29"
FT   gene            complement(415333..415731)
FT                   /locus_tag="GY4MC1_0378"
FT   CDS_pept        complement(415333..415731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0378"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bmq:BMQ_3973
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73220"
FT                   /db_xref="GOA:A0A0F6BIG9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADP73220.1"
FT                   /translation="MNQPFLRFLLVSIIHTAAGLSIMHLLYRLPHVPYWQATLAGIAAS
FT                   AVISYILNRTFTFQSNVSIIKSTFRFIAVMIVCYYCSYRLSTQLTDWAALTAGIISPRL
FT                   ANNAAILLGAGFYTILNYIGQKQFVFFR"
FT   gene            complement(415728..416720)
FT                   /locus_tag="GY4MC1_0379"
FT   CDS_pept        complement(415728..416720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0379"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gka:GK3091 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73221"
FT                   /db_xref="GOA:A0A0F6BIH0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP73221.1"
FT                   /translation="MQKPVLTIVVPCYNEEDVLPETIKQLTNVLEHLMEEHLIAGGSKV
FT                   LFVDDGSRDRTWELIEQESEQNPLVTGIKLSRNFGHQKALLAGLETAKNDSDCVISIDA
FT                   DLQDDVSAIREFVVKYWEGYDIVYGVRRSRDADTWFKRATAQWFYRFMQKLGVHVVYNH
FT                   ADFRLMSKRALEELSRYTEVNIFLRGIVPLLGFRTTKVFYDRKERFAGQSKYPLKKMLS
FT                   FAFDGITSFSIAPIRFITFIGFLAFFLSSIAGIYALAVKLLGHAESGWTSIIISIWFIG
FT                   GLLLMGIGLIGEYIGKIYQEVKRRPRFTIEKTLRSPALPPLSKKEKVQL"
FT   gene            complement(416738..418414)
FT                   /locus_tag="GY4MC1_0380"
FT   CDS_pept        complement(416738..418414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73222"
FT                   /db_xref="GOA:A0A0F6BIH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH1"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3179"
FT                   /protein_id="ADP73222.1"
FT                   /translation="MGMKRNERTAIGIALLLLAVYLSPLYILGEDAHIRVHDNMDSNIA
FT                   WYKVLARSGELFGPLNATIPQVINGLPRNAFGTEFSGIVWLHALFPSMVAYALSQTITR
FT                   VFAFIGMYALLKRHFLPDEESYLIRVGASLAFALTPFWPSGMLSTLGMPLALWAFLTIR
FT                   KGEATWKEWLVLVLLPFYASFVLGFFFFLAAMALLWLRDIIVQKRWNWPFFGAIALMTV
FT                   IFFAIEYRLVYSLVFGEEPTSRNEFLSSRLSFLHCVRLTFKNYLLGHTHVMTVHTFVIL
FT                   PILWITFFFAWAKRSETLEKQFIFLFVLNFVLSTWYAFWFYKGWQPLKERISLLNTFNF
FT                   ARFHFLRPMVIYLDFALALQILWKQGIRWRRVVPAALALQLLILGGFNEEIRYRLIGTP
FT                   SFKEFYAEHLFNEIKQYIGKPQSSYRVASVGLHPAIAQYNGFYTLDTYNNFYPLSYKHQ
FT                   FRKIIAKELDKSPVLQDYFDHWGNRVYLFSAELGKHYMFRKTSHKKIHHFDINTKVFKQ
FT                   MGGRYIFSSVPIMNAKEIHLRLLRTFEDSQAAWKIYVYEVE"
FT   gene            complement(418577..419065)
FT                   /locus_tag="GY4MC1_0381"
FT   CDS_pept        complement(418577..419065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0381"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: gwc:GWCH70_2995
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73223"
FT                   /db_xref="GOA:A0A0F6BIH2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR023522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH2"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADP73223.1"
FT                   /translation="MELKTSIVAKRLGVSPKTIQRWVKKYHIPCQKNEAGHYVFDAETI
FT                   SLLEQIKFEHGTALEQRDSQEPPNKTSAEALFTVYNQFASRLQHIEHQLDQKADDVVSV
FT                   QLLQHRQEIEELASHLHKLEQRIAKLEENAHKEQANAAEKTKKKAKRRGLGHFMSLFT"
FT   gene            419298..420485
FT                   /locus_tag="GY4MC1_0382"
FT   CDS_pept        419298..420485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0382"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="SMART: PDZ/DHR/GLGF domain protein; KEGG:
FT                   gwc:GWCH70_2994 PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73224"
FT                   /db_xref="GOA:A0A0F6BIH3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH3"
FT                   /inference="protein motif:SMART:SM00228"
FT                   /protein_id="ADP73224.1"
FT                   /translation="MSIWVLEALKGVLRLFAQPLFYFGIVLALAAGWRRVKRERKHFHI
FT                   RVYSPFQESKFFWRSGLAAGLILSLAAVAAGIALPRDAVSLIALVTVAFGLTLQMRLLS
FT                   PAYTVGTALLIISFLASNKEVFPAMKRFFPDLAEANMAALAMLLALLLFVEAWLILRNG
FT                   AIETSPQLAKSKRGLVVGEHWSQRLWLIPVLLPVSGELPPPFSWWPLFPYDEGSYSLML
FT                   VPFLIGFSQRVQGTLPKASIRFAGQKVLLLAWGVSLFAVGGYWYAPLSIVAAALALAGR
FT                   EWLAFYLHRQDRLKPPHFAKREHGLVILGILPHSKAEKMELQIGEVIMKVNGMPVKTEA
FT                   EFYEALQRNRAFCKLEVMDENEEIRFVQGALYEDEHHELGLLFVKERKKWALEAV"
FT   gene            420501..420722
FT                   /locus_tag="GY4MC1_0383"
FT   CDS_pept        420501..420722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0383"
FT                   /product="Protein of unknown function DUF2198"
FT                   /note="PFAM: Protein of unknown function DUF2198; KEGG:
FT                   gwc:GWCH70_2993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73225"
FT                   /db_xref="GOA:A0A0F6BIH4"
FT                   /db_xref="InterPro:IPR019242"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH4"
FT                   /inference="protein motif:PFAM:PF09964"
FT                   /protein_id="ADP73225.1"
FT                   /translation="MWFLIALIVPCLLVLLFTRVTYNHYIGTLLTVALLVASYFKGYTD
FT                   DLHEILADIVSTTVGFLYARKMVKQLKK"
FT   gene            420880..422859
FT                   /locus_tag="GY4MC1_0384"
FT   CDS_pept        420880..422859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0384"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; type III restriction protein res subunit;
FT                   UvrB/UvrC protein; KEGG: gwc:GWCH70_2992 excinuclease ABC,
FT                   B subunit; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73226"
FT                   /db_xref="GOA:A0A0F6BIH5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH5"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADP73226.1"
FT                   /translation="MGDRFELVSAYQPQGDQPQAIAKLVEGIRKGVKHQTLLGATGTGK
FT                   TFTISNVIKEVNKPTLVIAHNKTLAGQLYSELKEFFPNNAVEYFVSYYDYYQPEAYVPQ
FT                   TDTYIEKDAKINDEIDKLRHSATSALFERRDVIIVASVSCIYGLGSPEEYRELVVSLRV
FT                   GMEIERNALLRRLVDIQYERNDIDFQRGTFRVRGDVVEIFPASRDEHCIRVEFFGDEID
FT                   RIREVDALTGEIIGEREHVAIFPASHFVTREEKMRLAIENIEKELEERLRELREQGKLL
FT                   EAQRLEQRTRYDLEMMREMGFCSGIENYSRHLALRPPGSTPYTLLDYFPDDFLIIVDES
FT                   HVTLPQLRGMYNGDRARKQVLVDHGFRLPSALDNRPLTFEEFEQKINQIIYVSATPGPY
FT                   ELEHSPEVVEQIIRPTGLLDPTIDVRPIEGQIDDLIGEIQERVKRNERTLVTTLTKKMA
FT                   EDLTDYLKEVGIKVAYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLV
FT                   AILDADKEGFLRSERSLIQTIGRAARNANGHVIMYADTITKSMEIAINETKRRRAIQEA
FT                   YNREHGIVPQTVKKEIRDVIRATYAAEEKETYDAKPSYSKMTKKEREQLIADLEKEMKE
FT                   AAKALDFERAAQLRDIIFELKAEG"
FT   gene            422864..425728
FT                   /locus_tag="GY4MC1_0385"
FT   CDS_pept        422864..425728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0385"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: gwc:GWCH70_2991 excinuclease
FT                   ABC, A subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73227"
FT                   /db_xref="GOA:A0A0F6BIH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH6"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADP73227.1"
FT                   /translation="MATDKIIVKGARAHNLKNIDVEIPRDKLVVLTGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSAYARQFLGQMDKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVT
FT                   EIYDYLRLLFARIGRPVCPEHGIEITSQTIEQMVDRLLSYPERTKMQILAPIVSGRKGT
FT                   HAKTLEDIRKQGYVRVRVDGEMRELTETIELEKNKKHSIEVVVDRIIIKDGIATRLADS
FT                   LETALKLADGKVLIDVIGQEELLFSEKHACPYCGFSIGELEPRLFSFNSPYGACPDCDG
FT                   LGATLEVDPDLVIPNNELSLREHAIAPWEPQSSQYYPQLLEAVCNHYGIDMDVPVKDLP
FT                   KEQLDKILYGSGGEKIYFRYQSDFGQIREQYIVFEGVIPNVERRYRETSSDYVREQMEK
FT                   YMAQQPCPTCKGNRLKKESLAVLVGGKHIGEVTALSVTEALAFFENLQLSEKEQKIAHL
FT                   ILREIRERLGFLKNVGLDYLTLNRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSI
FT                   GLHQRDNDRLIATLKSMRDIGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGRVVAAGT
FT                   PQEVMNNPDSLTGQYLSGKKFIPIPSERRKPDGRWIEVVGAKENNLKNVSVKIPLGTFV
FT                   AVTGVSGSGKSTLVNEILYKALAQKLQRAKAKPGEHKTIKGLEHLDKVIDIDQSPIGRT
FT                   PRSNPATYTGVFDDIREVFAATNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHF
FT                   LPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLEMTVEDALEFFGNIPKIKRKLQTLY
FT                   DVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSTGRTLYILDEPTTGLHVDDIARLLK
FT                   VLQRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGEQGGQIVATGTPEEVAEAKHSHT
FT                   GRYLKPILERDRERMRALYETAKA"
FT   gene            425814..426140
FT                   /locus_tag="GY4MC1_0386"
FT   CDS_pept        425814..426140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73228"
FT                   /db_xref="GOA:A0A0F6BIH7"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2990"
FT                   /protein_id="ADP73228.1"
FT                   /translation="MNSNKVLASLCYFSVLFAGFIFPVIVYFVADDQEVKKHAKKAFLS
FT                   HCIPAATIAIFIILGVTMGAMHQYSDISFFVGGGLVWIGFAIAGIVNLVIVVWNIVQGI
FT                   RVLK"
FT   gene            426163..427239
FT                   /locus_tag="GY4MC1_0387"
FT   CDS_pept        426163..427239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73229"
FT                   /db_xref="InterPro:IPR016599"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH8"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2989"
FT                   /protein_id="ADP73229.1"
FT                   /translation="MEEKKRILKMVQDGKLTVEEALTLLEKLDEQKSATGLLDWHHVSG
FT                   SHANGKQHSVKMDSLKEKLFDFFDATVKKVKEFDFPFANSVEVRHVFQQNDVALQEIDV
FT                   HIANGNIKVVPWEQADVRVECEAKVYRFESPDAARRSFIEETSFFVQNGRFRFSVTKPF
FT                   IKTNATIYVPQAHYQDAHFRLFNGDIEMERLHANKLHVKNVNGSITLQHLFAEEAELET
FT                   ANGSIILERGAVEEVEAETIHGEIKLEGNYRYVRLRTFSGGIAYATEREDGVITGKTVT
FT                   GNIALRLPRNICLEGEIRTNLGGLICQHANVLPVEEKQETAQKLLRFACENPSKPPFHV
FT                   YADSKAGSVSLQMMEEGA"
FT   gene            427280..427639
FT                   /locus_tag="GY4MC1_0388"
FT   CDS_pept        427280..427639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0388"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   gwc:GWCH70_2988 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73230"
FT                   /db_xref="GOA:A0A0F6BIH9"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH9"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADP73230.1"
FT                   /translation="MINWLIGVFVNTVLLMAIDGYFDSIQFSGIGAAFIASMILSILNI
FT                   VVRPVLILLTLPVTILTLGLFLFVINAITLLMTAALMGNAFEIDGFGTALLASIVLSFF
FT                   HLLVQKAIIEPLLQK"
FT   gene            427757..428692
FT                   /locus_tag="GY4MC1_0389"
FT   CDS_pept        427757..428692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0389"
FT                   /product="HPr kinase"
FT                   /note="KEGG: gwc:GWCH70_2987 HPr kinase; TIGRFAM: HPr(Ser)
FT                   kinase/phosphatase; PFAM: HPr serine kinase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73231"
FT                   /db_xref="GOA:A0A0F6BII0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII0"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ADP73231.1"
FT                   /translation="MPKVRTKDIIEKFQLELVSGAEGIYRPITTSDLSRPGIEMAGYFA
FT                   YYPAERIQLLGRTELSFYETLSPEEKKIRMERLCTDITPGIIVSRGLEVPPELIEASER
FT                   QSVPVMRSTMKTTRLSSRLTNYLESKLAPTTAVHGVLVDVYGVGVLITGKSGVGKSETA
FT                   LELVKRGHRLVADDCVEIRQEDEGMLVGSAPELIEHLLEIRGLGIINMMTLFGAGAVRT
FT                   HKRISLVIDLELWDPNKQYDRLGLEEEKVKILDTELPKLTIPVRPGRNLAVIVEVAAMN
FT                   FRLKRMGVNAAEEFSARLTDAIEDGEHDYE"
FT   gene            428715..429524
FT                   /locus_tag="GY4MC1_0390"
FT   CDS_pept        428715..429524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0390"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="KEGG: gwc:GWCH70_2986 prolipoprotein diacylglyceryl
FT                   transferase; TIGRFAM: prolipoprotein diacylglyceryl
FT                   transferase; PFAM: prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73232"
FT                   /db_xref="GOA:A0A0F6BII1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII1"
FT                   /inference="protein motif:TFAM:TIGR00544"
FT                   /protein_id="ADP73232.1"
FT                   /translation="MDATIQPLDRVFLHLGPITIYWYGVIIGAGVLIGLWLATREGERR
FT                   GLPKETFVDLVMFAVPVAILCARAYYVIFEWSYYSKHLSEIPKIWEGGLAIHGGLLGAV
FT                   ATGIVFAKVKGLSFWKLADIAAPSIILGQAIGRWGNFMNQEAHGGPVTREFLESLHLPD
FT                   FIINQMYINGQYYHPTFLYESLWNVAGFLLLLWLRRVNLRRGELFLSYLIWYSAGRFYI
FT                   EGMRTDSLMLTSHLRMAQVVSVMLIILSVCLWVYRRKKGLAKERYSD"
FT   gene            429543..430481
FT                   /locus_tag="GY4MC1_0391"
FT   CDS_pept        429543..430481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0391"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   gwc:GWCH70_2985 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73233"
FT                   /db_xref="GOA:A0A0F6BII2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII2"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADP73233.1"
FT                   /translation="MVGILRRGFAVGLQTTWTLGKVIFPITLIVSVLQHTPVLQWIIQL
FT                   VAPLMKWIGLPGDAAIPLVLGNLLNLYAAIGAILTLDLTVKEVLILAVMLSFSHNLLIE
FT                   STVASRTGMSIALMVAVRLSLAIIAALLIHHLWQGGSEAAQYGFVSNSPEQLAGWGAIL
FT                   LAGVKKACLGIVQLAAIVIPLMIGIQILKELEWIHVFSRWMAPLTKMLGMKENTSLTLA
FT                   AGLVFGLAYGAGVMIQAVKEDGVSKRDLTLAFIFLISCHAVIEDTLVFVPLGIPVWPLL
FT                   VIRLATAMLLTMLISFIWNRGKEAKRKEATL"
FT   gene            430478..431125
FT                   /locus_tag="GY4MC1_0392"
FT   CDS_pept        430478..431125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0392"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: gwc:GWCH70_2984 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73234"
FT                   /db_xref="GOA:A0A0F6BII3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023733"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII3"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADP73234.1"
FT                   /translation="MKIRTVLFDLDGTLIDTNELIIQSFLHTLEKYYPGKYTREDILPF
FT                   IGPPLSETFNALDPSRAQEMIDTYRAFNHAQHDALIREFDTVYETIETLHKNGVRLGVV
FT                   TTKIHQTAVMGLKKTRLEPFFDCVIGLDDVQHAKPDPEPIYKALDLLQSTPDEALMVGD
FT                   NYHDILAGKNAGTKTAGVAWAIKGREYLQQYKPDFMLEKMSDLLAIVGVENA"
FT   gene            431122..431631
FT                   /locus_tag="GY4MC1_0393"
FT   CDS_pept        431122..431631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0393"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: gwc:GWCH70_2983 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73235"
FT                   /db_xref="GOA:A0A0F6BII4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII4"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ADP73235.1"
FT                   /translation="MRRTTKYPVSGANSLWQIYQTVSFWKVLKNVIVIQIGRYTPFLAV
FT                   KNWLYRTFLRMKIGEKTALAFMVMPDIMFPEKIQIGRNCVIGYNTTILAHEYLIDEYRL
FT                   GDVVIGDEVMIGANSTVLPGVVIGDRAVVAAGTVVHKDVPAGAFVAGNPMRIIYTKEEM
FT                   ERRKGH"
FT   gene            431900..432600
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0394"
FT   gene            432879..434060
FT                   /locus_tag="GY4MC1_0395"
FT   CDS_pept        432879..434060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0395"
FT                   /product="histidyl-tRNA synthetase 2"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase 2; KEGG:
FT                   gwc:GWCH70_2981 histidyl-tRNA synthetase 2; PFAM: tRNA
FT                   synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73236"
FT                   /db_xref="GOA:A0A0F6BII5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII5"
FT                   /inference="protein motif:TFAM:TIGR00443"
FT                   /protein_id="ADP73236.1"
FT                   /translation="MTKKLFMFEKPLGMRDTLPFLYEIKKRVRQAMVREIETWGYELIE
FT                   TPTLEYYETVGAASAIDDHQLFKLLDQQGHTLVLRPDMTAPIARLAASRLYQDGNPLRL
FT                   AYNANVFRAQQREGGRPAEFEQIGVECIGDGTVAADAEVISVMIAALKQTGLRNFTVAI
FT                   GHIGYVNALFLEILGNEERASVLRRFLYEKNYVGYREHVKSLPLSSIDQKRLLQLLHLR
FT                   GNDKTMENARELVHSEEGKRAVDELCELASALQLYGVDGAVKIDMSLVSHMSYYTGILF
FT                   EVYAEHVGFPIGNGGRYDELLEKFSRKAPATGFGVRVDRLIEALGESEAEAAIECIVFS
FT                   QERFAEALELARTKRREGKRVVLQHILGIRDIDAYSKKYQPITYLLGSGGKEE"
FT   gene            434064..434684
FT                   /locus_tag="GY4MC1_0396"
FT   CDS_pept        434064..434684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0396"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   gwc:GWCH70_2980 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73237"
FT                   /db_xref="GOA:A0A0F6BII6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII6"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADP73237.1"
FT                   /translation="MLTIAMPKGRIFAEALELLQKAGYTLPAEFAESRKLMMEVPEENM
FT                   RFILAKPMDVVTYVEHGVADLGIAGKDVMMEEERDVYELLDLKISKCHLAVAGLPNGRM
FT                   PQIAPRVATKYPNIASSYFREQGEQVEIIRLNGSIELAPLIGLADRIVDIVSTGRTLKE
FT                   NGLVELEKIADVTSRLIVNPVSYRIKDEEVDVLVCRLSEVIPQ"
FT   gene            434700..435968
FT                   /locus_tag="GY4MC1_0397"
FT   CDS_pept        434700..435968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0397"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   gwc:GWCH70_2979 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73238"
FT                   /db_xref="GOA:A0A0F6BII7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII7"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADP73238.1"
FT                   /translation="MKIERVKSRVSLRRTIESGTEEQRRAVLEIISTVRARGDEALKSY
FT                   TEKFDGVRLDSLRVTNEEIEAAYQNVSEEALRIIREAAENIRDYHERQKRESWIIAKED
FT                   GTMLGQKITPLDAVGLYVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKNGTLPAG
FT                   VLVAASELGVKEIYKVGGAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGQVAI
FT                   DMIAGPSEIVVLADETANVNEIAADLLSQAEHDERASAILVTPSMKLALAVASEVKKQL
FT                   ETLPRKAIAVSALENYGAIYVTETLAEAVEVVNELAPEHLEVMTAEPMQLLGQIRHAGA
FT                   IFLGRFSSEPVGDYFAGPNHVLPTNGTARFSSGLSVDEFVKKSSIIFYSEPALQRNAGK
FT                   IAAFARLEGLEAHARAVEERFKK"
FT   gene            435982..436569
FT                   /locus_tag="GY4MC1_0398"
FT   CDS_pept        435982..436569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0398"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="KEGG: gwc:GWCH70_2978 imidazoleglycerol-phosphate
FT                   dehydratase; PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73239"
FT                   /db_xref="GOA:A0A0F6BII8"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII8"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADP73239.1"
FT                   /translation="MERYASISRKTNETDIQLAFAIDGEGKAELHTGVPFLTHMLDLFT
FT                   KHGHFNLTVTAKGDTEVDDHHTTEDIGICLGQALREALGDKKGIRRYGNAFVPMDEALA
FT                   QVVVDLSNRPHFEFRGEFPSEKVGTFDVELVHEFLWKLALEARMNLHVIVHYGRNTHHM
FT                   IEAVFKALGRALDEATMIDPRVKGVPSTKGML"
FT   gene            436572..437207
FT                   /locus_tag="GY4MC1_0399"
FT   CDS_pept        436572..437207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0399"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="KEGG: gwc:GWCH70_2977 imidazole glycerol phosphate
FT                   synthase, glutamine amidotransferase subunit; TIGRFAM:
FT                   imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73240"
FT                   /db_xref="GOA:A0A0F6BII9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII9"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADP73240.1"
FT                   /translation="MIGIIDYGMGNLYSVSKALERLRYEYVVSDQPNVLKQTKGLILPG
FT                   VGSFKDAMHILRKTKLDKFIREAVNEGTPLFGICLGMQLLFEESEENGLTEGLGLLSGR
FT                   VVRIPGVTAGGERYKVPHMGWNRLVFRHPSPLLQNVEEGHVYFVHSYYVVTDDDSVVLA
FT                   SSFYDVEVPAVVGKGNVYGTQFHPEKSGEVGMKILQNYAAIVEGKGRV"
FT   gene            437207..437944
FT                   /locus_tag="GY4MC1_0400"
FT   CDS_pept        437207..437944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0400"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; KEGG: gwc:GWCH70_2976
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73241"
FT                   /db_xref="GOA:A0A0F6BIJ0"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ0"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADP73241.1"
FT                   /translation="MAAFTIYPAIDIRGGKCVRLLQGDYTKETVYGDSPVEMAALFAEQ
FT                   GAEWIHMVDLDGAKEGKRVNDRFVVEAAKQLPVKVQIGGGIRTEDDIVYYLENGVARVI
FT                   LGSAAIARPSFVKEMLKKYGERIAIGIDAKDGFVATEGWLHTSNVKATDLGKELAEAGA
FT                   QTFIFTDIATDGMLSGPNIQAAVEMARATGKDVIASGGVRSLADLVSLQNHVGDGVAGA
FT                   IVGKALYTKQFTVAEALKVVQGE"
FT   gene            437941..438699
FT                   /locus_tag="GY4MC1_0401"
FT   CDS_pept        437941..438699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0401"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="KEGG: gwc:GWCH70_2975 imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; TIGRFAM: imidazoleglycerol
FT                   phosphate synthase, cyclase subunit; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73242"
FT                   /db_xref="GOA:A0A0F6BIJ1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ1"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADP73242.1"
FT                   /translation="MITKRIIPCLDVKDGRVVKGVQFVQLRDAGDPVELAKFYDKQGAD
FT                   ELVFLDISASHEGRKTMVEVVEKVAAQLAIPFTVGGGIHSLDDIKTILRAGADKVSLNT
FT                   AAVRNPQLITEGADFFGAQCIVVAIDAKYDETLGSWRVYTHGGRNATDLEVVEWAKEAV
FT                   RRGAGEILLTSMDCDGEKNGFDIALTRAVSEAVSVPVIASGGAGSAKHFLEAFVEGKAD
FT                   AALAASIFHYKETSIKEVKAYLKERGVNVR"
FT   gene            438696..439328
FT                   /locus_tag="GY4MC1_0402"
FT   CDS_pept        438696..439328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0402"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="KEGG: gwc:GWCH70_2974 phosphoribosyl-ATP
FT                   diphosphatase; TIGRFAM: phosphoribosyl-ATP diphosphatase;
FT                   PFAM: phosphoribosyl-AMP cyclohydrolase; Phosphoribosyl-ATP
FT                   pyrophosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73243"
FT                   /db_xref="GOA:A0A0F6BIJ2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ2"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADP73243.1"
FT                   /translation="MNLANIRFDEKGLVPAIVQDAQSKEVLMLAYMNEESLKKSLETGE
FT                   TWFYSRSRKELWHKGATSGNIQRIVDMRYDCDSDSLLVLVEPAGPACHTGSYSCFFNRM
FT                   NGEKCETSPNRFAILNTLEEIIAKRDAERPEGAYTTYLFEKGVDKILKKVGEEAAEVII
FT                   AAKNRNHDELKWEVADLLYHLLVLLREQKLPLDAVLEVLAERHNAKQ"
FT   gene            439439..440917
FT                   /locus_tag="GY4MC1_0403"
FT   CDS_pept        439439..440917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0403"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /note="SMART: Tetratricopeptide repeat; KEGG:
FT                   gwc:GWCH70_2973 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73244"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ3"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ADP73244.1"
FT                   /translation="MGKQLKPKQRGTKIIPFIQNGEYYFKKGMQAYQQRDLYKAKKYLE
FT                   RAVQYDGNNASFALQLASVLAELGEYQASNQWLFKIIHELDETMDECFYFLANNFAHLG
FT                   LFHEAMKYAETYLARDPDGHFAEDTEDLMELLKIDQEDENGDEQDDLITQQERARLLLE
FT                   KEKFPEAIRLLEMIIDRYPEFWSAYNNLALAYFYNGNVQKAQEIIEQVLERNPGNLHAL
FT                   CNRLVFYYYLRDERQVNRLSDQLACVHPFFIEHRYKLGATFALVGRFDLAFKWLYHLYK
FT                   IRYDGDDAFYYWLAYAAYYTGREELAKNVWEKVIEANPNKRGEEPWAFSVPSVDPELQK
FT                   IIRWFDRMNIAEMLYGLYLLSESPYKNDPAVSVAIRRYLVDHPLLSQFADYFLFREAEV
FT                   SPPYVVDSHIIINKLSEKNERADETMYIAWFSVVVNASAKERFSNHSAWSAALEYVWRQ
FT                   RQGQHVTQKWIADKYHVSLSTVKKYVKKVKELLS"
FT   gene            440994..441941
FT                   /locus_tag="GY4MC1_0404"
FT   CDS_pept        440994..441941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0404"
FT                   /product="thioredoxin reductase"
FT                   /note="KEGG: gwc:GWCH70_2972 thioredoxin reductase;
FT                   TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73245"
FT                   /db_xref="GOA:A0A0F6BIJ4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ4"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ADP73245.1"
FT                   /translation="MSEEKIYDVIIAGAGPAGMTAAVYTSRANLSTLMIERGVPGGQMV
FT                   NTEEVENYPGYEQILGPELATKMFEHAKKFGAEYAYGEVKEIIDGEAYKTVVVGDKQYK
FT                   GRAVIIATGAEYKKLGVPGEAEYGGRGVSYCAVCDGAFFKGKDLVVVGGGDSAVEEGVY
FT                   LTRFANKVTIVHRRDQLRAQKILQDRAFANEKIDFIWNHTVKQINGKDGKVNSVTLVHT
FT                   QTGEEREFPCDGVFIYIGMLPLSKPFVNLGITNENGYIVTNERMETKVPGIFAAGDVRE
FT                   KSLRQIVTATGDGSIAAQSAQHYVEELKEKLNIK"
FT   gene            442194..442661
FT                   /locus_tag="GY4MC1_0405"
FT   CDS_pept        442194..442661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0405"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gwc:GWCH70_2971 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73246"
FT                   /db_xref="GOA:A0A0F6BIJ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP73246.1"
FT                   /translation="MSVLQRVTNCVLVKDGKVLLLQKPKRGWWVAPGGKMEQGESVREA
FT                   CIREYREETGIYLKNPKLKGVFTIVVKNQEQTVSEWMMFTFFADQFAGENVPYCEEGKL
FT                   EWHPLETIHQLPMAPGDYHILDYALKGSGVMYGTFIYTEDFDLLSYRLDPS"
FT   gene            442680..443573
FT                   /locus_tag="GY4MC1_0406"
FT   CDS_pept        442680..443573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73247"
FT                   /db_xref="GOA:A0A0F6BIJ6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ6"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2970"
FT                   /protein_id="ADP73247.1"
FT                   /translation="MSEGSANNIQVVIITGMSGAGKTVAIQSFEDLGFFCVDNLPPTLL
FT                   PKFLELMKESGNKINKVALVMDLRSRDFFDSLFTALDDLAEQSWVTPQILFLDAEDSTL
FT                   VARYKETRRTHPLAPNGLPLEGIRLERKLLEELKGRAQIIYDTSDLKPRELREKILQQF
FT                   SSHAQQTFTVNVMSFGFKYGVPIDADLVFDVRFLPNPHYIDHMRPKTGLDEEVSSYVLK
FT                   WGETQKFLEKLIDLLTFMLPHYKREGKSQLVIAIGCTGGQHRSVAIAEYIARHFANDYK
FT                   THVSHRDMERRKEKHK"
FT   gene            443570..444553
FT                   /locus_tag="GY4MC1_0407"
FT   CDS_pept        443570..444553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0407"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: gwc:GWCH70_2969 protein of unknown function UPF0052
FT                   and CofD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73248"
FT                   /db_xref="GOA:A0A0F6BIJ7"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ7"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADP73248.1"
FT                   /translation="MNAKSQPKIVIIGGGTGLPVLLRGLKQYAVDITAIVTVADDGGSS
FT                   GRLRDELQIPPPGDVRNVLAALSDVEPLVIELFQHRFQNGNGLSGHSLGNLILAALTSI
FT                   TGDFVKAIREMSKVLKVHGQVLPAANKSVVLHAEMEDGAIVSGESKIPYSGKRIKKVFL
FT                   TPENVEPLPETIDAIRSADLIVIGPGSLYTSILPNLLVPKIGQEVCRAKAKKVYICNVM
FT                   TQAGETLHYTVSDHVKALHDHMGCLFLDVVVVNNGHIPEEIQRRYAEELAEPVKDDGDR
FT                   LAELGIEVIRDNIVSYEDRVIRHDTKKVASLLISLITAPPSSQWHE"
FT   gene            444574..445536
FT                   /locus_tag="GY4MC1_0408"
FT   CDS_pept        444574..445536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0408"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199;
FT                   Sporulation regulator WhiA-like; KEGG: gwc:GWCH70_2968
FT                   protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73249"
FT                   /db_xref="GOA:A0A0F6BIJ8"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ8"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ADP73249.1"
FT                   /translation="MSFASETKKELTNLEVKPCCLKAELSALLRMNGLLSFSNRKIIVD
FT                   VQTENAAIARRIYTLLKKGYEVTVELLVRKKMRLKKNNVYIVRIVDGAHELLKDLKILE
FT                   EDFSLIRVISPELVKKKCCKRSYLRGAFLAGGSVNNPETSSYHLEIFSLYEEHNDSLCE
FT                   LMNSHFFLNAKTLERKKGFITYLKEAEKISEFLNIIGAHQALLRFEDIRIVRDMRNSVN
FT                   RLVNCETANLNKTIGAALRQVENIRYIDETIGLSSLPDKLREIAELRMMYQDVTLKELG
FT                   ELVSGGKISKSGINHRLRKIDEIAERLRAGKPVDFHKSL"
FT   gene            445554..445811
FT                   /locus_tag="GY4MC1_0409"
FT   CDS_pept        445554..445811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0409"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: gwc:GWCH70_2967 phosphocarrier, HPr family;
FT                   TIGRFAM: phosphocarrier, HPr family; PFAM: phosphoryl
FT                   transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73250"
FT                   /db_xref="GOA:A0A0F6BIJ9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ9"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADP73250.1"
FT                   /translation="MVEKQVEVRLKTGLQARPAALFVQEANRFSSDIYLEKDGKRVNAK
FT                   SIMGLMSLAISTGSVITLIADGPDENEAIEKLANYVENEK"
FT   gene            complement(445863..446453)
FT                   /locus_tag="GY4MC1_0410"
FT   CDS_pept        complement(445863..446453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0410"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; KEGG: gwc:GWCH70_2966 ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73251"
FT                   /db_xref="GOA:A0A0F6BIK0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK0"
FT                   /inference="protein motif:TFAM:TIGR00493"
FT                   /protein_id="ADP73251.1"
FT                   /translation="MNLIPTVIEQTSRGERAYDIYSRLLKDRIIILGSPIDDQVANSIV
FT                   SQLLFLAAEDPEKDISLYINSPGGSITAGLAIYDTMQFIKPDVSTICIGMAASMGAFLL
FT                   AAGAKGKRFALPNSEIMIHQPLGGAQGQATEIEIAAKRILFLRDKLNRILSENTGQPID
FT                   VIERDTDRDNFMTAQKAQEYGIIDRVLTRVDEK"
FT   gene            446682..446753
FT                   /locus_tag="GY4MC1_R0042"
FT                   /note="tRNA-Arg2"
FT   tRNA            446682..446753
FT                   /locus_tag="GY4MC1_R0042"
FT                   /product="tRNA-Arg"
FT   gene            447119..448432
FT                   /locus_tag="GY4MC1_0411"
FT   CDS_pept        447119..448432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0411"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: gwc:GWCH70_2965 RNA polymerase, sigma 54
FT                   subunit, RpoN; TIGRFAM: RNA polymerase sigma-54 factor,
FT                   RpoN; PFAM: sigma-54 DNA-binding domain protein; sigma-54
FT                   factor core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73252"
FT                   /db_xref="GOA:A0A0F6BIK1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK1"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADP73252.1"
FT                   /translation="MRAELWQEQRLKLSLTKELTQAIELLQYSAVELQSFLYEQSLDNP
FT                   FLEIRDYRLKRSYRDSSDKEKQRWIENISTHSETLSLHLIAQLPALSLSEREERVVRYM
FT                   IASLDEDGYLRVEIEEIAARLAISKQEAEKALQIIQSLEPAGVGARSLQECLYLQLKRL
FT                   PHRDELAEQIVQHHFSLFVEKAWKTLAKQLDIDIASLQRVWDLIRTLEPRPGIHYTKEM
FT                   PHFIVPDLIIERSDEGDWRIFCNDDVHPELAWNRAYEQKISGYRDGQVQSFIKDKYRQF
FT                   LWLTKSLEQRKQTLLNIMHVIVDKQKQCLEAGFAALKPLTMREVAEELGIHESTVSRAV
FT                   KNKYVQTPFGTVELRRFFSNAVSSAYADDDAASSVKVKMFIKQLIEQENKQRPLSDQKI
FT                   ADLLHERYGVAVSRRTVAKYREQLHIPSSAKRKQYVGK"
FT   gene            448439..448684
FT                   /locus_tag="GY4MC1_0412"
FT   CDS_pept        448439..448684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0412"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: gwc:GWCH70_2964
FT                   glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73253"
FT                   /db_xref="GOA:A0A0F6BIK2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK2"
FT                   /inference="protein motif:PFAM:PF05768"
FT                   /protein_id="ADP73253.1"
FT                   /translation="MIIRLYSKTNCPLCDKAKQVLQELQKEFAFQIKEIDIYQDDALLE
FT                   KYQLMIPVVEIDGEEVGFGIIQKDVIRKRLLEARNS"
FT   gene            448813..449832
FT                   /locus_tag="GY4MC1_0413"
FT   CDS_pept        448813..449832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0413"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: sugar-binding domain-containing protein; KEGG:
FT                   gwc:GWCH70_2963 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73254"
FT                   /db_xref="GOA:A0A0F6BIK3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK3"
FT                   /inference="protein motif:PFAM:PF04198"
FT                   /protein_id="ADP73254.1"
FT                   /translation="MQSLIEAQKKLLPDLLEIMQKRYRILRYISLMQPVGRRVLSNSLG
FT                   ISERVLRSEVQFLKEQNLLTISSAGMSLTQEGKGLLHTLEDVMREVLGLKDLETKLKRK
FT                   LHVEKIIVVAGDSDLSPWVKKEMGKACVTCMKERLANGDIVAVTGGTTMAAVAEMMTPD
FT                   AKLNDLLFVPARGGLGENVENQANTICAKMAEKSSGNYRLLHVPDHLSREAYESLIEEP
FT                   TVKEVLELIKSCRMVVHGIGDAITMAERRKTPNEDMAKIQARHAVAEAFGYYFNEKGEV
FT                   VHKVKTVGIQLEDLPRVEHVIAVAGGSSKAKAIQAYMKRAHHSILITDEGAAKALLGE"
FT   gene            449878..450885
FT                   /locus_tag="GY4MC1_0414"
FT   CDS_pept        449878..450885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0414"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="SMART: Glyceraldehyde 3-phosphate dehydrogenase,
FT                   NAD(P) binding domain; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; KEGG: gwc:GWCH70_2962
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, catalytic domain;
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73255"
FT                   /db_xref="GOA:A0A0F6BIK4"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK4"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADP73255.1"
FT                   /translation="MAVKIGINGFGRIGRNVFRAALKNPNIEVVAVNDLTDANTLAHLL
FT                   KYDSVHGKLDAEVSVNGNNIVVNGKEIVVKAERDPAQLAWNELGVDIVVESTGRFTKRE
FT                   DAAKHLEAGAKKVIISAPAKNEDITIVMGVNQDKYDPANHHIISNASCTTNCLAPFAKV
FT                   LHEKFGIVRGMMTTVHSYTNDQQILDLPHKDLRRARAAAESIIPTTTGAAKAVALVLPE
FT                   LKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKEAAEGELKGILAYSEEPLV
FT                   SRDYNGSTVSSTIDALSTMVIEGTMVKVVSWYDNETGYSHRVVDLAEYIASKGL"
FT   gene            451011..452195
FT                   /locus_tag="GY4MC1_0415"
FT   CDS_pept        451011..452195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0415"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: gwc:GWCH70_2961 phosphoglycerate kinase; PFAM:
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73256"
FT                   /db_xref="GOA:A0A0F6BIK5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK5"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADP73256.1"
FT                   /translation="MNKKTIQDVDVKGKRVFCRVDFNVPMENGAITDDTRIRAALPTIR
FT                   YLIEQGAKVILASHLGRPKGKVVEELRLNAVAERLSELLGKQVVKTDEAYGEAVKTAIA
FT                   GMKEGDVLLLENVRFYPGEEKNDPELAKAFAELADIYVNDAFGAAHRAHASTEGIAHYL
FT                   PAVAGFLMEKEIEVLGKALSNPERPFTAIIGGAKVKDKIGVIENLLNKVDNLIIGGGLA
FT                   YTFVKALGHEVGKSLLEEDKIELAKSFMEKAKEKGVNFYMPVDAVVADRFANDANTKVV
FT                   AIDAIPSDWEALDIGPKTCELYRDVIMKSKLVVWNGPMGVFEMDAFAGGTKAVAQALAD
FT                   AADTYSVIGGGDSAAAVEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALNDK"
FT   gene            452233..452994
FT                   /locus_tag="GY4MC1_0416"
FT   CDS_pept        452233..452994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0416"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; manually curated;
FT                   KEGG: gwc:GWCH70_2960 triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73257"
FT                   /db_xref="GOA:A0A0F6BIK6"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK6"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ADP73257.1"
FT                   /translation="MRKRIIAGNWKMHKTLPEAVSFVEEVKRLVPPAEQVDSVICAPFL
FT                   FLDRLVQNVQGSDLKIGAQNMHFEDKGAFTGEISPVALKDIGVAYVIIGHSERREMFAE
FT                   TDETVNKKVHAAFKHGLIPIVCCGETLEQRESGKTNDIVGAQVEKALAGLTAEQAKQVV
FT                   IAYEPIWAIGTGKSSTAEDANEVCGHIRSVIAKIFSPEVAEAVRIQYGGSVKPENIREF
FT                   LAQEHIDGALVGGASLDPKSFLQLVEAGQHE"
FT   gene            452987..454525
FT                   /locus_tag="GY4MC1_0417"
FT   CDS_pept        452987..454525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0417"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; KEGG: gwc:GWCH70_2959
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73258"
FT                   /db_xref="GOA:A0A0F6BIK7"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK7"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADP73258.1"
FT                   /translation="MSKKPVALIILDGFALRDETYGNAIAQAKKPNFDRYWNEYPHSTL
FT                   TACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNIAIREGEFDRNETFLAAMNHV
FT                   KEKGTNLHIFGLLSDGGVHSHINHLYALLKLAAKEGVKNVYIHGFLDGRDVGPQTAPKY
FT                   IKELQEKIKEYGVGEIATLSGRYYSMDRDKRWERVEKAYRAMVYGEGPTYRDPLECIED
FT                   SYQHGIYDEFVLPSVIVREDGSPVATIKDEDAIIFYNFRPDRAIQISNTFTNEDFREFD
FT                   RGPKHPKNLFFVCLTHFSETVKGYVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHV
FT                   TYFMNGGREEKFPGEDRILINSPKVATYDLKPEMSAYEVTDALLKEIEADKYDAIILNY
FT                   ANPDMVGHSGKLEPTIKAIEAVDECLGKVVDAILAKGGIAIITADHGNADEVLTPDGKP
FT                   QTAHTTNPVPVIVTKKGIELRKGGILGDLAPTMLDLLGLPQPKEMTGKTLIIKK"
FT   gene            454544..455836
FT                   /locus_tag="GY4MC1_0418"
FT   CDS_pept        454544..455836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0418"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="TIGRFAM: enolase; KEGG: gwc:GWCH70_2958 enolase;
FT                   PFAM: Enolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73259"
FT                   /db_xref="GOA:A0A0F6BIK8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK8"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ADP73259.1"
FT                   /translation="MSAILDVYAREVLDSRGNPTVEVEIYTEDGGFGRALVPSGASTGE
FT                   YEAVELRDGDKSRYLGKGVLKAVENVNEVIAPAIIGLEVTDQVGIDKTLIELDGTENKS
FT                   KLGANAILGVSLAVARAAADELGMPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQ
FT                   EFMIMPVGAKSFREALRMGAEIFHSLKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQTI
FT                   IEAIEKAGYKPGEEVMLAMDVASSELYNKEDGKYHLEGEGVVRTSEEMVAWYEELVSKY
FT                   PIISIEDGLDENDWEGHKLLTERLGKKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKV
FT                   NQIGTLTETFDAIEMAKRAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDR
FT                   VAKYNQLLRIEDQLGDTAIYNGIKSFYNLKK"
FT   gene            456507..456902
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0419"
FT   gene            457101..457334
FT                   /locus_tag="GY4MC1_0420"
FT   CDS_pept        457101..457334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0420"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: gwc:GWCH70_2957 preprotein translocase, SecG
FT                   subunit; TIGRFAM: preprotein translocase, SecG subunit;
FT                   PFAM: Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73260"
FT                   /db_xref="GOA:A0A0F6BIK9"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK9"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADP73260.1"
FT                   /translation="MHTLLVTLLVIVSIALIVVVLLQSGRSAGLSGAITGGAEQLFGKQ
FT                   KARGLDAVLQRITVVLAVLFFVLSIAVTYMQL"
FT   sig_peptide     457101..457187
FT                   /locus_tag="GY4MC1_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.240 at
FT                   residue 29"
FT   gene            457411..458151
FT                   /locus_tag="GY4MC1_0421"
FT   CDS_pept        457411..458151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0421"
FT                   /product="carboxylesterase"
FT                   /note="KEGG: gwc:GWCH70_2956 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73261"
FT                   /db_xref="GOA:A0A0F6BIL0"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL0"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2956"
FT                   /protein_id="ADP73261.1"
FT                   /translation="MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTC
FT                   HAPIYKGHGVPPEELVHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSLKLGY
FT                   TVPVVGIIPMCAPMYIKSEETMYEGVLKYAREYKKREGKTPEQIEEEMEAFQKTPMKTL
FT                   KALQQLIADVRERIDLIYAPTFVVQARHDEMINPDSANIIYNGIESPVKKIKWYEESGH
FT                   VITLDKEKEQLHEDIYEFLESLDW"
FT   gene            458179..460464
FT                   /locus_tag="GY4MC1_0422"
FT   CDS_pept        458179..460464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0422"
FT                   /product="ribonuclease R"
FT                   /note="TIGRFAM: ribonuclease R; VacB and RNase II family
FT                   3'-5' exoribonuclease; PFAM: ribonuclease II; RNA binding
FT                   S1 domain protein; Ribonuclease B OB region domain; KEGG:
FT                   gwc:GWCH70_2955 ribonuclease R; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73262"
FT                   /db_xref="GOA:A0A0F6BIL1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL1"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ADP73262.1"
FT                   /translation="MDQSLVERILTFMQDEAYKPLTVQELEEAFGITDAAAFKEFVKAL
FT                   VAMEEQGLVVRTRSNRYGVPEKMNLVRGKVSGHAKGFAFVVPDDPELDDIFIPPSEMKN
FT                   AMHGDTVLVRVHADSSGARREGTIVRILERGVTEVVGTYTESKYFGFVIPDDKKIVNDI
FT                   FIPKHAANGAVEGHKVVVRLTSYPQGRMSAEGEVVKILGHKNDPGVDILSIIHKHGLPL
FT                   QFPDEVLEHANRISDTISEKDLQGRRDLRDQMIVTIDGEDAKDLDDAVTVTKLANGHYK
FT                   LGVHIADVSYYVEEGSPIDREAYERGTSVYLVDRVIPMIPHRLSNGICSLNPKVDRLTI
FT                   SCEMEINERGEVVSHEIFQSVIRTTERMTYSDVNKILVDKDEELRKKYAPLVPMFELMA
FT                   ELAEILRNKRMKRGAIDFDFKEAKVLVDENGKPYDVVLRERSVAERLIEEFMLAANETV
FT                   AEHFHWLNVPFIYRVHEDPKPEKLQRFLEFITNFGYVVKGTGNQIHPRALQEILEAVRG
FT                   EPEEMLISTVMLRSMKQARYDAESLGHYGLSTDFYTHFTSPIRRYPDLIVHRLIRTYLI
FT                   NGQMDEQTQQKWAEKLPDIAAHASNMERRAVEAERETDDLKKTEFMEDKIGMEFDGIIS
FT                   SVTNFGLFVELPNTIEGLVHVSYLTDDYYHYDERSYAMIGERTGKVYRIGDQITVRVIN
FT                   VNKDERIVDFEIVGMKDRRRKEPKHAPVVIEGKKRKKRNKDEKTKKAKKFYEDIPKLKA
FT                   KKKKKKKK"
FT   gene            460556..461023
FT                   /locus_tag="GY4MC1_0423"
FT   CDS_pept        460556..461023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0423"
FT                   /product="SsrA-binding protein"
FT                   /note="KEGG: gwc:GWCH70_2954 SsrA-binding protein; TIGRFAM:
FT                   SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73263"
FT                   /db_xref="GOA:A0A0F6BIL2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL2"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ADP73263.1"
FT                   /translation="MPKGEGKLIAQNKKAHHDYFIEETYEAGIVLKGTEIKSIRAGKVN
FT                   LKDSFAKVEKGEVFLHNMHISPYEQGNRYNHDPLRTRKLLLHRREINKLIGYTKEQGYT
FT                   LVPIKLYIKNGFAKVLLGVGKGKKKYDKREDMKRKEAQREIERAFRERQKI"
FT   gene            461126..461477
FT                   /gene="ssrA"
FT                   /locus_tag="GY4MC1_R0043"
FT   tmRNA           461126..461477
FT                   /gene="ssrA"
FT                   /locus_tag="GY4MC1_R0043"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 258.15"
FT   gene            462021..463310
FT                   /locus_tag="GY4MC1_0424"
FT   CDS_pept        462021..463310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0424"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="KEGG: hmo:HM1_2081 signal transduction protein,
FT                   putative; PFAM: EAL domain protein; SMART: EAL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73264"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL3"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADP73264.1"
FT                   /translation="MADQLASIMLLADSLNSENLTAKIDKYLNKHPVGLIYLDIKRFRE
FT                   IEKRHGPIACQKLLEVWKQLIFEAEMSDSFGLLTHRMFGDDVLLFVRAERGDANWAKMG
FT                   LLRLAHEISTMFGKKLNESIALSGDSIELYAGTAVLDPSTGRTAESLLYDAIKEAIHEA
FT                   RSKTDAEFRHLQMEFRDILARRKIAAHYQPIISLSTGSIYGYEALARGPQASYFATPNR
FT                   LWEFAEKENQLYALETAARQRAIEGFLPHDSNWKLFINLNANVIHDPQFTPGQTLAFLE
FT                   KMNLTPQNVVFEITERQSIDDYASFTKALDHYRNQGYQIAIDDAGAGYSSLQAIAELRP
FT                   DYIKIDRSIIHHIGCDKIKEILLETLAGFAQKINCQIIAEGIETFEELEIVRRLGVHFG
FT                   QGYLLGRPCPQLQPVPDAVLKWIQRYSSTV"
FT   gene            463680..464243
FT                   /locus_tag="GY4MC1_0425"
FT   CDS_pept        463680..464243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0425"
FT                   /product="3D domain-containing protein"
FT                   /note="KEGG: hypothetical protein; PFAM: 3D
FT                   domain-containing protein; Peptidoglycan-binding lysin
FT                   domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73265"
FT                   /db_xref="GOA:A0A0F6BIL4"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL4"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADP73265.1"
FT                   /translation="MKKLLLSITSSFFLAFGFSGAASAAGTYQVKSGDTLWNIAKKHKV
FT                   TVSQLKSWNNLKSDLIKPKQVLKILGTTTKAAAKTTVKKEAAKTAAYKTITVKAYAYTV
FT                   NCKGCSGITATGLNLKKNPSLKVIAVDPKVIPLGSKVYVEGYGYAVAADKGGGIRGNKI
FT                   DVFMPTKAKAIQWGVRTVKVKVYK"
FT   sig_peptide     463680..463754
FT                   /locus_tag="GY4MC1_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            complement(464309..464455)
FT                   /locus_tag="GY4MC1_0426"
FT   CDS_pept        complement(464309..464455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73266.1"
FT                   /translation="MFIEGRYTRNLGGKGSLSVSLLSSAAKIKAQNLLYFIYPSEFMKL
FT                   SKL"
FT   gene            464680..465297
FT                   /locus_tag="GY4MC1_0427"
FT   CDS_pept        464680..465297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL6"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0411"
FT                   /protein_id="ADP73267.1"
FT                   /translation="MLLALILIGGCEMDSKAQPEKLPDTVAFQDEFTREFMVSPKEVKE
FT                   GYYLFKSKTGGFTMLYPKNAKIDRMFYEKHKKYYESIHLGGGRERENISNYIRMTYENA
FT                   KITENIDVNLDLLSTYVHYNGKYTKFESNNNMIYFGKNEQHISNNDIIYYFFSYVKSKH
FT                   SHQAVRFIYAVTCKDAKQKCSIDVKKEEERAKMFMKSIKFQY"
FT   gene            465297..467264
FT                   /locus_tag="GY4MC1_0428"
FT   CDS_pept        465297..467264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL7"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0414"
FT                   /protein_id="ADP73268.1"
FT                   /translation="MEGAEEFVSNEEVLNTDILRARIMNVEYQNLTISEIKREIRRIYI
FT                   EETGKEPPANITIYRSDDFKNLNDIDSGFDGTVIHFYDEEKGINQSYTITRGSEAPEKD
FT                   TWKPLDWTYNVFGIFVGQNRSQYDAALRFDQIVTQKINEKIGRSDNKIKLKKIGLGHSL
FT                   GGNLNETIQLTEKRYEKVYVINDAPPSFYQLATIDEYFWGQLVKKFNLNFDHYEEIYSI
FT                   PPSKLKSFAEEYYKKQIDERSIYHLTAEEDLLYAVSGVRGFIDIGSRQFIDTNKGFTSI
FT                   KDLIAKISDKDVRAIQLYLSQYSDVYNEKGFDGVVQAMTGGDIAFIESLQGYDSMDYVW
FT                   HAGDIVSKANHMLDDMKVKIPELMKNVAILYKNLDPIFSVFVELGYVTPEEKKTVLSEV
FT                   KGIEKDVASIQQLLRKTWNWRMAIPFLTPLVTDDILQWKASIEVLFQIRDKVLDILKRL
FT                   QIIQENTKNLQNAITISVNAHSLNDVIMALARSKGRTYDKYGNLILIKKVGDHEIRMNL
FT                   SSAVRIYQKGLQILEEKETVLHEMKQRYFDEYVEDFEMQKRKLLNKINDMEQNPWAYQH
FT                   LLGHFTYDAEQVHVLRRIDVHESIPPLDPMIPHIFETMFSYYEQEISKGKELIATIKKS
FT                   FEEFFEQDQNVSKIFDLRYG"
FT   gene            467280..467612
FT                   /locus_tag="GY4MC1_0429"
FT   CDS_pept        467280..467612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL8"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0415"
FT                   /protein_id="ADP73269.1"
FT                   /translation="MGQLNMFYHFDVEQDFMYKANTFIQQLNRMSELDAELVHLIHQEM
FT                   KYGRGQIIDKTNEAVEQYQKRNLLSNDLYKNSMNTAAQRYTNMINDMRGQHITLYYDVI
FT                   IREKKR"
FT   gene            467678..468679
FT                   /locus_tag="GY4MC1_0430"
FT   CDS_pept        467678..468679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73270"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIL9"
FT                   /inference="similar to AA sequence:KEGG:CA_C3721"
FT                   /protein_id="ADP73270.1"
FT                   /translation="MVLSRTEGRMIMKTYRAVLAAITMLVSLVLFGCTHEETRSKKPGE
FT                   ESETRVKIPSDKELIAIIDDNLKAFDEGNVDKYMETIHTQSPLYEQSRKLVEEISKAYK
FT                   LKTEISNVEVMEKSEKEAKVKFTQKTVKIEGPAFRDNEITGYHVLRPEKGTWKIYNTVM
FT                   TKSVFLDENGNPLETNGQDGKNQIEQMDLKFDERKWVLDHFDSANGESIWEFVLEGESV
FT                   ENWTELYTIHRFEKMNSTVGLKSWLEAYKQALAEATNGHFTFHTFESTGQEEIYEFIVK
FT                   DAKVQDDQHEVARLFAQGDDLYLVRYTKLGEAMPDKTRDEWIQRLKQFKAQK"
FT   gene            469173..469466
FT                   /locus_tag="GY4MC1_0431"
FT   CDS_pept        469173..469466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73271"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM0"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0416"
FT                   /protein_id="ADP73271.1"
FT                   /translation="MSGVIRLTPEELRGVARQYNTESSNVTELISRLDQMSNVLQGIWE
FT                   GASSEAFIQQYHELRPSFEKMAVLLNEIAQQLHNSATILEETDQQIASQIRG"
FT   gene            469546..469785
FT                   /locus_tag="GY4MC1_0432"
FT   CDS_pept        469546..469785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0432"
FT                   /product="protein of unknown function ubiquitin-like YukD"
FT                   /note="PFAM: protein of unknown function ubiquitin-like
FT                   YukD; KEGG: gtn:GTNG_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73272"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM1"
FT                   /inference="protein motif:PFAM:PF08817"
FT                   /protein_id="ADP73272.1"
FT                   /translation="MYIQVTIDLRHYTEDVFDLRLSNFYSIKKLIDIVWQLKSISAPPR
FT                   EGYWVRVDNKQMVCPGYFTLKDSGITDGDRIVIL"
FT   gene            469819..471159
FT                   /locus_tag="GY4MC1_0433"
FT   CDS_pept        469819..471159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0433"
FT                   /product="Protein of unknown function EssB"
FT                   /note="PFAM: Protein of unknown function EssB; KEGG:
FT                   gtn:GTNG_0418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73273"
FT                   /db_xref="GOA:A0A0F6BIM2"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM2"
FT                   /inference="protein motif:PFAM:PF10140"
FT                   /protein_id="ADP73273.1"
FT                   /translation="MEEKKTYLETQIDAVMTKDKHYTIIFQRAKLRMQHPLELQIVKEI
FT                   DSYLLRDIDISEDEVKITITPPASCFPFPVVRKKSLLSRLRAAYQLVTKVKNHSRRRFI
FT                   LIVCPENLVFDHGLEPFFLHVGIKESLPPYEPDEARLLQEVKATVLALTDGQYQFEEYL
FT                   KFHETLKYSAIAKEMLQAENLETLLSILERWMDEEEAKEQSSVHIPKRKWNVQRYIFFS
FT                   IVALLIPAIIYMFYSVFFLQPKQKAYVQSAELFLQNKYSDVITALENYPPEKMPYVVQY
FT                   ELASSYVMTESLTEEQRKVVLNNITLKTDPQYLLYWIYIGRGRSEEAIELARAMEDREL
FT                   IVYGLLKHREEIKADEKLSGEEKKQKLEEIDREIEEYKREREEQEQQSEEEEKQEEPNQ
FT                   QQPPAQQPAATPPASTAPNQQQSTTPAPNHTPPASNSVPPNNVETKQ"
FT   gene            471203..475642
FT                   /locus_tag="GY4MC1_0434"
FT   CDS_pept        471203..475642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0434"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; DNA transporter;
FT                   KEGG: gtn:GTNG_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73274"
FT                   /db_xref="GOA:A0A0F6BIM3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM3"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADP73274.1"
FT                   /translation="MSQLWIFYEDICQLFPLTGQEDCVFIGNKLEHDVTIPSFLFRNGY
FT                   MEIRKQTDASVMVVLQGDKRIGELKPCVPVTVDEDGQTITVVWLDEEIKQHIYYVGNKT
FT                   ELMAAPDPQADIQTKTARVSFVKQKGEWFVIPNRSSPLFLNGVKISDAVSLQNGDVILC
FT                   PYVQFVFLEDDLLSVTSGQEIASSLTETVPPVSEMKKKYPVYHRTPRMIYELPSEKVAI
FT                   SFPSQEGDGDQRGLWLMILPPLLMLLVMGIIAFIQPRGIFILISIVMFATTLVTSTVQY
FT                   FRERKNRKTRKEKRRRIYTNYLTQKREELHALSEKQRNVLYYHFPSFEKMKSLALQISD
FT                   RIWERTMESDDFLHLRIGKADVPSTYEVSVSMGDLANREIDDLLEQAQQMARTYQTVKN
FT                   VPLTIDLSSGAMGMIGKAAIVNHEIQQLVGQIAFFHSYHDVRFVAIFSEKDYKDWEWMK
FT                   WLPHFQLPNSFAKGFIYNEQTRDQLLSSIYEMLRERDLDEEKEKKRFSPHFVFIVANRS
FT                   LIAEHVILEYLEEKNEEVGISVIFASDTKESLTENIHTLVQYINERDGEILIQHRKAAH
FT                   IPFTLDEHTREGNERFARLLRSLDHQRGMHNSIPEKVTFLELLQVKKAEEIKIKENWMI
FT                   HQPSRSLAVPIGLKGKKDVVELNLHEKAHGPHGLVAGTTGSGKSELLQTYILSLAVHFH
FT                   PHEVAFLLIDYKGGGMAQPFKNIPHLLGTITNIHGSKNFSARALASINSELKKRQRLFD
FT                   RYEVNHINDYMELYKQGKAKQPLPHLFLIADEFAELKSEEPDFIRELVSAARIGRSLGV
FT                   HLILATQKPKGVIDEQIWSNARFRISLKVQDASDSKEILKNGDAATITVTGRAYLQVGN
FT                   NEVYELFQSAWSGAPYMEEGVESEDEIYIVTDLGLVPVSNIDAEMKKNKKKQKTEIEMV
FT                   VQEIIKTQQQLGIEKLPSPWLPPLSSRLHRPALQERDTVYFPIGLKDEPELQRQSDYLY
FT                   QWMEDGNIGIFGSAGYGKSTTAMTLLMSFASVYSPEQLHYYIFDFGNNALLPLRQLPHT
FT                   ADYFRLDDEKKIEKFMKLMKEEIEQRKQRFMEKEVSTIKWYNTLSEEKLPIIFIAIDNF
FT                   DLVKEEMPELETQLIQYARDGQSLGIFLMITATRVSGVRPPLMNNLKTKIVHYFLDSSE
FT                   RFSIIGRTPYEVEPVPGRALIKKEQAVLTQIYLPADGEDDIAVLENMKEEIAKLTEKYK
FT                   SMRKPQPIPMLPAQLPFALFAKTYIVQQQPGLIPIGLDEETVHPVSLHIQTNPHCLVVG
FT                   QLRKGKTNVIKVILESLLAQPTAGIGLFDGVDRGLALYANKENVTYIETKEQMHHWLDE
FT                   ANGILQTREEEYLAAIGKTDVHVQAFSPVVFVADSLSRLQQSADSKIHERIAMMMKRYS
FT                   HLGFSVIVAGNANEFTKGFDALTTELKQVRQAILVMKKSEQSLFALPFTRHEPEVDPGF
FT                   GYFVANGKEQKIQIPKAE"
FT   gene            475662..478448
FT                   /locus_tag="GY4MC1_0435"
FT   CDS_pept        475662..478448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73275"
FT                   /db_xref="GOA:A0A0F6BIM4"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM4"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0420"
FT                   /protein_id="ADP73275.1"
FT                   /translation="MTEKWKIVKLIAKIVFIVALPVLFFTFIGHNPMKVTERTTNRIAV
FT                   VNEDVGADYNKKTYEFGKEIVPALDDDSDYQWSVVNRSQAEKGLADGQYDAVVYLPSDF
FT                   SRNILTFNEKKPLKATIQYKIQPNLEAKNREQVQRELEAAKNTINQKMSTLYWSYVGQA
FT                   VEDIRKKFSAILEKEIAFQKTMYDFYTPSSAKLTKEIESQKKMLEQLLSSSKNAESSSN
FT                   DTLKGLEQAEAEIASFIEDIQMYKEYQQRQHDIIQQGIRQYETMISGGLRSVVERPWNV
FT                   RPELELSSQTLLQSVSKLRNMVTDSHTALTSLYNQLENSNVYERLLESQKDLIRQYQQQ
FT                   TDAKILDEVQQKLIPLRQRLQSATAPSAPNEQPGPGELPQPSGNGQWLDRLEQQLASLK
FT                   TELRTAKPQLPQETKEGQDASGSWGDIDNAINQLEVEMQKAKEAWQKQLAFEQQWQEKY
FT                   AQLAKQLAALANNDSGQSEETVVQQIVEKEQAILQSPSLSEERKQQLSAQFQPAIQSRN
FT                   MNDLLAYFYWLSVFEDTLKRMENFDEALVDQLILNWKEKADIFQTLLNIHSGIYQLQDG
FT                   SATSLHGAEAVENNVHSFVEVTFEYDKNVKKMQAELMGQLQSLNDAANEVTAQLQQTMD
FT                   EEGTIQSTVGADNGEFVIAIQQNTLQDITQISDLVTSIAEGQDRIIDYTNEMHEKVASV
FT                   QGRADELNNKWATNVNTTKQIKNDVYRLLDNTMVDKQTNGYVYDYLTNPVQVSGDIPKE
FT                   KATYTPPVVMLVIVLLCGMLIGFFLHYYSSVPLMLQLALLIIMNLLVGFIISTYGLRIY
FT                   PMQEVQALKWSIFTIILLFFCSAIVRLAFFIGPFTGWVLGVGLILFFITPLLDLVLPNF
FT                   RFDHPISETYMSIQYGDQQAFYPAVITLGVVTVLMSAVPFLKQRLDALQKEAETYEG"
FT   gene            478438..478929
FT                   /locus_tag="GY4MC1_0436"
FT   CDS_pept        478438..478929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73276"
FT                   /db_xref="GOA:A0A0F6BIM5"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR020212"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM5"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0421"
FT                   /protein_id="ADP73276.1"
FT                   /translation="MKGRRRLMMFCFPFLCSVLAAMGMTVYAESDEWPEIEPNQYQRQD
FT                   IELRTDYLHEESLLDEKRDLPEVQTSLTFQRPASSFFERTKAQLFLSGEKETNTIAVKA
FT                   EKLRLFANTSTQSVPSRQPLDETERTSSSFLPWLFGFFIFGFLIVIFTVIVPRMKKFVP
FT                   "
FT   sig_peptide     478438..478524
FT                   /locus_tag="GY4MC1_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 29"
FT   gene            479090..479401
FT                   /locus_tag="GY4MC1_0437"
FT   CDS_pept        479090..479401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0437"
FT                   /product="Retroviral VpR/VpX protein"
FT                   /note="PFAM: Retroviral VpR/VpX protein; KEGG:
FT                   gwc:GWCH70_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73277"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM6"
FT                   /inference="protein motif:PFAM:PF00522"
FT                   /protein_id="ADP73277.1"
FT                   /translation="MASLLESIEKEWKRRAYEAMIHCLQSYQGQVEEAIEEFQHGTRAF
FT                   YRANDEYVPHWQGKSREAYEWVYEDLRQIETRIYATADDLLHEISREIARIRRKIEEL"
FT   gene            479403..480482
FT                   /locus_tag="GY4MC1_0438"
FT   CDS_pept        479403..480482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73278"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0294"
FT                   /protein_id="ADP73278.1"
FT                   /translation="MTTIRIKPEELETVAKHVPDAEDACRRARTSLSWELPSLVMEIPG
FT                   IGSAAIQELTDELLHWLRRYEEKLNEAEELLYRTAAAIRQADQTLADNMKEFGLELSGW
FT                   YDVQRLFGEYDPITGERISGWDRLVAGGMLLLNVIPPAKGAGIAGKAAVKGAKAAGATA
FT                   DVSKWISKTRNVLNVNKIKGAFQTIYYQVIKGPITETIRSFKHQWENFLENVGSVLQGP
FT                   QPALAGIGSTRGVWVSRAEKEVKETTMNIIGKTGDEVVGKGKGKINGNIKNIDKLKQVL
FT                   RDSKRVGDRLETILDDGSKVIFRRDVGEHAHPIGKKYRQPVDHYNVEIHVPTKSGRWKQ
FT                   KENFHIIIDNNGKVIEILD"
FT   gene            480499..480840
FT                   /locus_tag="GY4MC1_0439"
FT   CDS_pept        480499..480840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_1605 resolvase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73279"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM8"
FT                   /inference="similar to AA sequence:KEGG:Cbei_1605"
FT                   /protein_id="ADP73279.1"
FT                   /translation="MEDYIIINLENDDEDEFDLEGKNVAQIKVFNTKGEDITSNCRVIF
FT                   ELSEEALIGLGTELIRLSKRFKDGKHIHLVPSDKQFISQSMGIFLTSKSCEMIIGCTEF
FT                   GKIEDHLDD"
FT   gene            481184..481622
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0440"
FT   gene            481846..482127
FT                   /locus_tag="GY4MC1_0441"
FT   CDS_pept        481846..482127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIM9"
FT                   /inference="similar to AA sequence:KEGG:Aflv_2216"
FT                   /protein_id="ADP73280.1"
FT                   /translation="MNEDLKYDTFRYFLECYFNPSANYEELETIVKEFNLTEKSKYRQN
FT                   LQQELEQILQLDNWDDIQEFVRKHAMRKMNSDRLNWFIRTILYNLNQS"
FT   gene            482456..482617
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0442"
FT   gene            482638..482751
FT                   /locus_tag="GY4MC1_0443"
FT   CDS_pept        482638..482751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73281"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN0"
FT                   /inference="similar to AA sequence:KEGG:GK0782"
FT                   /protein_id="ADP73281.1"
FT                   /translation="MGDAQNIFNHFKLEGKVCLLQNKNTEFCKENVQSLIG"
FT   gene            482828..484356
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0444"
FT   gene            484328..485068
FT                   /locus_tag="GY4MC1_0445"
FT   CDS_pept        484328..485068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0445"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="manually curated; PFAM: IstB domain protein
FT                   ATP-binding protein; KEGG: gyc:GYMC61_2739 IstB domain
FT                   protein ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73282"
FT                   /db_xref="GOA:A0A0F6BMA2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BMA2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP73282.1"
FT                   /translation="MTRDIKEICKALHLAYIADRFEEVPYETKEQFLRDVLALEVSSRQ
FT                   EAKRSKLIKKAKFRELKWLKDYEWSDHIHWPSTTTKEELCDLVFLERRQNVLLLGSPGT
FT                   GKTHLATALGLKACEKGHEVRFFRVADLVAQLEEALKNGTLPRLKRQIETCELLILDEL
FT                   GYVPFQKQGSELLFHIIADCYERKSVIVTSNLEFGQWNRVFGDNRLTAALVDRLVHHAH
FT                   IIAFTGESYRLRHALSSVKKISSN"
FT   gene            485116..485657
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0446"
FT   gene            485996..486880
FT                   /locus_tag="GY4MC1_0447"
FT   CDS_pept        485996..486880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0447"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: gwc:GWCH70_0294 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73283"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN2"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0294"
FT                   /protein_id="ADP73283.1"
FT                   /translation="MLTIRVNPEELETVAKHVPDAEDGCSRARTSLSWELPSLVMEIPG
FT                   IGSAAIQELTDELLHWLRRYEEKLNEAEELLYRTAAAIRQADQTLADNMKEFGLELLGW
FT                   YDLQRVFGEYDPITGERISGWDRLVAGGMLLLSVIPPAKGAGVAGKAVIKGAKAAETAA
FT                   DVSKWISKTRNVLNVNKIKGALQTIYHQVIKGPITETIRSFKHQWENFLENVGSVLQGP
FT                   QLAADGVEVVPSGRMIGIAEESASSVRVSMSQAGDEVVGKGIGKGKNESPRNKPGVVSE
FT                   SFKFDRSLQSKQN"
FT   gene            486880..487230
FT                   /locus_tag="GY4MC1_0448"
FT   CDS_pept        486880..487230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0448"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: bcg:BCG9842_B0470
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73284"
FT                   /db_xref="GOA:A0A0F6BIN3"
FT                   /db_xref="InterPro:IPR003060"
FT                   /db_xref="InterPro:IPR037146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN3"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ADP73284.1"
FT                   /translation="MYNKGSIGIIPKEIRDKLVGKKFNSFDDFRKEFWKCVANSSYAKE
FT                   FRSRNIARMLEGNAPIAPKAEHYGKLKSYILHHKQPIERGGEVYNLDNMIITSPRMHQI
FT                   ILDPAYHFGKKG"
FT   gene            487254..487466
FT                   /locus_tag="GY4MC1_0449"
FT   CDS_pept        487254..487466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0449"
FT                   /product="Colicin immunity protein/pyocin immunity protein"
FT                   /note="PFAM: Colicin immunity protein/pyocin immunity
FT                   protein; KEGG: bsu:BSU06800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73285"
FT                   /db_xref="GOA:A0A0F6BIN4"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN4"
FT                   /inference="protein motif:PFAM:PF01320"
FT                   /protein_id="ADP73285.1"
FT                   /translation="MENKLSKEELIELVKKICDPKLSDEEVSEYIDILEKNVPHPAPSD
FT                   LIFWNDEELSPEEIVEIALNYKDRN"
FT   gene            487724..488617
FT                   /locus_tag="GY4MC1_0450"
FT   CDS_pept        487724..488617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi01315 YeeF"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN5"
FT                   /inference="similar to AA sequence:KEGG:BLi01315"
FT                   /protein_id="ADP73286.1"
FT                   /translation="MSIIPPAKGAGVAGKAGIKGLKAAETAAEVLKWISKTRNVLNVNK
FT                   IKGALQTIYYQVIKGPITATIRSFKQQWEQLLENVGSVLMGPQPALAGIGPARGVWMSG
FT                   AEREVKETTMNMIGKTGDEVVGKGTGKSTPTNTHTKVNYGEHYTRDGRRKVLKPNVEYT
FT                   TPAGYTYRTDDKGRIVNAEGKLNLGEAKRNNHAQKVAGREDRLLDDEGGHLIATIFKGS
FT                   GSLDNLVPMNGNLNKGEWKKLENMWRKQLEKGKLVEVKIKPVYKGESQRPVSFDIEYKI
FT                   GKGKWQYKEFQNKPGG"
FT   gene            488622..489104
FT                   /locus_tag="GY4MC1_0451"
FT   CDS_pept        488622..489104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0451"
FT                   /product="protein of unknown function DUF600"
FT                   /note="PFAM: protein of unknown function DUF600; KEGG:
FT                   bld:BLi01314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73287"
FT                   /db_xref="InterPro:IPR006728"
FT                   /db_xref="InterPro:IPR036170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN6"
FT                   /inference="protein motif:PFAM:PF04634"
FT                   /protein_id="ADP73287.1"
FT                   /translation="MDDLKLNNIYQKIAHTIIETIPEEWSKVFVYGEITEDVRTAFFYY
FT                   YPANGSTPIYSHDIPNIFAIEKEDYKKLWRQLLDNLEELWREFKNNGQDPWTNLTLIFD
FT                   NQGNFKIEYDYEDLSDADDHERSIIWEYKYLGLTPEDEDDKKFLEEYLNSIKENDQ"
FT   gene            489974..490876
FT                   /locus_tag="GY4MC1_0452"
FT   CDS_pept        489974..490876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73288"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN7"
FT                   /inference="similar to AA sequence:KEGG:GTNG_0423"
FT                   /protein_id="ADP73288.1"
FT                   /translation="MKQKKLLYRTAAAISQADQTLADNMKEFGMELSGWYDLQRVFGEY
FT                   DPVTGERISVGDRLFAGGMLLLSIIPPAKGAGVAGKAGIKGLKAAETAAEVLKWISKTK
FT                   NVLNVDKIKGAFQTIYHQVIKGPITETIRSFKKQWENFLENVGSVLMGPELAIDGVGAV
FT                   PSGRMIGIAEESASSVRISMSQVGGEVGKEAGGAVYKGTGKLSRRDQLLNQVTNKKLRN
FT                   TINEMFRPTATVGDGSLAAAVRLEAKKGILTGGKSHIQKAKERIRNLENILMKENLDPK
FT                   EREIANDLLIELKRALNGK"
FT   gene            490866..491255
FT                   /locus_tag="GY4MC1_0453"
FT   CDS_pept        490866..491255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_2115 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73289"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN8"
FT                   /inference="similar to AA sequence:KEGG:Gura_2115"
FT                   /protein_id="ADP73289.1"
FT                   /translation="MENRLEGIIIITVDVFTKKFLELFPEYQASYIEHIEFNGELLPHV
FT                   FFGETLNEDLPALINSGKEEKLRSIFDFIEFMLKKGDTDVQEVITLTILARLGDEPEIL
FT                   KKALKYMGTETRKASKEIETFWGRQ"
FT   gene            491469..492650
FT                   /locus_tag="GY4MC1_0454"
FT   CDS_pept        491469..492650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0454"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: gtn:GTNG_0322
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73290"
FT                   /db_xref="GOA:A0A0F6BIN9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIN9"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73290.1"
FT                   /translation="MSKSIPNVDWANQLESAIRQFVKEKLELIMREEIKNFLEIAQAET
FT                   SNMRNGYYQRTLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWRKRSSRCIKVAGV
FT                   RGNWQVYRTNSRKCLFSRDDQPYYRCRKGRHRKMAPSSTAQALFGLIFGRFVCETSPRY
FT                   GRERSHLCGVKGNEEGYREILDFFVGGQESAYVWQEILQQLYNRGVKEVLLGVFDGLPG
FT                   LEEAFQAVYPKTGVQRCVVHKVRSTLSRVQIHFRDTLSILHYTKFLTVPEKEMRYMNKE
FT                   EFVKLLHQSIIKENRNFYRDIFNNTDINEVTDPYWKEALMFYSELSDKNKEILFKIIEQ
FT                   VEVDAVSNILGVLDGVVSIGEEDIEFKVTINDNNEPINGDLQDLFLEYDEENR"
FT   gene            493158..494021
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0455"
FT   gene            494874..495272
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0456"
FT   gene            complement(495556..496791)
FT                   /locus_tag="GY4MC1_0457"
FT   CDS_pept        complement(495556..496791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0457"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   gwc:GWCH70_1766 transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73291"
FT                   /db_xref="GOA:A0A0F6BLG8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BLG8"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73291.1"
FT                   /translation="MAQYHITLNDELLHGLFTRDEGLAKLLEQVLNQILEAQVEEQLGA
FT                   RRYERTEERKGYRNGSYPRQLTTRVGRLTLRVPRTRDGEFSTELFQRYQRSEQALVLAL
FT                   MEMVVNGVSTRKITQITEELCGTSFSKSTVSSLCKGLDPIIQDWNYRSLHEHVYPFVLV
FT                   DAIYTKVREDGRVRSRAVLIATGVNEEGYREILGLQIGNSESESSWSEFFGWLKDRGLR
FT                   GVDLIISDQHGGLVQAIEKHFQGATWQRCQTHFIRNILDAAPKYMQDALLEEIRGILHA
FT                   PNKQTARLLLEQVLAKWEEKAPKAMQILEEGFEDATAVLDYPDRYRRRLRTTNGVERLN
FT                   EEIRRRERVIRIFPNRESVYRLVGAVLIEIDEKWMSGRKYLDMSEYWRWRKMKEQGVRS
FT                   VNQEAPAIKRVG"
FT   gene            497058..497300
FT                   /locus_tag="GY4MC1_0458"
FT   CDS_pept        497058..497300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0458"
FT                   /product="Protein of unknown function DUF2642"
FT                   /note="PFAM: Protein of unknown function DUF2642; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73292"
FT                   /db_xref="InterPro:IPR020139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP1"
FT                   /inference="protein motif:PFAM:PF10842"
FT                   /protein_id="ADP73292.1"
FT                   /translation="MTMNQPHYSYPSSPQLVALVDPYVYQTLQSIVGREVVVETARGSV
FT                   QGMLREVRPDHIILSSNRTTLFIRIQQIVWIRLTN"
FT   gene            497362..498258
FT                   /locus_tag="GY4MC1_0459"
FT   CDS_pept        497362..498258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0459"
FT                   /product="manganese containing catalase"
FT                   /note="PFAM: manganese containing catalase; KEGG: manganese
FT                   containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73293"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP2"
FT                   /inference="protein motif:PFAM:PF05067"
FT                   /protein_id="ADP73293.1"
FT                   /translation="MFTRIDKLAIELPEPKYADANAAAAVQELLGGRFGEMSTLNNYLF
FT                   QSFNFRQKKKLKPFYDLIASITAEEFGHVELVSTAINLCLTGSTHPGDPDIAPMRNAVD
FT                   KRNTYHFIATAQTAFPGDSMGKAWTGDYVFSSGNLILDLLHNFFLECGARANKMRVYEM
FT                   TDHPVAREMVGYLLVRGGVHIIAYAKALEVATGVDVTKMLPIPNLDNKKFDVARKFEEQ
FT                   GVHRRLYTFSDKYYKDIAQIWKGTHPLDGQPLEVIEGIPQGGPVPELAEIPEAFAPGVS
FT                   AEDFFEIAKRLQRSAGL"
FT   gene            complement(498465..499931)
FT                   /locus_tag="GY4MC1_0460"
FT   CDS_pept        complement(498465..499931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0460"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bld:BLi04113 KatA; PFAM: Catalase related
FT                   subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73294"
FT                   /db_xref="GOA:A0A0F6BIP3"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP3"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADP73294.1"
FT                   /translation="MADTKKLTTSWGAPVGDNQNSITAGNPGPTLIQDVHLIEKLAHFN
FT                   RERVPERVVHAKGAGAHGYFEVTNDMSKYTKAKVFNGVGKRTPVFVRFSTVAGELGSAD
FT                   TVRDPRGFAVKFYTEEGNYDIVGNNTPIFFIRDAIKFPDFIHTQKRDPRTHLKNPTAMW
FT                   DFWSLSPESLHQVTYLFGDRGIPLTYRHMNGYGSHTFKWVNEKGEAVWVKYHFKTNQGV
FT                   KNMDPELAVKIAGENPDYHTEDLYNAIEKGDYPSWTLYVQIMPLEDAKTYRFNPFDVTK
FT                   VWSHKDYPLIEVGRMVLNRNPENYFAEVEQATFSPGNLVPGVEPSPDKMLQARLFAYAD
FT                   AHRYRVGVNHNLLPINRPRVEVNNYQRDGFMRFDNNGGGSVNYEPNSFGGPTEVPEHKT
FT                   TPFPVSGVAESVPYDDDDHYTQAGDLYRLMSEEEKARLVKNIVESLKQVTKEEIKLRQI
FT                   RHFYKADPDYGRRVAEGLGLQIPDDVTTNA"
FT   gene            complement(500063..500962)
FT                   /locus_tag="GY4MC1_0461"
FT   CDS_pept        complement(500063..500962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gtn:GTNG_2993 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73295"
FT                   /db_xref="GOA:A0A0F6BIP4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP73295.1"
FT                   /translation="MIDIKQLKYFATIVEEGQITKAAKKLHMAQPPLSQQLKQLEETLG
FT                   ITLLERNGRKLELTAPGKILYKKAKQLLHQLEDAILEVREMEDGTSGVLSIGCVKSCFY
FT                   YLSEIIRPFHQLFPNVKFHLREGDSFSICELLRQREIDIGIVRLPIDSHHYEMIHLPND
FT                   PYIAVFPRQWNISKPYVYMKEFADIPLLLLHRIQGKGQYELVINECRRHGFEPKIICEC
FT                   PDATILLSLVSKGIGATIVPKSTVSFFCLPDICVLDIADSSIYAEAAAIIEKNRYIPKS
FT                   THHFLTILKEKFSNKIKN"
FT   gene            501168..502643
FT                   /locus_tag="GY4MC1_0462"
FT   CDS_pept        501168..502643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0462"
FT                   /product="4-hydroxyphenylacetate 3-monooxygenase, oxygenase
FT                   subunit"
FT                   /note="KEGG: gtn:GTNG_2992
FT                   4-hydroxyphenylacetate-3-hydroxylase; TIGRFAM:
FT                   4-hydroxyphenylacetate 3-monooxygenase, oxygenase subunit;
FT                   PFAM: 4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73296"
FT                   /db_xref="GOA:A0A0F6BIP5"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012687"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP5"
FT                   /inference="protein motif:TFAM:TIGR02309"
FT                   /protein_id="ADP73296.1"
FT                   /translation="MPAKTGKEYIERLKKAKSNVYIHGERVEDVTEHPAFKNVIQSMAR
FT                   LYDLQYEKQEKMLYTSPTTGNKVSITYIQPTTKEELIARREATQEWARTSAGMMGRSPD
FT                   YLNAEVMAMGVANDLFAEDDPMFAENARNYYEYARENDISLTHTLIHPQMNRSKAQHEQ
FT                   KDANVPLHLVEKRKDGIIVEGIRLLATQGGITDEILVFPSTVKKSGSGEDPYSLAFAIP
FT                   NNTPGVKFICREAFDYGKSHWDHPLGSRFEEGDAIVSFENVFVPWERVFICGNSSICNR
FT                   TFRETNAVVHMSHQVVAKNIVKTEFILGVVLCIMDAIGIEQFQHVKDKGTEIMLVLETM
FT                   RSHLYRAEHNAKLDKWGTMTPDFAALDAARNWYPRIYPRLAEIVRILGASGLMAIPAEA
FT                   DFNNEEIGAIVRRAMQGANIDGYERVQLFRLAWDMTMSAFGSRQTHYEYYFFGDPIRMG
FT                   MTYFDNYEKDYYKNLIYEFLGTPKLAHVSVNTH"
FT   gene            502669..503652
FT                   /locus_tag="GY4MC1_0463"
FT   CDS_pept        502669..503652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0463"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="TIGRFAM: 3,4-dihydroxyphenylacetate 2,3-dioxygenase;
FT                   KEGG: gtn:GTNG_2991 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73297"
FT                   /db_xref="GOA:A0A0F6BIP6"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR011981"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP6"
FT                   /inference="protein motif:TFAM:TIGR02295"
FT                   /protein_id="ADP73297.1"
FT                   /translation="MRFNIVRCARAVLRVTDLNASRDFYERALGFIVTEADSNHLYLRG
FT                   LEEYHHHSLLLKKAEQPSVEAISYKVYSEEDLEALYHFFQQKQLNPKWIETGQQHAIGR
FT                   SFRVQDISGLPLEFFVEMDTVERLLQRYDLYRGARVQRIDHFNCMVTDVQKAYDFYVKE
FT                   LGFACSEYTETEDRQLWAAWLHRKPNVHDVAFMNGRGPRLHHIGFWLSDQISLIHACDV
FT                   LASLGYASSIERGPGRHGLSNAFFLYLRDPDGHRIELYTGDYLTSDPDFQPIRWDINDP
FT                   RRQTFWGHQAPDSWFEEASTVLNIHNDQVVEATEPTLTKMKPTFII"
FT   gene            503712..503944
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0464"
FT   gene            503959..504471
FT                   /locus_tag="GY4MC1_0465"
FT   CDS_pept        503959..504471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0465"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: gtn:GTNG_2979 flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73298"
FT                   /db_xref="GOA:A0A0F6BIP7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP7"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADP73298.1"
FT                   /translation="MAVIMIKQGVKNVDDRTFRNAMGKFATGVTVITSSLNGQVRGMTA
FT                   NAFMSVSLNPKLVLISVGEKAKMNSVIQQTGKFAVNILSDQQQALSMLFAGQLKEERNV
FT                   EFAWMDGHPILPDSLANILCDVDISYIAGDHTLYVGKVTDIYMKEGDPLLFFAGKYCTV
FT                   AGLANGG"
FT   gene            504762..505679
FT                   /locus_tag="GY4MC1_0466"
FT   CDS_pept        504762..505679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0466"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /note="KEGG: gtn:GTNG_2990 dihydrodipicolinate synthase;
FT                   TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase;
FT                   dihydrodipicolinate synthase; PFAM: dihydrodipicolinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73299"
FT                   /db_xref="GOA:A0A0F6BIP8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR012691"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP8"
FT                   /inference="protein motif:TFAM:TIGR02313"
FT                   /protein_id="ADP73299.1"
FT                   /translation="MAYEEMKQRLKGSIAPVITPFDSEGNIDFETMKKLIDWQIENGSH
FT                   GISVTGTSGEPSSLTIEERKKVMETAKKAVNGRVPFIPATGSTNHAETLELTKFAQEIG
FT                   ADAAMVIVPYYNRPSQQALYKHFKAVADSVDIPIIIYNIPGRTAVNLEVRTMARLVEDC
FT                   PNIIGAKESNKDFEHVNRVLLYCGRDFLLFSGIELLCYPMLAIGGAGSISATANVTPAK
FT                   VAEMHNAWFEGDVERAQNLHFELMELNDILFIETNPGPVKAALGMMGKITPKLRLPLDL
FT                   PSEEVQEKIRQTLVKYNLLTEVTS"
FT   gene            505704..506519
FT                   /locus_tag="GY4MC1_0467"
FT   CDS_pept        505704..506519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0467"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase, HpaG1 subunit"
FT                   /note="KEGG: bcy:Bcer98_0971 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase, HpaG1
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG1 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73300"
FT                   /db_xref="GOA:A0A0F6BIP9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIP9"
FT                   /inference="protein motif:TFAM:TIGR02305"
FT                   /protein_id="ADP73300.1"
FT                   /translation="MAKAVFKIAGISYMMESEVDPERNTVIIDGKEYSANQLQWEAPVS
FT                   GAIYGVLLNYKGEWEQFREQMTKPPYHHPPNAPILYMKPSNTVNVHGGCIPLPDDVPEL
FT                   QVGAALGVVIGQTATKVAKERAFDYISGYTIVNDVTIPHETIYRPAVKERARDGFTPVG
FT                   PWVVEKKDVDDPDLLDIRVFVNDRLVQHNNTKHLMRSVASLLADITEFMTLYPGDVLLV
FT                   GVPERAPLVKAGDYVRIEIEKIGRLENTVVHERDWIKETGSHETRAHSV"
FT   gene            506494..507231
FT                   /locus_tag="GY4MC1_0468"
FT   CDS_pept        506494..507231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0468"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /EC_number="5.3.3.10"
FT                   /note="TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit; KEGG:
FT                   bcy:Bcer98_0972 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73301"
FT                   /db_xref="GOA:A0A0F6BIQ0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ0"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ADP73301.1"
FT                   /translation="MKRARIAFNGAVYEAVVEESGLLKLSNGRAVKEEEVTWLPPVEPR
FT                   TIFALGLNYAEHAQELSFSAPKEPLIFFKGRNTLIGHRGETPRPSDAAFMHYECELVVV
FT                   IGKMARKVKAEEAYEYVQGYTIANDYAIRDYLENYYRPNFRVKNRDGCTPIGPWLVDKE
FT                   DIDDPMNLTLRTYVNGKLVQEGNTKDMIFNIPALIEYLSSFMTLNAGDMILTGTPKGAV
FT                   NVNVGDEVVTEIEPIGRLMNKIV"
FT   gene            507248..507634
FT                   /locus_tag="GY4MC1_0469"
FT   CDS_pept        507248..507634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0469"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: gka:GK3029 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73302"
FT                   /db_xref="GOA:A0A0F6BIQ1"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ1"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /protein_id="ADP73302.1"
FT                   /translation="MPHFILEYTDNIAKEANIHELLRKVHQVLISRSDLFPIGGIRSRA
FT                   IELKEYYVADGTEDDAFVHGTLKIGAGRSEADKQAVCKEIFNVMKDHFSALYEKRYLAL
FT                   SLELYEFSESGTYKHNNIHRRYQE"
FT   gene            507657..509171
FT                   /locus_tag="GY4MC1_0470"
FT   CDS_pept        507657..509171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0470"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /note="KEGG: gtn:GTNG_2986
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; TIGRFAM: 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73303"
FT                   /db_xref="GOA:A0A0F6BIQ2"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ2"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ADP73303.1"
FT                   /translation="MAGKIGNVLHYINGEFVEGASGNYFENVNPFTNEIINEVAEGWKE
FT                   DIDAAVRAAKEAFDNGPWRTMSVQERMTYILRIADLIEKYAEEISYLESLDTGLPISQT
FT                   KKQAARAAENFRFYAEMVKSRMVGEAYHVDGQFLNYTIYKPVGVAGLITPWNAPFMLET
FT                   WKVAPALATGNTVVLKPAEWSPLTANKLAEIIHEAGLPQGVFNVVHGFGETAGASLVAH
FT                   PNVRLISFTGETTTGSEIIKNSADTLKKTSMELGGKSPVIVFADADVEKALDAVVWGIF
FT                   SFNGERCTANSRLFLEKSIYDSFVEKLKERVNNISIGDPMDPATEVGPLIHRKHWETVM
FT                   NYIEIAKQEGAEVYSADVPEELKKGNFVPPTLLLNCHNSMKVAQEEIFGPVMAVMPFET
FT                   EEEVIRMANDVKYGLAAYVWTNDIKRGHRVAQSIESGMAWVNSQNVRDLRIPFGGTKYS
FT                   GIGREGGHYSFDFYTEVQVIHVSIGDHSIPKFGKIKQHSAASAQRG"
FT   gene            509225..509869
FT                   /locus_tag="GY4MC1_0471"
FT   CDS_pept        509225..509869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: transcriptional regulator, GntR family; PFAM:
FT                   GntR domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH; GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73304"
FT                   /db_xref="GOA:A0A0F6BIQ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADP73304.1"
FT                   /translation="MEPKTKNKTQIAYEYILSRIESGVYGPGYRIIIDQIARELSLSSI
FT                   PVREAIRQLEAEGWIQYKPYTGAIVSNINEKEYLETLSVLAVLEGYATALSSSNMKEGM
FT                   IQQLAELNKKMEQALHEFDFEQFSELNYEFHALIYKHCGNAYLEEQIKQIWQRMKRIRA
FT                   YGFTFVPQRARESIKEHEEIIRLLKEQAPRNEIEDFVRQHKLNTAEAFKNR"
FT   gene            510094..511263
FT                   /locus_tag="GY4MC1_0472"
FT   CDS_pept        510094..511263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0472"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gka:GK3026 branched amino acid ABC transporter
FT                   (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73305"
FT                   /db_xref="GOA:A0A0F6BIQ4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADP73305.1"
FT                   /translation="MRRFLSAMISIFCVFILASCGKEPSNASKSEVIKIGGIFSASGGA
FT                   APLGKPEMGTVKMLVKELNENGGVNGKKIELIAYDDKSDQNEAVLSTKKLIEQEKVTAI
FT                   IGGTISGNSLAMIPQIEKAGIPYISLAASKQIVQPDDHSPRNWTFKTAQGDDIVISKLL
FT                   GYLKENGLQKVAWLNVANAYGTSGHEEFKRFAPDYGIKAVIEEEFEATVDDAKAMLTRV
FT                   KKANPQAIIVWGTAQESAVITKNIHQLGINVPVIESHGIGTKSFIDLAGEAAEGVIFPV
FT                   GRILVAEQLPDSDPQKETLLKYKKDFEKAYNYEPTTFGGHAWDAFHLLINAIKEAGTDK
FT                   EKIKEKLENTKNFVGISGIFNMDKNDHTGLAADSLVMVKIKDGKFVLAE"
FT   sig_peptide     510094..510159
FT                   /locus_tag="GY4MC1_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.866 at
FT                   residue 22"
FT   gene            511342..512223
FT                   /locus_tag="GY4MC1_0473"
FT   CDS_pept        511342..512223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0473"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gtn:GTNG_2983 branched chain amino acid ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73306"
FT                   /db_xref="GOA:A0A0F6BIQ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP73306.1"
FT                   /translation="MDIWNQFVQLLFSGLTVGSIYALVALGFVITYSITGILNLSQGDF
FT                   AMLGALICISFVNSGFPFIIAILLSIVLVMIIGGLFERSAIHPARYSSTATLIIITIGA
FT                   AFVFRGIAIFVWGTQPYALRPFTGNDSLQIFGAVIQTQNIWAIGISLVSLAVLYFFFNK
FT                   TYMGKAVTACVVNPFAARLMGIQPRKMSFGAIVISAGLGALAGIIIAPISGASYDMGVM
FT                   IGLKAFIAAVIGGLTNAPAAIAGAFIIGILEAFTEGYFSSGYKDAISFGLLLLVLFFMP
FT                   NGIFAKASGKRV"
FT   gene            512236..513300
FT                   /locus_tag="GY4MC1_0474"
FT   CDS_pept        512236..513300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0474"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gka:GK3024
FT                   branched amino acid ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73307"
FT                   /db_xref="GOA:A0A0F6BIQ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP73307.1"
FT                   /translation="MGLDVKKIYNGSTKGSLLVAVVLLVLPLVFSTNNYLLSTMIMIGF
FT                   YTIVSTGLTLLMGYAGQISLGQAAFYGIGSYTSAYFTTHFGLSPWLAMIAGAVLAAMVA
FT                   FVIGIPAFRLREHYLALATLGFGVIVFTFFKEWKEITGGLNGFFGIPPIRLFGITIQTD
FT                   FQFYYLVWVFALAGILFARNIVRSRVGRALLSIHGSEVAANSLGVNITKYKLQMFMISA
FT                   VYAAIAGSLYAHYVTFINPQLFEMITSIYFLIMVVIGGNGSIWGGLIGATVYVCLGELL
FT                   KEIVPLFIPNASGEFEIVFFGILLVMMLIYMPNGLSHSISKIVKRLLPDWRRKNESMLV
FT                   SENENAGSVGGERL"
FT   gene            513297..514073
FT                   /locus_tag="GY4MC1_0475"
FT   CDS_pept        513297..514073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0475"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73308"
FT                   /db_xref="GOA:A0A0F6BIQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73308.1"
FT                   /translation="MKENVLLQVHQLSKSFGGVHAIQGVSFHVHAREIVAVIGPNGAGK
FT                   TTLFNVITGILRPTSGSIVFKGVSVVGKKPFQLAQLGMTRTFQNLQVFGNMTVIENVMV
FT                   GLHTRLKTGIFSAGFRLPRVSKEEKQALEQAFACLRQVGIEHLAFEKADILPYGMQRLV
FT                   ELARAAASNPSLILLDEPMAGLNPQESNKLVEVLLEMRSNGMTFLFVEHDMETVMSIAD
FT                   RIIVLDYGKKIAEGSPEEIAQHPDVIKAYLGEEEVI"
FT   gene            514074..514820
FT                   /locus_tag="GY4MC1_0476"
FT   CDS_pept        514074..514820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0476"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_2980 branched-chain amino acid ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73309"
FT                   /db_xref="GOA:A0A0F6BIQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73309.1"
FT                   /translation="MLTLNHLHVYHGHLHVLKGIHLQIGKGEIMAIVGANGAGKSTLLG
FT                   TIAGIYLPKEGEMIFENEVLPYGKVEQIVKKGICLVPERRQIFDDLSVKDNLLLGAYHR
FT                   YRHDFRQVMRDYENVLDVFPKLKTMLDRPGGLLSGGEQQMLAIGRGLMAKPALMMLDEP
FT                   SLGLAPLIVKEIMKLLEQLRDQFGMTILLIEQNVRAALQIADYACVLDRGEIVIQGKAD
FT                   ELLRDERVKNAYLGIQRKTLENTKHR"
FT   gene            complement(514938..515504)
FT                   /locus_tag="GY4MC1_0477"
FT   CDS_pept        complement(514938..515504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0477"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gka:GK3020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73310"
FT                   /db_xref="GOA:A0A0F6BIQ9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIQ9"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73310.1"
FT                   /translation="MYDIAIIGAGPAGASAAIFTAKAGKKTVLIDNDKSITKRAWIENH
FT                   YGVVETTGPDLVETGKKQAAKFGAELVVGQATNIEKTENGFRIQTDNGTFEAKHVILAT
FT                   GIAVDLAEKIGVKTRQGTEPRIKTVIDADADGRTNIEGIWAAGTVAGVSVHTIITAGDG
FT                   AKVAINVISELNGERYVDHDVLQSK"
FT   gene            515960..516907
FT                   /locus_tag="GY4MC1_0478"
FT   CDS_pept        515960..516907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0478"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73311"
FT                   /db_xref="GOA:A0A0F6BIR0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR0"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73311.1"
FT                   /translation="MKKLFILFVILAVASLFIGVQHISLADLLMLKADDVEVLIISRIP
FT                   RLISIIIAGASMSICGLIMQQLSQNKFVSPTTAGTMDCARLGILVSLILFASAGPLLKV
FT                   TIAFLFAFAGTMIFMRILEKVKYKDAIFIPLVGLMFGNIISSMTTFFAYKYNLIQSISS
FT                   WLHGDFSMIIKGRYELLYLSVPLMIVAYMYANRFTIAGMGEEIATNLGLHYRSIVNVGL
FT                   IIVAATSSVVVLTVGTLPFLGLIVPNLVTLYYGDHLEKVLPLTALSGAIFVLACDIFGR
FT                   VVIYPYEIPIGLTVGVIGSGVFLYLLVRRRKQYV"
FT   sig_peptide     515960..516040
FT                   /locus_tag="GY4MC1_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.945 at
FT                   residue 27"
FT   gene            516900..517850
FT                   /locus_tag="GY4MC1_0479"
FT   CDS_pept        516900..517850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0479"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   gtn:GTNG_1273 ferrichrome ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73312"
FT                   /db_xref="GOA:A0A0F6BIR1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR1"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73312.1"
FT                   /translation="MSNKTKLIVLSIAALSLIMVFLFTNVKGNWDYVFRSRSEKIAAMV
FT                   LTGCAIAASTVIFQTITNNRILTPSIIGFDSVYMLIQTFVVFIFGSTTLTMMNANVQFL
FT                   VSVGFMVGFAVLLYSILFKQEEQTIYFLLLVGMIMGTFFQSVTSFMQFLIDPNEFFVIQ
FT                   DRMFASFNNMKTELLLVAGIVIALMIGYIVSYIRYLDVLSLGKEHAVNLGVPYEKTVKR
FT                   LLIVVAVLVSVSTALVGPITFLGFIVANVAYTFLQTYRHSYLLVGAMLFAVVALVGGQL
FT                   VVERVFTFSTPLTVIVNLIGGIYFLYLLLRERKAW"
FT   sig_peptide     516900..516974
FT                   /locus_tag="GY4MC1_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.441 at
FT                   residue 25"
FT   gene            517844..518602
FT                   /locus_tag="GY4MC1_0480"
FT   CDS_pept        517844..518602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0480"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_1274 ferrichrome ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73313"
FT                   /db_xref="GOA:A0A0F6BIR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73313.1"
FT                   /translation="MVEVRGVYKQYGGKNVVDNVSITIPTGKLTSLIGPNGAGKSTLLS
FT                   IMSRLIDKDRGEVRIEGKEISQYKSDELAKKISILKQSNHIAIRLTVKELVSFGRFPYS
FT                   RGRLTREDWEYVKEAIRYMELEDLQDCYLNELSGGQRQRAYIAMVLAQDTDYIFLDEPL
FT                   NNLDMKHCVQMMKVLRKLVDELGKTIVVVMHDINFASCYSDYIVALKNGKVVREGTASE
FT                   IMSNGVLQGIYDMDVHIETIHDKKICVYFA"
FT   gene            518725..519681
FT                   /locus_tag="GY4MC1_0481"
FT   CDS_pept        518725..519681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0481"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   gtn:GTNG_1275 ferric anguibactin-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73314"
FT                   /db_xref="GOA:A0A0F6BIR3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR3"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73314.1"
FT                   /translation="MLKKRWLPIFVAFFTAILLAACGNEDNAKNASSSNPKNDSEEITI
FT                   KHELGETKVKKKPEKVVVFDFGVLDSLDKLGVEVTGVPKANLPSYLEKYKDSKYENVGG
FT                   LMEPDFEKINEIAPDLIVISGRQANSYEKFAEIAPTVYMGIDTKNYIDSFANNMKTLGK
FT                   IFGKEKEVEKELESINKQIEAVKAKAEKTSGKALIVLTTGGKVSAYGPGSRFGIIHDVL
FT                   GIKPVDANIEVSTHGQSISFEYIAEKNPDYLFVVDRDAVVAGKPSAKQTIENELVKKTN
FT                   AYKNNRIIYLNPNYWYLAGGGLISVAEMINEVEKGIE"
FT   sig_peptide     518725..518796
FT                   /locus_tag="GY4MC1_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.577 at
FT                   residue 24"
FT   gene            519923..520486
FT                   /locus_tag="GY4MC1_0482"
FT   CDS_pept        519923..520486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0482"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: gwc:GWCH70_2947 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73315"
FT                   /db_xref="GOA:A0A0F6BIR4"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR4"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADP73315.1"
FT                   /translation="MKTKSLLLAALFAALTAIGGFIKIPIPYVPFTLQIAAVYLAGCLL
FT                   GPKLGMLSQLVYVLVGLAGAPVFAEGGGPSYVLQPTFGYLIGFAAGAYVNGWLMQIFQF
FT                   RKAATVFLANLSALFAVYLFGCSWLYIAMKWIVEKPLTIGQTLWFGFLLPVPGDLLLCA
FT                   VCSVLVARMLPRIHSVIRKQEVVS"
FT   sig_peptide     519923..519982
FT                   /locus_tag="GY4MC1_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.720 at
FT                   residue 20"
FT   gene            520486..521205
FT                   /locus_tag="GY4MC1_0483"
FT   CDS_pept        520486..521205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0483"
FT                   /product="dethiobiotin synthase"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   gwc:GWCH70_2946 dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73316"
FT                   /db_xref="GOA:A0A0F6BIR5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR5"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADP73316.1"
FT                   /translation="MGKAIFITGTGTEIGKTVATSFLTFVFQTLGLRTKIFKPVQTGLA
FT                   EDGVSFADQHWYEKVVELPQSEGLYYMEPAVSPHLAATLTNTTIDPALIAEKIEQWKRQ
FT                   YDIVLVEGAGGLAVPLIEKEQGFYMTNDLIRECNIPIIIVSLSGLGAIHHTVTTASYAQ
FT                   QQGIQVLGLIFNQFDPESIIHANNVQTIQKILKFPVIATLPSLADVSKHAMMALAERWL
FT                   EGNKQKQLLREVLSVEV"
FT   gene            521195..522562
FT                   /locus_tag="GY4MC1_0484"
FT   CDS_pept        521195..522562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0484"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   gwc:GWCH70_2945 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73317"
FT                   /db_xref="GOA:A0A0F6BIR6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR6"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADP73317.1"
FT                   /translation="MRYSYEQLEQWDKEYVWHPFTQMKTYVQEHPLIIERGSGSYLFDV
FT                   NGNKYLDGYASLWVNVHGHNDPELNEALHMQIETIAHSTLLGSANVPSILLAKKLVELW
FT                   PGLSKVFYSDTGAAAVEIALKIAYQYWQNIDPVRYAKKTAFVSLREAYHGDTIGAVSVG
FT                   GMELYHRIFQPLLFERIEVPSPYVYRMSEYGNEQEIVQYCLQQLEHVLASEQERVAAVI
FT                   VEPLVQGAAGIITHPRGFLKGVEALCRRYGVLLICDEVAVGFGRTGTMFACEQEQVTPD
FT                   IVCLGKGITGGYLPLAATLTTNQVYEAFLGEADENKTFYHGHTYTGNQLSCSVALKNIE
FT                   LMEKRQLVENVRKKAEFLAKKLEMLYELPIVGDIRQKGLMTGIEIVQDRNTKEIFPHSE
FT                   MIEHRIILEARKRGLIIRPLGPVLTFIPVLAMTEEQMETAVSILFDSIAEMAKAVR"
FT   gene            522696..522908
FT                   /locus_tag="GY4MC1_0485"
FT   CDS_pept        522696..522908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2944"
FT                   /protein_id="ADP73318.1"
FT                   /translation="MNDISLQDTRIWGFGRPWGFGGFGGFGRPFFGGPFFGSPFFGGFL
FT                   GGLLGGALTGPFYGGFGGYPYGPVW"
FT   gene            523069..523200
FT                   /locus_tag="GY4MC1_0486"
FT   CDS_pept        523069..523200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIR8"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2943"
FT                   /protein_id="ADP73319.1"
FT                   /translation="MVYPRVFFGGPFLGGFLGGLLGSALALPLYAHPRPYYPYFLYG"
FT   sig_peptide     523069..523164
FT                   /locus_tag="GY4MC1_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.829 at
FT                   residue 32"
FT   gene            complement(523359..524909)
FT                   /locus_tag="GY4MC1_0487"
FT   CDS_pept        complement(523359..524909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0487"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bca:BCE_2458 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73320"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BPB5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADP73320.1"
FT                   /translation="MYIYYNRDQLILPMDLEILIPKHHLCRIVDLAVEKMDPALLVSLY
FT                   PGGGRPAYHPKMMLKVILYAYANRIYSSRQIAKQLKENIYFMWLSGHQTPDFRTINRFR
FT                   SERMKDIIYETFFSIVDLLRQEGLVKLEDYFLDGTKIEASANKYTFVWRKSTEKYDQKL
FT                   EEKFRKIVASIEQVVKEDEESEQEGDFQEKLEASPITSEKIEAVIEQVEEHLKKEPKNR
FT                   TLKKAKQQLEQDILPRKKKYEEYKKVLGERNSFSKTDPDATFMRMKDDHMKNGQLKPGY
FT                   NVQIGTENQFITGFSVHQRAGDAGCFIPHLEQLAAYGRPMPKRAIADSAYGSEENYTYC
FT                   EKKQIVALIKYNTLDREQTKAWAKEIGRIENMTYDEELDEWICAKGERLVFVYKRKETT
FT                   DNGYVIVKRTYRCTACAGCPFQAACAKGKDTKTIRVSLKNQQQRQEIRKRLSTEEGATT
FT                   YRRRQIENEPVFGQIKHNQQFHRFSLRGLPKITLEWGLVCAAHNLRKWATTTDPTRKK"
FT   gene            complement(525064..525396)
FT                   /locus_tag="GY4MC1_0488"
FT   CDS_pept        complement(525064..525396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0488"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: gwc:GWCH70_2941
FT                   coat F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73321"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS0"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADP73321.1"
FT                   /translation="MNQNQVQNPETQVPKTPQMNDRDFLNDMLATEKYMTSSYSVFLHE
FT                   ASHQQLYQDMLNIFTETQNCQRELYNLMFQKGWYKLETADPQKLQQSYQQFQGYTSQFP
FT                   YQTTVQ"
FT   gene            complement(525417..525680)
FT                   /locus_tag="GY4MC1_0489"
FT   CDS_pept        complement(525417..525680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS1"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2940"
FT                   /protein_id="ADP73322.1"
FT                   /translation="MQQQMNTQQPSAMPQPPQIISTKDALYFTDMLSWNLLAMKKAHFF
FT                   ASQCQDKEVSAAIEKAGQMHQRHYQQILSHLQNTGRPKTPMQ"
FT   gene            525847..526764
FT                   /locus_tag="GY4MC1_0490"
FT   CDS_pept        525847..526764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0490"
FT                   /product="Proline dehydrogenase"
FT                   /EC_number="1.5.5.2"
FT                   /note="KEGG: gwc:GWCH70_2939 proline dehydrogenase; PFAM:
FT                   Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73323"
FT                   /db_xref="GOA:A0A0F6BIS2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS2"
FT                   /inference="protein motif:PRIAM:1.5.99.8"
FT                   /protein_id="ADP73323.1"
FT                   /translation="MEQVMRNFFLFLSKNKPLTRLAKKYGLRFGASRFVAGETIEQAVE
FT                   VIKQLNKKGLAVTVDYLGEFVDNEQEANDMADHCIEAIEAIHREKLDAQLSLKMTSMGL
FT                   DISEELVMRNMRRILDTAKLHDVFVTIDMEDYSRCQKTLDIFKRLKTEYDNVGTVLQAY
FT                   LYRTVSDIEDLKNYHPNLRLVKGAYKEPPEVAFPDKKDVDENFKKIIKMHLLNGNYTAV
FT                   ATHDDAIIEYTKRLVKEYNIPNSQFEFQMLYGIRPERQEQLAREGYTMRVYVPYGTDWY
FT                   GYFMRRLAERPANVAFVLKGVLRK"
FT   gene            complement(526942..527575)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0491"
FT   gene            complement(527637..528578)
FT                   /locus_tag="GY4MC1_0492"
FT   CDS_pept        complement(527637..528578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS3"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0868"
FT                   /protein_id="ADP73324.1"
FT                   /translation="MKKLKLFISILLMLTFFILPVSTTPTSKTTNEVSIPLSNSNPKSI
FT                   SIKMPGKTFEFIKSTSFTHIKAKDKNYYYKIKDKNEILANLRVTIRTIDNGDKFIFTRI
FT                   TNYSKQNIYTDLIIPLSNTTTYNLEKYSDRDKIIRQHDHVFGIDPTSYPIGVLNTYNKN
FT                   QTVASMMLGKNYISRQLVKRYSKTRASYVREFFEETDNYKIYLNSKTKSTFINLNLKTQ
FT                   SNSIGESWVLISNQPLFKNKNNMDYWMKRSIEEYISTHKWLTADGPYFKLPWSIEPATK
FT                   MGFGRNLGYMQGDDFVSTYSFTKERFFYNYDY"
FT   sig_peptide     complement(528507..528578)
FT                   /locus_tag="GY4MC1_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.699 at
FT                   residue 24"
FT   gene            complement(528946..529095)
FT                   /locus_tag="GY4MC1_0493"
FT   CDS_pept        complement(528946..529095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73325"
FT                   /db_xref="InterPro:IPR025625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS4"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2938"
FT                   /protein_id="ADP73325.1"
FT                   /translation="MAKLKKNPSERAVSAASVKGNAGPTVERDGGGKKTSQNQQYKRHN
FT                   MQSE"
FT   gene            529281..531665
FT                   /locus_tag="GY4MC1_0494"
FT   CDS_pept        529281..531665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0494"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   Enoyl-CoA hydratase/isomerase; KEGG: gwc:GWCH70_2937
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73326"
FT                   /db_xref="GOA:A0A0F6BIS5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS5"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADP73326.1"
FT                   /translation="MVKRIQKAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEE
FT                   EAKGLTLEHKEVRNRLANQALQKLLKQKPAPFMSKSNLALIETGNFADDFHRLAEVDWI
FT                   IEAVVENLEIKKSVFAMVDEVRKPGTIVSSNTSGISIETMAEGCSEDFKKHFLGTHFFN
FT                   PPRYLKLLEIIPTKDTDPEVVSYMKTFGEEVLGKGVVMAKDTPNFIANRIGTYGLLVTV
FT                   REMMKGGYSVGEVDSLTGPLIGRPKSATFRTLDVVGLDTFIHVANNVFEKVEGEEKEAF
FT                   RVPDFMKAMLEKGWIGSKSGQGFFWKQGKDILELNYETLEYEPRKKLTTPAVEASKQAK
FT                   KLNDKLKALVYADDRAGTFLWKIIAPVLLYSAKLLGEIADDIVAIDRAMKWGFGWELGP
FT                   FEMWDALGVEQSVRKMQAEGLDIPSWVTDMLAAGFPFFYKSEKGQVFYYDRGEYKQIHE
FT                   NPKVIHIKRLKEQRDVIKKNSGASLIDLGDDVALLEFHSPNNAIGTDIVQMINYALEEV
FT                   ERNYKGLVIGNQGKNFCVGANLAMILMEAQDDNYFEIELAVRQFQQAMMNIKYSTKPVV
FT                   AAPFAMTLGGGVEVCLPSSRIQAAAETYMGLVEVGVGLIPGGGGNKELYIKYLNSLPSG
FT                   VHFDLQQVANKVFETIALAKVSGSAAEARELNFLNQRDGITMNSDHLIHDAKQAVISLY
FT                   DQGYRPPVRKKVPVVGETGYAAMLLGAQSMYHSGYISEHDLKIAKKLAYVIAGGKVPYG
FT                   TEVDEQYLLDLEREAFLSLVGEPKSQARMQHMLVKGKPLRN"
FT   gene            531712..532884
FT                   /locus_tag="GY4MC1_0495"
FT   CDS_pept        531712..532884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0495"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   gwc:GWCH70_2936 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73327"
FT                   /db_xref="GOA:A0A0F6BIS6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS6"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP73327.1"
FT                   /translation="MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVRETLKRAGNY
FT                   EGNIDDLIIGCAMPEAEQGLNIARNIGALAGLPYTVPAITINRYCSSGLQAIAYAAERI
FT                   MLGHSDTIIAGGVESMSLVPMMGHVIRPNAKLAEEAPQYYMSMGHTAEQVAMKYGVSRE
FT                   DQDAFAVRSHQRAAKAIREGKFKDEIVPVEVTVRKVENNKLVEKTILFEEDEGVRPDTN
FT                   METLAKLHPAFSVNGTVTAGNASQMSDGAAAVMVMDREKAESLGLKLLGKFRSFAVAGV
FT                   PPEVMGIGPVAAIPKALKLAGLELSDIGLIELNEAFASQAIQVIRELGLDEEKVNVNGG
FT                   AIALGHPLGCTGAKLTLSLLYEMRRRNVQFGIVTMCIGGGMGAAGVFELI"
FT   gene            532954..534738
FT                   /locus_tag="GY4MC1_0496"
FT   CDS_pept        532954..534738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0496"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: gwc:GWCH70_2935 acyl-CoA dehydrogenase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73328"
FT                   /db_xref="GOA:A0A0F6BIS7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS7"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADP73328.1"
FT                   /translation="MAKALENAIKGGSFLIEDIPCERVFTPEDFTDEHKMIAKTTEDYV
FT                   VNEVLPQLEHLENHEFDRSVQLLRKAGELGLLSADIPEEYGGLGLDKISSALIGEKMSR
FT                   AGGFSISHGAHVGIGSLPIVLFGTEEQKRKYLPSLATGEKIAAYALTEPGSGSDALGAK
FT                   TTARLNAEGTHYILNGEKQWITNAGFADVFIVYAKVDGEHFSAFIVERGFPGVSTGPEE
FT                   KKMGIKSSSTRTLILQDVPVPKENLLGEVGKGHVIAFNILNIGRYKLGVGAVGGAKRAL
FT                   EITLQYANQRQQFKQPISKFSLTQEKFATMASRLYATESSVYRTVGLFDERMGLLDEEK
FT                   AKDGKEIAKSIAEYAIECSLNKFFATETLDYIVDEGVQIHGGYGFMQEYEIERAYRDSR
FT                   INRIFEGTNEINRLLVPGMYLKKAMKGELPLLQKAQQLQEELIMLAPEEVGDGVLEQEK
FT                   YLVRNAKKIALMAAGLAAQRFGPKLENEQEILVNIADIVANIYAMESAVLRTEKAINRS
FT                   GVEKNKQKLLYTQIFCQEAFNEIEAHAKETIVAVEQGDTLRMMLTALRKLTRYTPINII
FT                   AKKREAAAALIEAERYIV"
FT   gene            534793..535155
FT                   /locus_tag="GY4MC1_0497"
FT   CDS_pept        534793..535155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0497"
FT                   /product="arsenate reductase-like protein"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   gwc:GWCH70_2934 arsenate reductase and related"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73329"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS8"
FT                   /inference="protein motif:PFAM:PF03960"
FT                   /protein_id="ADP73329.1"
FT                   /translation="MSFTFYWYPKCGTCRKAKKWLDEHHIAVREIHIVDNPPAKEELTE
FT                   LYRKSGLPLKKFFNTSGMKYRQLGLKDKVNTASEEELLELLASDGMLVKRPILTDGNHV
FT                   IVGFNEEQYEKFFGQK"
FT   gene            535247..535630
FT                   /locus_tag="GY4MC1_0498"
FT   CDS_pept        535247..535630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0498"
FT                   /product="glycine cleavage system H protein"
FT                   /note="KEGG: gwc:GWCH70_2933 glycine cleavage system H
FT                   protein; TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73330"
FT                   /db_xref="GOA:A0A0F6BIS9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIS9"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ADP73330.1"
FT                   /translation="MNTPKELRYSEEHEWVRVEGDKVRIGITDFAQSELGDIVFVELPE
FT                   VGTEITANEPFGSVESVKTVSELYAPISGKVVEVNEALNDNPEYVNESPYEKAWMIVVE
FT                   PSDISEIDNLLTAEQYEAMVKEG"
FT   gene            536125..536475
FT                   /locus_tag="GY4MC1_0499"
FT   CDS_pept        536125..536475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0499"
FT                   /product="TOPRIM domain-containing protein"
FT                   /note="KEGG: gwc:GWCH70_2931 toprim domain protein; PFAM:
FT                   TOPRIM domain-containing protein; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73331"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT0"
FT                   /inference="protein motif:PFAM:PF01751"
FT                   /protein_id="ADP73331.1"
FT                   /translation="MIEIEKVIIVEGRSDKQKIEKIINEPVEVICTNGTISDAKLEELI
FT                   EELYYKDVYILVDADEAGEKLRKQFRREFPEAEHIYIDRTYREVAAAPNWHIAQVLLRA
FT                   NFNVHYDYLLKR"
FT   gene            536484..536804
FT                   /locus_tag="GY4MC1_0500"
FT   CDS_pept        536484..536804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0500"
FT                   /product="Thioredoxin domain-containing protein"
FT                   /note="PFAM: Thioredoxin domain-containing protein; KEGG:
FT                   gwc:GWCH70_2930 thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73332"
FT                   /db_xref="GOA:A0A0F6BIT1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT1"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ADP73332.1"
FT                   /translation="MKKLQLAEIDDILDKEETVCLFVYTPLCGTCQLAERMLEVVKELF
FT                   PGIPFYKTDINYMPERAVTWKIESVPCLLLFDGGNIVQKLYAFHSVTYLYETIKKIWAE
FT                   NR"
FT   gene            537025..537366
FT                   /locus_tag="GY4MC1_0501"
FT   CDS_pept        537025..537366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0501"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   gwc:GWCH70_2929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73333"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT2"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADP73333.1"
FT                   /translation="MHELIKQLTERMQKLNHLSPILPDEELYIQFECETETAVVAVSKH
FT                   SIEQKEAADERQVLTVRGSKEALEALLNGRLKLQQQIRLHEVNISGSFRHMLLLESLLH
FT                   LSKPYRHVC"
FT   gene            538036..539064
FT                   /locus_tag="GY4MC1_0502"
FT   CDS_pept        538036..539064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0502"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_2926 ABC transporter related; PFAM:
FT                   ABC transporter related; NIL domain; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73334"
FT                   /db_xref="GOA:A0A0F6BIT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73334.1"
FT                   /translation="MIILENVTKIYEASNGSVTAVDNVSLQIKEGEIFGIIGYSGAGKS
FT                   SLIRLLNGLEKPTKGKVVVAGRDIANIKGKELRKARQEIGMIFQHFNLLWSRTVRENIA
FT                   FPLEIAGVPKTQRKQRVDELIQLVGLQGREDAYPSQLSGGQKQRVGIARALANNPKVLL
FT                   CDEATSALDPQTTDSILELLVDINKRLGLTIVLITHEMHVIRKICDRVAVMENGKIVEQ
FT                   GEVLQVFRQPKQAITKRFVQQVVEPEETKETITHLLDRYPNGTVVQLTFVGEAAEQPLI
FT                   ANVVRQFQIDANILQGKISQTHQGSYGVLFVHMDGEKEEIARAIDYIRSQQVAVEVITD
FT                   AR"
FT   gene            539054..539722
FT                   /locus_tag="GY4MC1_0503"
FT   CDS_pept        539054..539722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0503"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_2925
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73335"
FT                   /db_xref="GOA:A0A0F6BIT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73335.1"
FT                   /translation="MLANLLPNVEWDMMWAATVETLYMTGIAVAVTFILGTILGLLLFL
FT                   TSKGNLWENRLANMIIAAAVNIFRSIPFIILIILLIPLTKWLVGTMLGANAALPALIIG
FT                   AAPFYARMVEIALREIDKGVIEAAKAMGASTATIIWKVLLPESLPALVSGITVTAIALV
FT                   GYTAMAGVVGAGGLGNLAYLEGFQRSHNDVTFVATVLVLIIVFVIQFIGDFVTSKIDKR
FT                   "
FT   gene            539739..540578
FT                   /locus_tag="GY4MC1_0504"
FT   CDS_pept        539739..540578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0504"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: gwc:GWCH70_2924 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73336"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT5"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADP73336.1"
FT                   /translation="MKKWLSALFAVVLVLALAACGGNNNASDGQEKGKLTKLVVGASNV
FT                   PHAEILEKAKPILKEKGIDLEIVKFQDYILPNKALADKEIDANYFQHIPYLESQKKEHG
FT                   YDFVNAGGIHIEPIGIYSKKYKSLDELPDGATIIMSNSVADHGRILSMLQEKGLIKLKD
FT                   GVDKTKATVKDIVENPKHLKFEADVDAGMLPQIYKNGEGDAVLINANYALDAGLDPAKD
FT                   PIAVESPKDNPYVNIIAVRKGDENRKEIKTLVEVLQSKEIQDFIKKEYKGAVIPAAQ"
FT   sig_peptide     539739..539819
FT                   /locus_tag="GY4MC1_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.671 at
FT                   residue 27"
FT   gene            541092..541307
FT                   /locus_tag="GY4MC1_0505"
FT   CDS_pept        541092..541307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73337"
FT                   /db_xref="GOA:A0A0F6BIT6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73337.1"
FT                   /translation="MLAVSETVASAKKCLHERMPEHEMKASLSGSFFVIFIDMLDKKFF
FT                   HYVYSDILYKRLLILFICYKIVMRIK"
FT   gene            541372..542151
FT                   /locus_tag="GY4MC1_0506"
FT   CDS_pept        541372..542151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0506"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: gwc:GWCH70_2923 FeS assembly
FT                   ATPase SufC; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73338"
FT                   /db_xref="GOA:A0A0F6BIT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT7"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ADP73338.1"
FT                   /translation="MAVLTIKDLHVSVEGKEILKGVNLEVKGGEIHAIMGPNGTGKSTL
FT                   SSAIMGHPKYEVTQGSITLDGQNVLEMEVDERARAGLFLAMQYPSEISGVTNADFLRAA
FT                   INARLGEGNEISLMKFIRKLDEKMEFLEMNPDMAHRYLNEGFSGGEKKRNEILQLMMLE
FT                   PKIAILDEIDSGLDIDALKIVSKGINEMRSSEFGCLIITHYQRLLNYITPDYVHVMMQG
FT                   RIVKSGGPELAQRLEAEGYDWIKKELGIEDETVEQEA"
FT   gene            542169..543482
FT                   /locus_tag="GY4MC1_0507"
FT   CDS_pept        542169..543482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0507"
FT                   /product="FeS assembly protein SufD"
FT                   /note="KEGG: gwc:GWCH70_2922 FeS assembly protein SufD;
FT                   TIGRFAM: FeS assembly protein SufD; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73339"
FT                   /db_xref="GOA:A0A0F6BIT8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT8"
FT                   /inference="protein motif:TFAM:TIGR01981"
FT                   /protein_id="ADP73339.1"
FT                   /translation="MTTETKIPFDQQYVRSFSGGRGEPDWLLQLRLQALAKAEELPLPK
FT                   PDKTKIDNWNFTQFANHIVERAPFASLDELPETVKALIEAGEGTKNLYVQRDHTPAFLA
FT                   LSEDLKAKGVIFTDIFTAAREHGDLLQKYLLKDGVKIDEHRLTALHAALFNGGVFVYVP
FT                   KGVEVDVPLQAVYIQESDDTALFNHVIVVAEDNSRVVYVENYISAKETSKAVVNIVAEV
FT                   FANTNARVFFAAVDNLAKGVTTYVNRRGIAGRDGRIEWALGLMNDGDTISENITRLIGD
FT                   GSFGDTKTVVVGRGEQVQNFTTSVVHYGKHTEGYILKHGVVRDSATSIFNGIGKIEHGA
FT                   SKSNAQQESRVLMLSEKARGDANPILLIDEDDVMAGHAASVGRVDPTQLYYLMSRGIPK
FT                   REAERLIIHGFLAPVVEAIPIESVKKQLIEVIERKVQS"
FT   gene            543479..544699
FT                   /locus_tag="GY4MC1_0508"
FT   CDS_pept        543479..544699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0508"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="KEGG: gwc:GWCH70_2921 cysteine desulfurase, SufS
FT                   subfamily; TIGRFAM: cysteine desulfurase, SufS subfamily;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73340"
FT                   /db_xref="GOA:A0A0F6BIT9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIT9"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ADP73340.1"
FT                   /translation="MNTKEIRRLFPILDQKVNGKPLVYLDNAATSQKPLSVIETLDRYY
FT                   REYNSNVHRGVHTLGTKATDAYEGAREKVRRFINAKSTQEIIFTRGTTAALNMVATSYG
FT                   RANLQEGDEIVITYMEHHSNLIPWQQAAKQTGATLKYIPLQADGTIDMKDVEATVTENT
FT                   KIVAIAHVSNVLGTINPIKEIARVAHQRGAVIVVDAAQSAPHMKIDVQDLDCDFLAFSG
FT                   HKMCGPTGIGVLYGKRELLEKMEPVEFGGEMIDFVDLYESTWKELPWKFEGGTPIIAGA
FT                   VGLGAAIDFLEDIGLDHIAAHEQELAQYALERLSAIKGLAIYGPKHRGGLVTFNIEGVH
FT                   PHDVATVLDAEGIAIRAGHHCAQPLMKWLNVTATARASFYLYNTKEEIDQFVDALQKAK
FT                   EYFGHVF"
FT   gene            544689..545126
FT                   /locus_tag="GY4MC1_0509"
FT   CDS_pept        544689..545126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0509"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="KEGG: gwc:GWCH70_2920 SUF system FeS assembly
FT                   protein, NifU family; TIGRFAM: SUF system FeS assembly
FT                   protein, NifU family; PFAM: nitrogen-fixing NifU domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73341"
FT                   /db_xref="GOA:A0A0F6BIU0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU0"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ADP73341.1"
FT                   /translation="MSSNNPLDMLYRQVIMDHYKNPRNRGVLEGNSVDINMNNPTCGDR
FT                   IHLTMKVEDGKITDVKFEGEGCSISMSSASMMTQAIKGKTVEEALKLATIFSDMMQGKE
FT                   YDDDIDLGDIEALQGVSKFPARIKCATLAWKAMEKGLHQHH"
FT   gene            545157..546554
FT                   /locus_tag="GY4MC1_0510"
FT   CDS_pept        545157..546554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0510"
FT                   /product="FeS assembly protein SufB"
FT                   /note="KEGG: gwc:GWCH70_2919 FeS assembly protein SufB;
FT                   TIGRFAM: FeS assembly protein SufB; PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73342"
FT                   /db_xref="GOA:A0A0F6BIU1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU1"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ADP73342.1"
FT                   /translation="MAKKAPEIGEYKYGFVDKDVSVFRAKRGLTREVVEEISRMKNEPQ
FT                   WMLEFRLKALDIFYSKPMPQWGGDLSSLDFDEITYYVKPTEKSGRSWDEVPPEIKATFD
FT                   KLGIPEAEQKYLAGVSAQYESEVVYHNMKEDLEKLGVIFKDTDSALKENEDLFREYFAK
FT                   VVPPTDNKFAALNSAVWSGGSFIYVPKGVKVDTPLQAYFRINSENMGQFERTLIIVDEG
FT                   AHVHYVEGCTAPIYTTASLHSAVVEIIVKKDAYCRYTTIQNWSNNVFNLVTKRAVCEEN
FT                   ATMEWIDGNIGSKLTMKYPAVILKGEGARGLTLSIAIAGKGQHQDAGAKMIHLAPNTSS
FT                   TIVSKSISKQGGKVTYRGMVHFGRKASGSRSNIECDTLIMDNQSTSDTIPYNEILNDNI
FT                   SLEHEAKVSKVSEEQLFYLMSRGISEQEATEMIVMGFIEPFTRELPMEYAVEMNRLIKF
FT                   EMEGSIG"
FT   gene            547039..547887
FT                   /locus_tag="GY4MC1_0511"
FT   CDS_pept        547039..547887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0511"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   gwc:GWCH70_2914 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73343"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU2"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADP73343.1"
FT                   /translation="MIYIGLTGWGDHDSLYPPGLAAKDKLQEYAAHFPTVEVDSYFYAI
FT                   QPRQNVEKWIRETPDSFRFVVKAYQGMTGHERGPIPYSSKEEMFAAFLDSIEPFIRSGK
FT                   LAMVLFQFPPWFDCRREHVTYLRWCKAQMKEVPVALEFRHRSWFSPRFYAKTLQFMTEE
FT                   GWIHSICDEPQAGEGSIPTVLHPTNAEKTLVRLHGRNVYGWNKATSGENWRAVRYLYRY
FT                   REDELREWVAHIETLKTKTNDIYVLFNNNSGGDAADNAKQFIRLLGIEYTDLAPRQLDL
FT                   F"
FT   gene            547904..548725
FT                   /locus_tag="GY4MC1_0512"
FT   CDS_pept        547904..548725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0512"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   gwc:GWCH70_2913 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73344"
FT                   /db_xref="GOA:A0A0F6BIU3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU3"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADP73344.1"
FT                   /translation="MGDVLLLVIVGFLAGTVGSLVGLGGGVIIVPSLLFLGAIHWLPHV
FT                   TPQVAVGTSLVVIIFNGLSSTLSYMKEKMVDYRSGLLFFIGSGPGAIIGAWMNNKLSLE
FT                   HFSLYFGLFLIAVSFFLSFSSNASARSQRKPFKITRTYITNEGETVTYGYHPLAAIAIS
FT                   FVVGFFGGMFGIGGGSLMVPAMIILFFFPPHVAVATSMFMIFLSSLVSSLTHVFMGNVQ
FT                   WLFALSLIPGVWFGAKTGAFINKRLRSKTIVIALRLVLVLLGIRLIYQSFS"
FT   gene            548743..550134
FT                   /locus_tag="GY4MC1_0513"
FT   CDS_pept        548743..550134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0513"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase
FT                   domain-containing protein; KEGG: gwc:GWCH70_2912
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73345"
FT                   /db_xref="GOA:A0A0F6BIU4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADP73345.1"
FT                   /translation="MKRTIYVYHTNDVHSHFEYWPKISHFLWEQRQKHEKRNETMLLFD
FT                   IGDFIDRFHPITEATRGKANVDLLNELHYDAVTIGNNEGITLDYNELDTLYENARFPVL
FT                   VANLFKKDGTRPSWAHPYCIIPVSDTFRVGVIGATAYFTKSYELLGWKVATPFEILGDI
FT                   AAEVKKQADLVILLSHLGINDDEKIAQTIPEIDIILGGHTHHLFPEGKRVHDTLLCAAG
FT                   KYGKFVGIVKLEIEESDHTYEALATVVDVEGFPDSEKMRRTLALLEKQSLQKLESEQVA
FT                   ELKEDLPLQWFSPSPLAKLLASALREWCEAEIGMVNAGVLLEPLYKGTVTRKDLHRICP
FT                   HPINPCKVQLRGAELKEIILQANTERMKYLEFKGFGFRGKVMGQMVYDGVELEMETGKD
FT                   GYEHIRRITINGEPLNPDQLYDVATIDMFAIGHFYPQIQRAPKKEYYMPEFLRDVLAWK
FT                   LADRK"
FT   gene            550188..550505
FT                   /locus_tag="GY4MC1_0514"
FT   CDS_pept        550188..550505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0514"
FT                   /product="Domain of unknown function DUF1805"
FT                   /note="PFAM: Domain of unknown function DUF1805; KEGG:
FT                   gwc:GWCH70_2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73346"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU5"
FT                   /inference="protein motif:PFAM:PF08827"
FT                   /protein_id="ADP73346.1"
FT                   /translation="MMISVTPITIDHYPFIAVSVQLPKTNLLAVASEKGYIMCGALDVA
FT                   LLNEKLRDRGIVAGRAVGVRTIEQLLEAPLESVTAAAEELGITVGMKGKEALLKMREKN
FT                   L"
FT   gene            550564..551310
FT                   /locus_tag="GY4MC1_0515"
FT   CDS_pept        550564..551310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0515"
FT                   /product="sporulation protein YunB"
FT                   /note="KEGG: gwc:GWCH70_2910 sporulation protein YunB;
FT                   TIGRFAM: sporulation protein YunB; PFAM: Sporulation
FT                   protein YunB-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73347"
FT                   /db_xref="GOA:A0A0F6BIU6"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU6"
FT                   /inference="protein motif:TFAM:TIGR02832"
FT                   /protein_id="ADP73347.1"
FT                   /translation="MPRFPARLRKGPLPLRYVFLLTFVFFMFATAVSLWIVNKAIEPVL
FT                   MEIAEKETKRIANLVINNAIEQQFLKENTEMSDLITVQKDESGKIASVDFNTAVVNRIL
FT                   AKTDDYVMQSLKAATEGKIAELEFPDDKSEKEKNNGIIYYIPIGQVTDNALLGNLGPRV
FT                   PVQFQLIGNVTSDVTKEIKPFGINNALIEVDIHVSVDIQVVIPFATKAATVSTDIPIAM
FT                   QVIQGEVPEFYNDGGNVNPSFKVPSQ"
FT   sig_peptide     550564..550659
FT                   /locus_tag="GY4MC1_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.569 at
FT                   residue 32"
FT   gene            551666..553180
FT                   /locus_tag="GY4MC1_0516"
FT   CDS_pept        551666..553180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0516"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   gwc:GWCH70_2909 sodium:neurotransmitter symporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73348"
FT                   /db_xref="GOA:A0A0F6BIU7"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU7"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ADP73348.1"
FT                   /translation="MENRQQWGSRAGFILAAAGSAIGLGNIWRFPGVAYENGGGAFFFP
FT                   YLFALLTAGIPLLVMEFTIGHKYRGSAPLSFSRIHKNLEWIGWWQVLISFVISTYYAVI
FT                   IAWALSYTVFSFNLKWGEDTEGFLFKNYLHLVDKPGQLGGISFNVFIPLLIVWLVSLGV
FT                   LYKGVKKGIELANKIFLPTLVVLFLIIVLRAITLDGAVEGLNVFFKPNWDQIMSGKVWI
FT                   AAYSQIFFSLSIAFAIMVTYSSYLPKNSDITNNAFITGFANSGFELLAGIGVFSALGFL
FT                   AQQQGVPVDKVVSSGVGLAFVVFPKIISEFPAFNAFFGVLFFLSLALAGLTSLISICET
FT                   YIAGIQEKFGISRAKSVLFGGGLAALLSLFFASHGGLYLLDVVDYFINNFGVALAGFVE
FT                   VVVIAWIVRELSNLQQHANSVSDIMLGAWWKICLSVITPLVLGYMMVDNIRTNIKENYE
FT                   GYATWFVTSFGWIVALAVIVIGILFSFKQWHGSAVGEAGHTERRGG"
FT   gene            553186..553293
FT                   /locus_tag="GY4MC1_0517"
FT   CDS_pept        553186..553293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73349"
FT                   /db_xref="GOA:A0A0F6BIU8"
FT                   /db_xref="InterPro:IPR031596"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU8"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2908"
FT                   /protein_id="ADP73349.1"
FT                   /translation="MEMSAVVMMVIGIVVIWGGLAASIIHAVKKAKQRA"
FT   gene            complement(553304..554308)
FT                   /locus_tag="GY4MC1_0518"
FT   CDS_pept        complement(553304..554308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0518"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: gwc:GWCH70_2907 peptidase
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73350"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIU9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADP73350.1"
FT                   /translation="MHPFIIAIVTTAVIFLSPKPIFAQEKSDEAIYQKRMELYKKAEAV
FT                   SLIPWYYFAAIDQYERNVRQVRRDLPKPTGALGIYIKPEIWAGPLNKNPYDTNPFSISQ
FT                   FGGFGMDGNGDGVADPKNDEDVIFAMARFLQSYGIDHKRIKMALWDYYQRSKTVDLILG
FT                   KVKIYKKYHTLKLDGHVFPLPLHTDYSYRDTWGDARGWGGRRIHEGTDIFANYGVPVRS
FT                   TCYGIVELKGWNKYGGWRIGIRDINNNYHYFAHLNGFPPHLREGQIVEPGTIIGYVGSS
FT                   GYGPPGTAGKFPPHLHYGMYKDNGYMEWSFDPYPHLKAWERAEWLKKKQGGSH"
FT   gene            554476..555372
FT                   /locus_tag="GY4MC1_0519"
FT   CDS_pept        554476..555372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0519"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   lipoic acid synthetase; KEGG: gwc:GWCH70_2906 lipoic acid
FT                   synthetase; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73351"
FT                   /db_xref="GOA:A0A0F6BIV0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV0"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADP73351.1"
FT                   /translation="MATKEEHLRKPDWLKIKLNTNENYTGLKKLMRENRLHTVCEEAKC
FT                   PNIHECWAARRTATFMILGNVCTRACRFCAVKTGLPTELDWQEPERVAESVRLMNLKHV
FT                   VVTAVARDDLKDGGAAVFAETIRAIRRKNPFTTIEVLPSDMGGVYENLKTLMDARPDIL
FT                   NHNIETVRRLTPRVRARATYERSLEFLRRAKELQPDIPTKSSIMVGLGETKEEIIEAMD
FT                   DLRANHVDILTIGQYLQPTKKHLKVVKYYHPDEFKELKEIALSKGFTHCEAGPLVRSSY
FT                   HADEQVNAASAARQAKA"
FT   gene            complement(555430..556113)
FT                   /locus_tag="GY4MC1_0520"
FT   CDS_pept        complement(555430..556113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0520"
FT                   /product="Sporulation lipoprotein YhcN/YlaJ-like protein"
FT                   /note="PFAM: Sporulation lipoprotein YhcN/YlaJ-like; KEGG:
FT                   gwc:GWCH70_2905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73352"
FT                   /db_xref="InterPro:IPR019076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV1"
FT                   /inference="protein motif:PFAM:PF09580"
FT                   /protein_id="ADP73352.1"
FT                   /translation="MRKALLAVTLSAATLAGCAQTAQDNNTDVYKRSGNTINVTDRNDL
FT                   YNENGVPNGDDTRMDNFGYVRHQKSPVPSDANLYNNMPTFNRERAADLISKLCTQLPNV
FT                   NDAATLVTDEEVLIVYDTDTKNRHQTADQVKKTALSVVPRYYHVYVADDPRLMKDIERF
FT                   GRLDSNSRNIDQIIDTTIQRMLKYPQGRKLSDGENENGEMIHETNDRLDRDFHDERPAP
FT                   AKTSR"
FT   sig_peptide     complement(556048..556113)
FT                   /locus_tag="GY4MC1_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.650 at
FT                   residue 22"
FT   gene            556226..556501
FT                   /locus_tag="GY4MC1_0521"
FT   CDS_pept        556226..556501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0521"
FT                   /product="protein of unknown function DUF1027"
FT                   /note="PFAM: protein of unknown function DUF1027; KEGG:
FT                   gwc:GWCH70_2904 protein of unknown function DUF1027"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73353"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV2"
FT                   /inference="protein motif:PFAM:PF06265"
FT                   /protein_id="ADP73353.1"
FT                   /translation="MICINNICYELVENVKNAFNEEAFRARYADILSKYDYIVGDWGYN
FT                   QLRLRGFFDDHNQRATYDTKISTLSEYLYEYCNFGCAYFVLRKVKR"
FT   gene            complement(556592..556852)
FT                   /locus_tag="GY4MC1_0522"
FT   CDS_pept        complement(556592..556852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_2921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73354"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV3"
FT                   /inference="similar to AA sequence:KEGG:GTNG_2921"
FT                   /protein_id="ADP73354.1"
FT                   /translation="MQSDFSTVEKQKNFLTAEEFPEGPYGSPRRADEPVQNKSTSWKKG
FT                   QRYYSAFNYEDKSFHQNIPRRDPGAHPPHDDPRENEQYGET"
FT   gene            complement(556909..557178)
FT                   /locus_tag="GY4MC1_0523"
FT   CDS_pept        complement(556909..557178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0523"
FT                   /product="Protein of unknown function DUF3055"
FT                   /note="PFAM: Protein of unknown function DUF3055; KEGG:
FT                   gwc:GWCH70_2902 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73355"
FT                   /db_xref="InterPro:IPR021415"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV4"
FT                   /inference="protein motif:PFAM:PF11256"
FT                   /protein_id="ADP73355.1"
FT                   /translation="MSERFYLYDDTVDTKTRFVSFLGERQRFDLAIIETDRFYGKYLVL
FT                   DLQSNRFAIIGQDDLEEPGYLEEAYRLSEEDANDLRSFLYECIS"
FT   gene            557279..557716
FT                   /locus_tag="GY4MC1_0524"
FT   CDS_pept        557279..557716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0524"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   gwc:GWCH70_2901 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73356"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV5"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADP73356.1"
FT                   /translation="MYFVDRNKIEETLRYMEKLLHIYKQKPSWDDELSQLALERLVHLV
FT                   IEAVLDVGNAMIDGFIMRDPGSYEDIIDILTDERVVTADDAKGLKAIIGYRKMLVHHYT
FT                   NVDHAKLLEEMQKHFPALQAYPNAIRTYLENELGPVSAFRN"
FT   gene            557907..558680
FT                   /locus_tag="GY4MC1_0525"
FT   CDS_pept        557907..558680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0525"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="KEGG: gwc:GWCH70_2900 HAD-superfamily subfamily IIA
FT                   hydrolase like protein; TIGRFAM: HAD-superfamily subfamily
FT                   IIA hydrolase like protein; HAD-superfamily hydrolase,
FT                   subfamily IIA; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73357"
FT                   /db_xref="GOA:A0A0F6BIV6"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV6"
FT                   /inference="protein motif:TFAM:TIGR01457"
FT                   /protein_id="ADP73357.1"
FT                   /translation="MLKKYKGYLIDLDGTMYRGTECIAEARDFVKALYQKGIPYLFVTN
FT                   NSSRTPAQVAEKLQSFGVPATEEHVFTTSQATANYIFEKKPDASIYVIGEEGLRTALEE
FT                   KGFAFAKEDAEFVVMGIDRNITYEKLAIACLAVRNGATFISTNADIALPTERGLLPGNG
FT                   SLTAVVAVSTQVQPIFIGKPEKIIMEQALKVLGVPREETLMIGDYYDTDIMAGMNAGVD
FT                   TLLVHTGVTTKELLQRYEKQPTYTADSLKEWIDRI"
FT   gene            complement(558941..559423)
FT                   /locus_tag="GY4MC1_0526"
FT   CDS_pept        complement(558941..559423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0526"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   gwc:GWCH70_2899 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73358"
FT                   /db_xref="GOA:A0A0F6BIV7"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV7"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ADP73358.1"
FT                   /translation="MNNLEQIARQWLEERGVTIKDIAELVYYLQSKYHPNLQLEECIEN
FT                   VNRVISKREVQNAILTGIQLDKLAEEGKLDEPLQSIIQRDEGLYGVDEILALSIVNVYG
FT                   SIGFTNYGYVDKQKPGILKKLNDKSTGKCNTFLDDIVGAIAAAASSRLAHRAANVE"
FT   gene            559665..560669
FT                   /locus_tag="GY4MC1_0527"
FT   CDS_pept        559665..560669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0527"
FT                   /product="spore coat protein YutH"
FT                   /note="TIGRFAM: spore coat protein YutH; KEGG:
FT                   gwc:GWCH70_2898 spore coat protein YutH"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73359"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014254"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV8"
FT                   /inference="protein motif:TFAM:TIGR02905"
FT                   /protein_id="ADP73359.1"
FT                   /translation="MKEFINNEYEIPAERFEKTGRYDTFLHKNQRYTVIPVYGRTEAEI
FT                   EELQKMSDYLLLTGDDTVAAFVPTKSGKWVAYYGDQPVVIVRSPVSPYARNISIGRELA
FT                   KFHQRGRTCPIPVVHCRRIGQWKEFWGTRLDQMEQFWRSKMETGIKAMFDRLFLESFPY
FT                   YLGLAENAIQYVADAELDEEPVGVDYATFCHERLPNAKWVEGKEQKLATDWVYDHCARD
FT                   LAEWVRHIYMKKGNVSVESIRRFFREYQRIAPLSPFAWRLIYARLLFPLHYFECVEGYY
FT                   MTDGERRKQAYEQMLRGIVGRSRENEQFLASFAEIAGPAGQRLYIPKIYWFFY"
FT   gene            560762..561742
FT                   /locus_tag="GY4MC1_0528"
FT   CDS_pept        560762..561742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0528"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="KEGG: gwc:GWCH70_2897 glyoxylate reductase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73360"
FT                   /db_xref="GOA:A0A0F6BIV9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIV9"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ADP73360.1"
FT                   /translation="MTRPYVFITRKLPDHIVAPIKEIAEVAMWPYDDIQVPRDVLMNEA
FT                   KKADALLTMVSDVVDEEILEAGKSLKVVANMGVGFDNIDIPAATKHGIAVCNTPDVLTD
FT                   TTADLTFALLLATARRVVEAAQWIKEGKWKSWSPFLLAGADVHHKTIGIVGMGKIGQAV
FT                   AKRAAGFDMNILYHNRSRNKEAEQRLGATYCSFDELLEAADFVVCLTPLTKETRHMFNS
FT                   EAFRKMKRSAIFINASRGAVVDEQALYAALVNGEIAAAGLDVFEHEPIGASHPLLTLTN
FT                   VVALPHIGSATKETRTKMMELCCRNIIAVLEGKRPETLVNKELER"
FT   gene            561931..563232
FT                   /locus_tag="GY4MC1_0529"
FT   CDS_pept        561931..563232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0529"
FT                   /product="homoserine dehydrogenase"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; amino acid-binding ACT domain
FT                   protein; KEGG: gwc:GWCH70_2896 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73361"
FT                   /db_xref="GOA:A0A0F6BIW0"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW0"
FT                   /inference="protein motif:PFAM:PF00742"
FT                   /protein_id="ADP73361.1"
FT                   /translation="MAKPIFVGLLGLGTVGSGVVKIIENHQERLMHQVGCPVQVKKILV
FT                   RDIYKQRDVRVDPSLLTTDVADVIDDPEIDVVIEVMGGIEETREYLLRALQQGKHVVTA
FT                   NKDLMALHGSELLAVAAENHCDLFFEASVAGGIPILRSLVDGLASDRITKMMGIVNGTT
FT                   NYILTKMSKYGASYEEVLAEAQALGYAEADPTSDVEGLDAARKMAILARLGFSMNIDLE
FT                   DVQAKGITSITEEDLNYSKRLGYTMKLIGIAQRDGNKVEVSVQPTLLPDSHPLASVNDE
FT                   YNAVYVYGEAVGETMFYGPGAGSLPTATAVVSDLVAVMKNMRLGVNGCNAVAPQYEKQL
FT                   KSPSEIFSKYFLRIRVKDQVGAFAKITTLFSERGVSFEKILQLPLKEDGLAEIVIVTHR
FT                   ASQQDYEEILQQLRELEIVHEVKSSYRVEGEGKE"
FT   gene            563229..564290
FT                   /locus_tag="GY4MC1_0530"
FT   CDS_pept        563229..564290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0530"
FT                   /product="threonine synthase"
FT                   /note="KEGG: gwc:GWCH70_2895 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73362"
FT                   /db_xref="GOA:A0A0F6BIW1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW1"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADP73362.1"
FT                   /translation="MTWKGLLHAYREFLPINENTPMLTLNEGNTPLIPLPRLSEKLGVE
FT                   LYVKVEGANPTGSFKDRGMVMAVAKAKESGSHTIICASTGNTSASAAAYAARAGLRCIV
FT                   VIPNGKIAMGKLAQAVMYGAEIFAIEGNFDEALKMVRRLSDMAPITLVNSVNPYRIEGQ
FT                   KTAAFEICDQLGKAPDVLAIPVGNAGNITAYWKGFKEYHAAKQTGLPQMRGFEAEGAAA
FT                   IVRNQVIEHPETIATAIRIGNPASWEKAVQAAAESNGKIDEVSDAEIVEAYKLLAREEG
FT                   IFAEPASCASIAGVIKQRKRNEIEKGSTVVAVLTGNGLKDPAIAMEVAEIEPTVLANDE
FT                   TVVFEHIQGVVHQ"
FT   gene            564287..565201
FT                   /locus_tag="GY4MC1_0531"
FT   CDS_pept        564287..565201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0531"
FT                   /product="homoserine kinase"
FT                   /note="KEGG: gwc:GWCH70_2894 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73363"
FT                   /db_xref="GOA:A0A0F6BIW2"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW2"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ADP73363.1"
FT                   /translation="MKEDGMLRIVVPASTANLGPGFDSIGLAVSRYLTLEVRLADEWKF
FT                   VPRSSEVAAIPAGMDNLIYQVAAQVAQTYGCTLPSCFVDVYSNIPFTRGLGSSAAAVVA
FT                   GIELANELAGLSLSLEQKMRFASCYEGHPDNVGASLYGGLVIGSHRREETDVVHVPDVQ
FT                   LDLVAVIPSYELETEKARSVLPQMMAREDAVEASAVSNVLVAALLTKRWELAGKMMSCD
FT                   LFHQPYRKELVPQLSLVEKLAMQYGAFGVALSGAGPTILAFAEPGKGMELKEKLAPYFP
FT                   DCAVEWLTVEQKGSQVYKMSFEK"
FT   gene            complement(565252..565488)
FT                   /locus_tag="GY4MC1_0532"
FT   CDS_pept        complement(565252..565488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0532"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   gwc:GWCH70_2893 nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73364"
FT                   /db_xref="GOA:A0A0F6BIW3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW3"
FT                   /inference="protein motif:PFAM:PF01106"
FT                   /protein_id="ADP73364.1"
FT                   /translation="MSDQEIKEQVQEVLDKLRPFLLRDGGDCELIDVEDGVVKLRLLGA
FT                   CGSCPSSTITLKAGIERALLEEVPGIVEVEQVF"
FT   gene            565585..565911
FT                   /locus_tag="GY4MC1_0533"
FT   CDS_pept        565585..565911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0533"
FT                   /product="Uncharacterized conserved protein UCP010603"
FT                   /note="PFAM: Uncharacterised conserved protein UCP010603;
FT                   KEGG: gwc:GWCH70_2892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73365"
FT                   /db_xref="InterPro:IPR009190"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW4"
FT                   /inference="protein motif:PFAM:PF07315"
FT                   /protein_id="ADP73365.1"
FT                   /translation="MTLKQVEICVYGADMICPSCVHLPSSKETYEWLEAAIKRKYPNQP
FT                   FSITYIDIFNPPEDDEAKKAFAKKVLEEDLFYPVVVIEGVIVGEGNPRLKSIYAEMEKY
FT                   GYRG"
FT   gene            566113..566358
FT                   /locus_tag="GY4MC1_0534"
FT   CDS_pept        566113..566358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73366.1"
FT                   /translation="MMLDKWHPPLVVKFLKFLKKKIPRTGHTVIHKHDRTEQEMPAITL
FT                   LHVPRPSLREARLNENKTMQPTQGVGFLFIKKKGRI"
FT   gene            complement(566469..567539)
FT                   /locus_tag="GY4MC1_0535"
FT   CDS_pept        complement(566469..567539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0535"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2891 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73367"
FT                   /db_xref="GOA:A0A0F6BIW6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73367.1"
FT                   /translation="MRHLVLLGGGYGNMRILLRLLPNHLPEDVHITLVDRVPYHCLKTE
FT                   YYALAAGTISDHHIRVPFPEHPRLTYRFGEVVNIDLDNQNVQLQDESSIPYDDLVIGLG
FT                   CEDKYHGVPGAETFTHSIQSIEKARAAYEALNNLPPGSIVGIVGAGLSGVELASELAES
FT                   RPDLHIKLFDRGERILPMFPKRLSNYVESWFHQHDIEIVRCSNITKVEERTLYNHDTPV
FT                   HCDVIVWTAGIQPNRVVRQLPVEKDKQGRVVLTKRHHIPGYENVYVVGDCASLPHSPSA
FT                   QLAEGQAEQIVQVLQKRWNGEEPPSEFPPIKLKGILGSLGRKHGFGLLADRPITGRVPR
FT                   LLKSGILWMYKYHNGY"
FT   gene            567684..567779
FT                   /locus_tag="GY4MC1_0536"
FT   CDS_pept        567684..567779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73368.1"
FT                   /translation="MGKMALHPVNEAMENGIAFHWFLRYSPESVQ"
FT   gene            567854..568093
FT                   /locus_tag="GY4MC1_0537"
FT   CDS_pept        567854..568093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2889 protein of unknown function
FT                   DUF1450"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73369"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="InterPro:IPR022916"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW8"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2889"
FT                   /protein_id="ADP73369.1"
FT                   /translation="MIQPIIEFCISNLANGSQKALEILEKDPNLDIIEYSCLSYCTRCA
FT                   ETLFALVNGEIVTGDTPEQLVENIYRYLEENPMF"
FT   gene            568286..569140
FT                   /locus_tag="GY4MC1_0538"
FT   CDS_pept        568286..569140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0538"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   gwc:GWCH70_2888 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73370"
FT                   /db_xref="GOA:A0A0F6BIW9"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW9"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADP73370.1"
FT                   /translation="MNQFSFTKMHGLGNSYIYVNMFEETIPESLLSLLAVKVSNVNTGI
FT                   GADGMILICPSKVAPVKMRIFNSDGSEGKNCGNGLRCVAKYVYEHGIVNDRSFFIETLS
FT                   GLVKAEVEVENGAVTNVTIDMGKPRLKRSEIPMVGPEAERVVAEPFEVDGQLYEITAVS
FT                   MGNPHVIFYVDDINQAAVTSLGPIVEKDKRFPEGVNVEFVEVVNDHELHFRVWERGSGV
FT                   TQACGTGACAAVVASVLNGKTARNKETIVHLAGGDLTITWTDEGNVRMTGPAETICTGV
FT                   YYY"
FT   gene            569202..569564
FT                   /locus_tag="GY4MC1_0539"
FT   CDS_pept        569202..569564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0539"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: gwc:GWCH70_2887 iron-sulfur cluster assembly
FT                   accessory protein; TIGRFAM: iron-sulfur cluster assembly
FT                   accessory protein; PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73371"
FT                   /db_xref="GOA:A0A0F6BIX0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX0"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADP73371.1"
FT                   /translation="MTDIVTLTEAAAFQIKDMMKEHEEEGAYLRIGVRGGGCSGLSYGM
FT                   GFDHERHEDDHEFEQHGIKILVDKDSAPILQGTVIDYKQSLMGGGFTINNPNAIATCGC
FT                   GSSFRTATNTGTPEQC"
FT   gene            complement(569997..570989)
FT                   /locus_tag="GY4MC1_0540"
FT   CDS_pept        complement(569997..570989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0540"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2885 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73372"
FT                   /db_xref="GOA:A0A0F6BIX1"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73372.1"
FT                   /translation="MKEDPKIYDVTIIGGGPTGLFAAFYGGLRQMSVKIIESLPQLGGQ
FT                   LSALYPEKYIYDIAGFPKIRAQELINNLKEQMEQFAPTVCLEQSVEKLEKLENGTLKLT
FT                   TNKEIHYSKTVVITAGNGAFQPRRLELETAAQYEGKNLYYFINDLNQFKGQKVLVCGGG
FT                   DSAVDWSLMLEPIAEKVTIVHRRDKFRAHEHSVETLLNSTVNVKTPFVPVELIGDENGI
FT                   RQVVIEHVKDGSRETIDIDALIVNYGFISSLGPIKNWGLEIEKNSIKVNSKMETNIPGV
FT                   YAAGDICTYEGKIKLIACGFGEAPIAISSAKTYIDPTARMQPAHSTSLF"
FT   gene            571279..572502
FT                   /locus_tag="GY4MC1_0541"
FT   CDS_pept        571279..572502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0541"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2884 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73373"
FT                   /db_xref="GOA:A0A0F6BIX2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX2"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73373.1"
FT                   /translation="MIQLKKPNVVILGAGYGGLMTTVRLQKLVGMNEANITLVNKNDYH
FT                   YETTWLHEASAGTLHHDRVRYPISDVIDRNKVNFVKDTVVKILPDEKKVLMENGEIAYD
FT                   YLVIALGFESETFGIKGLKEYAFSISNVNAARQIREHIEYQFATYNTEEEKREERLTIV
FT                   VGGAGFTGIEFLGELVNRLPQLCREYDIDPHKVRVICVEAAPTALPGFDPELVEYAVGQ
FT                   LERKGVEFKIGTAIKECTPDGIIVAKGDDVEEIKAGTVVWAAGVRGSRVVDESGFEAMR
FT                   GRIKVDPFLRVPGREDIFVVGDCSLVINEETNRPYPPTAQIAMQEGELCAKNLAVLIRQ
FT                   QGELQPFRPDIKGTVCSLGHDDAIGVVFGKKLWGAKASFMKKMIDNRALYLIGGASLVM
FT                   KKGKFKFF"
FT   gene            572757..573254
FT                   /locus_tag="GY4MC1_0542"
FT   CDS_pept        572757..573254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0542"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gyc:GYMC61_3028 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73374"
FT                   /db_xref="GOA:A0A0F6BIX3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX3"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP73374.1"
FT                   /translation="MDKKRGNVWIAAAGLVVNEADEWLVVKKKYGGLKGKWSLPAGFVQ
FT                   PGETLDEAAIREIKEETGIDAEIVGFLGMRTGVIRNEISDNMAIFLLRAVSDAITVQTE
FT                   ELFTAAFLSKQTLEKDAHTSRLLRYLLQSEPFHYLPFNDGMNPGEPFGYTKYRLYFNNG
FT                   KN"
FT   gene            573341..573505
FT                   /locus_tag="GY4MC1_0543"
FT   CDS_pept        573341..573505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmj:P9211_11471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX4"
FT                   /inference="similar to AA sequence:KEGG:P9211_11471"
FT                   /protein_id="ADP73375.1"
FT                   /translation="MKHTGQTACYTAKETECAAFVGQGGNLPWMFKEINRIKMKRFLKI
FT                   DSLYLIQYT"
FT   gene            573534..573857
FT                   /locus_tag="GY4MC1_0544"
FT   CDS_pept        573534..573857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73376"
FT                   /db_xref="GOA:A0A0F6BIX5"
FT                   /db_xref="InterPro:IPR025917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX5"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2881"
FT                   /protein_id="ADP73376.1"
FT                   /translation="MQMSLPVVLISMLLFFVLFFGIGFLLNMLLRMTWIMAVLCPIVFI
FT                   FIIDDIPWTKYFTDPVSSFVALKHKVLSLAPADILILASGFVGAVCAGFAIRTLRAKGY
FT                   QMF"
FT   gene            573965..574669
FT                   /locus_tag="GY4MC1_0545"
FT   CDS_pept        573965..574669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0545"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; KEGG:
FT                   gwc:GWCH70_2880 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73377"
FT                   /db_xref="GOA:A0A0F6BIX6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX6"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADP73377.1"
FT                   /translation="MILLKNIVRRITMSLLFAMALLTTFQAISGVEAKVIVDKLYGVSS
FT                   FHTGYHFFDIWKEQQHVAIDAQWKYYEGRKKPQISSEKISQPPRLEEAIDWSKYPSKVV
FT                   VATGYTAGVESTGKTPNHPEYGITYSGVRVKRDLYSTIAADLNVFPIGTILFIPGYGYG
FT                   VVADKGGAIKGNRVDLYYDTVEDVYKYWGKKTVQVYIVKKGDGELSEEELKQLNENETM
FT                   QVFRQQYLQSKS"
FT   sig_peptide     573965..574054
FT                   /locus_tag="GY4MC1_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.804 at
FT                   residue 30"
FT   gene            complement(574701..575516)
FT                   /locus_tag="GY4MC1_0546"
FT   CDS_pept        complement(574701..575516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0546"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   gwc:GWCH70_2879 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73378"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX7"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73378.1"
FT                   /translation="MMKIISLCPSNTELLAYLGMLDYLIAVDSHSDWPPSICKLPKVGP
FT                   DLNIDMEKVEALKPDLVLASLSVPGMERNVQELEKRNIPHIVFAPNSLHDIAEDLLRLG
FT                   ETLGKKQAAQAIARRYCSLIETYRQLAANVKHPARLYWEWWPKPIFTPGKTNWLSEISE
FT                   LAGGMNIFGDVAKANVQSDWDEVVKRNPSHICLVWVGVQTKKMNKDAVLKRPDAEKVEA
FT                   VRAGRIYVLEESLYCRPSPRLLLGLKKLAALLHPSVFPPDDGMDPLLEY"
FT   gene            575717..577210
FT                   /locus_tag="GY4MC1_0547"
FT   CDS_pept        575717..577210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0547"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="KEGG: gwc:GWCH70_2878 leucyl aminopeptidase; PFAM:
FT                   peptidase M17 leucyl aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73379"
FT                   /db_xref="GOA:A0A0F6BIX8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX8"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ADP73379.1"
FT                   /translation="MFTISGQLSLDTAHEALVIGIFEKNKPLDGIAAECDNRLHGQISV
FT                   MLKEGDISAKNKQISKVHTLKQAGVKRFFFVGLGKEEKLTFDLLREAFGKLFKTIKQAK
FT                   LTEVAVALDTFTTKNVDALDAAHALAEAYYLATYEFPGYKQKKNEREKHINSITVYTEA
FT                   DQAEIKASVFVGSVYGKATNSARTLVNTPSNLLTAADLADYAVRLAGKYGFEHEILEKE
FT                   EMEKLGMGALLAVNQGSKNPPKMIVLKYQGKETWENVIGLVGKGVTFDTGGYSLKPRES
FT                   MIDMKTDMAGAAAVLGAMEIIGELRPEQNVVAVIPATDNMISGEAFKPDDVITSMSGKT
FT                   IEIRNTDAEGRLILADAITYAKHHGADYLIDVATLTGGVIVALGVHTTGAMTNNEALFE
FT                   QLLEASAETGEFIWRLPITEKDKERVRSSKIADLNNSPGREGHAIMGGAFLGEFAEDTP
FT                   WVHLDIAGTSVTSKEHDLGPSGATGVMVRTLATLVERFE"
FT   gene            577407..578027
FT                   /locus_tag="GY4MC1_0548"
FT   CDS_pept        577407..578027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0548"
FT                   /product="Putative phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   gwc:GWCH70_2877 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73380"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX9"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADP73380.1"
FT                   /translation="MIFSPKKDVFFDLLFTISENVKEAAQYFVEYKINNISDLKEFARV
FT                   MKEYERKGDSYIHELVVELNKTFITPIEREDIHQLAMKMDDVLDGLEQCSARFEMFSFT
FT                   EIDDHMVKFFDNIYQSTIEIADALKLLSQKKLLDMRTHAIKIKDYETKCDEILRASIKN
FT                   LFVDQKDPIKIIQYKELYEMLEEIADSCEDVANTIETIIMRNA"
FT   gene            578045..579043
FT                   /locus_tag="GY4MC1_0549"
FT   CDS_pept        578045..579043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0549"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: gwc:GWCH70_2876
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73381"
FT                   /db_xref="GOA:A0A0F6BIY0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADP73381.1"
FT                   /translation="MDTVFLLTVLIVVFALAFDFINGFHDTANAIATSVSTRALSPRKA
FT                   IVLAATMNFIGALTFTGVAKTITKDIVDPFALENGSVVILAALTAAIAWNLITWYYGIP
FT                   SSSSHALIGSIAGAAVSAAGFDVLHYQGFLKILESLIISPFLALAVGFVIMSLFRAIFK
FT                   NANLTRTTKGFRMFQVITAAFQAYTHGTNDAQKTMGIITMALIAANYHTSSEVPEWVRI
FT                   SAAIAMGLGTSVGGWKIIKTVGGKIMKIRPVNGAAADLSSALVIFSATLLHLPVSTTHV
FT                   ISSSIMGVGAAQRVKGVKWGVAQRIVLTWIITLPVSALIAGFVYQIFKLFF"
FT   gene            complement(579113..579721)
FT                   /locus_tag="GY4MC1_0550"
FT   CDS_pept        complement(579113..579721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0550"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: gwc:GWCH70_2875 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73382"
FT                   /db_xref="GOA:A0A0F6BIY1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY1"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADP73382.1"
FT                   /translation="MGETQRKWRALDMTLVGMFAALMAIGANITSWAPFLVIGGVPITL
FT                   QTFFCVLAGAILGRKLGATAMTVYMLIGLFGAPVFAQFSGGFGTIVRPTFGFILSFILA
FT                   AYVTGWIIERGNGNPSVVRFIAATVAGMAINYLIGTNWMYIAYKLWAEAPKGFSYALAW
FT                   SWMIVPLPKDIILSVIAGIISPRIYMSIRKSASYRQHVA"
FT   gene            complement(579974..581302)
FT                   /locus_tag="GY4MC1_0551"
FT   CDS_pept        complement(579974..581302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0551"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: gka:GK2936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73383"
FT                   /db_xref="GOA:A0A0F6BIY2"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY2"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADP73383.1"
FT                   /translation="MHDSAAAEISSLQYYAAIAIFLITYAIIISEKINRAVIAMLGAAL
FT                   MIMFGIVDLHNAFTQHIEWGTITLLIGMMILVGITSKSGFFQYVAIKAAKLAKGRPLRI
FT                   LVMLSLLTGALSAFLDNVTTVLLIVPVTFSITRMLQVNPVPYLISEVLFSNIGGTATLI
FT                   GDPPNIMIGSANKHLDFNAFLFNLTPIVLIIMIVTVSILVFIYRRQLKTDDHLVNKLMN
FT                   VNEAEYIKDAALLKKSVSVLFLTILGFLLHSVIHVDAAVIAMTGAIILMLIGVQEHEIE
FT                   DVFASVEWVTIFFFAGLFTLVGGLVDIGFIKSLAEKVLEVTGGDISAAAYFILWVSGLA
FT                   SATIDNIPFVATMIPLIKDMAAGMGLSPDSAQMEVLWWALSLGACLGGNGTLIGASANV
FT                   IVAGIASREGHGFSYMDFLKIGAPLTFIALLLSHIYLFVRYLM"
FT   gene            581698..582321
FT                   /locus_tag="GY4MC1_0552"
FT   CDS_pept        581698..582321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0552"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="KEGG: exonuclease RNase T and DNA polymerase III;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73384"
FT                   /db_xref="GOA:A0A0F6BIY3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY3"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADP73384.1"
FT                   /translation="MTATSQYLFLDFEFTMPETKMEPKGFFPEIIEVGLVVVVNDEICD
FT                   QFSSYVKPTRFPVLTNRCKSFLNITQEQINQGMSFHELVALLCKYDRSCPSTVVTWGSM
FT                   DMKVLKENCKAANLPFPFTGEHRDLAMEYKLFFGNKNHTGLRKAIQEYGNEGVGKAHCA
FT                   LDDAFTTYNIFRLVENDKKYLMKTKPPTIGERIDLTQLRKKFAL"
FT   gene            582410..582613
FT                   /locus_tag="GY4MC1_0553"
FT   CDS_pept        582410..582613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73385"
FT                   /db_xref="GOA:A0A0F6BIY4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY4"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2866"
FT                   /protein_id="ADP73385.1"
FT                   /translation="MAVSYILSFMLYFPEDKREYIPAAVTCMIFLIAAILTTRLIIKIS
FT                   RYQEEKAKRLEEQLIRDNKNQE"
FT   gene            582686..583210
FT                   /locus_tag="GY4MC1_0554"
FT   CDS_pept        582686..583210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0554"
FT                   /product="superoxide dismutase copper/zinc binding protein"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: gwc:GWCH70_2865 superoxide dismutase copper/zinc
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73386"
FT                   /db_xref="GOA:A0A0F6BIY5"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY5"
FT                   /inference="protein motif:PFAM:PF00080"
FT                   /protein_id="ADP73386.1"
FT                   /translation="MFQKAGLLFAAAVLFAVGCQKENVTNLEVNMINSAGDSIGTVKLT
FT                   EQAKGVKLKLDLEGLPPGEHAIHIHEKGVCKKPDFQSAGNHYNPDGKKHGLLHPEGAHA
FT                   GDLPNIIVKEDGTVNTELTAPNVTLKEGKKGTLLTKDGTAIVIHAGKDDGMTQPAGDAG
FT                   ERIACGEIKNR"
FT   sig_peptide     582686..582751
FT                   /locus_tag="GY4MC1_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.742 at
FT                   residue 22"
FT   gene            complement(583326..584486)
FT                   /locus_tag="GY4MC1_0555"
FT   CDS_pept        complement(583326..584486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0555"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gwc:GWCH70_2864 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73387"
FT                   /db_xref="GOA:A0A0F6BIY6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADP73387.1"
FT                   /translation="MYSFDDVIDRRNTHSLKWDATERIFGVKDVLPMWVADMDFPAPPA
FT                   VIEALNKRVEHGIFGYTIIPDSLKNAVKHWLQSRHQWEIETSWLSFSTGVIPAIATAIE
FT                   AFTNEEDRIVVLTPVYPPLFQLVKKHRRTLVTSSLRLAETQYEIDWDDFEEKIRGAKLL
FT                   VLCSPHNPGGRVWTKEELIKIGELCVEHGVIVISDEIHADLTLPPYQHVPFASIDPAFA
FT                   EKSVTCIAPTKTFNLAGLQAAAAIIPNETLKRQFNNVQQRQGILTLNTFAVAGAEAAYQ
FT                   HGGEWLDALLPYLQKNINRLCSYIETNLPKLRVIRPEATYLVWVDCRPLGKTERQLKQL
FT                   LLEKGKIAVEFGSKFGEEGRGFIRINIACPQKTLEDALHRLTAALQ"
FT   gene            584592..584840
FT                   /locus_tag="GY4MC1_0556"
FT   CDS_pept        584592..584840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0556"
FT                   /product="Domain of unknown function DUF1871"
FT                   /note="PFAM: Domain of unknown function DUF1871; KEGG:
FT                   gka:GK2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73388"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY7"
FT                   /inference="protein motif:PFAM:PF08958"
FT                   /protein_id="ADP73388.1"
FT                   /translation="MNWQLLHAIRAWDPFGYGNDAYETEAVDVLQAVHDCDEPTTLAGK
FT                   IQAIYEFSFERKIPLNECIKMAKSLLAMKQAAACSLP"
FT   gene            584955..585455
FT                   /locus_tag="GY4MC1_0557"
FT   CDS_pept        584955..585455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0557"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: gwc:GWCH70_2862 transcriptional regulator,
FT                   AsnC family; PFAM: Transcription regulator AsnC-type-like;
FT                   SMART: Transcription regulator AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73389"
FT                   /db_xref="GOA:A0A0F6BIY8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY8"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADP73389.1"
FT                   /translation="MKLTEKEIEIIEILEKDARIPTETLAKMVSLSVDETEAILKKLEE
FT                   TKVIVQYTALVDWRKVDGHEGVTAMIDVKVTPKRGVGFDEVAERIYRFPEVKSVYLMSG
FT                   AYDLSVVIEGRSMSEIANFVSEKLSTLDSVISTTTHFILKKYKHDGTVFDQGDQDHRIV
FT                   MAP"
FT   gene            585452..586624
FT                   /locus_tag="GY4MC1_0558"
FT   CDS_pept        585452..586624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0558"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gwc:GWCH70_2861 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73390"
FT                   /db_xref="GOA:A0A0F6BIY9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADP73390.1"
FT                   /translation="MMQQTKKSYVSETVARLKPSGIRRFFDLASSMEGVVSLGVGEPDF
FT                   VTSWSIREASILSLEQGYTSYTANAGLLELRQEIAAYLARKFHVEYDPEAEILVTVGAS
FT                   QAIDLALRATVNPGDEVIVVEPSFVSYGPLVTLAGGVPVPVGTTGEDHFKLRPDQIERV
FT                   ITDRTKALIVCSPNNPTGTVLHKEDLEAIAQIVKKHDLLVISDEIYAELTYDEPYISFA
FT                   AVDGMRERTILVSGFSKGFAMTGWRLGFTAAPAEILQAMLKIHQYAIMCAPTMAQYAAI
FT                   EALRNGEQDVEYMKKSYRRRRNYFVQSLNEIGLSCHMPGGAFYAFPSIRATGLTSEQFA
FT                   EKLLLEEKVAVVPGSVFGAGGEGYIRCSYASSMEQLQEAIKRIKRFLERL"
FT   gene            586745..587110
FT                   /locus_tag="GY4MC1_0559"
FT   CDS_pept        586745..587110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0559"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gwc:GWCH70_2860 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73391"
FT                   /db_xref="GOA:A0A0F6BIZ0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ0"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADP73391.1"
FT                   /translation="MSNIEVGSIVKGKVTGIQPYGVFVELDRETQGLVHISEISHGFVK
FT                   NIKDYVNVGDEITVKVLSIDPHTKRASLSMRAVEEGQRNMRKRHVKVKMSLNPGFHTLK
FT                   EKLQEWIEQSKKEDLSK"
FT   gene            complement(587148..587381)
FT                   /locus_tag="GY4MC1_0560"
FT   CDS_pept        complement(587148..587381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0560"
FT                   /product="protein of unknown function DUF378"
FT                   /note="PFAM: protein of unknown function DUF378; KEGG:
FT                   gwc:GWCH70_2859 protein of unknown function DUF378"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73392"
FT                   /db_xref="GOA:A0A0F6BIZ1"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ1"
FT                   /inference="protein motif:PFAM:PF04070"
FT                   /protein_id="ADP73392.1"
FT                   /translation="MNALQRIALLLTIIGAINWGLIGFFQFDLVAAIFGGQDSVLSRII
FT                   YGLVGIAGLINLALLFKPAEELGRTEPKASRT"
FT   gene            587535..588698
FT                   /locus_tag="GY4MC1_0561"
FT   CDS_pept        587535..588698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0561"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gwc:GWCH70_2858 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73393"
FT                   /db_xref="GOA:A0A0F6BIZ2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ2"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADP73393.1"
FT                   /translation="MENFSFQNPTKLIFGKGQIEQLKEEIPRYGKKILLVYGGGSIKRN
FT                   GLYDEVMNLLNELKVEVTELPGVEPNPRLSTVRKGVEICKTEGIEFLLAVGGGSVIDCT
FT                   KAIAAGAKYDGDPWDFITKKVKVFEALPFGTVLTLAATGSEMNAGSVITNWETKEKYGW
FT                   NSPATFPQFSILDPTYTLTVPRDHTVYGIVDMMSHVFEQYFHHTANTPLQDRMCEAVLR
FT                   TVMEAAPKLVNDLQNYELRETILYCGTIALNGLLQMGLRGDWATHNIEHAVSAVYDIPH
FT                   AGGLAILFPNWMKHVLDENVSRFAQLAVRVFDVNPEGKAERDVALEGIEKLREFWSSIG
FT                   APSRLADYGIGEESLELIADKAMANGEFGKFKKLNRDDVLAILRASL"
FT   gene            588858..590207
FT                   /locus_tag="GY4MC1_0562"
FT   CDS_pept        588858..590207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0562"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: gwc:GWCH70_2857 glucose-6-phosphate isomerase;
FT                   PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73394"
FT                   /db_xref="GOA:A0A0F6BIZ3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ3"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ADP73394.1"
FT                   /translation="MTHIRFDYSKALAFFGEHELTYLRDAVKVAHHSLHEKTGVGNDFL
FT                   GWIDLPVNYDKEEFARIQKAAAKIQADSDVLLVIGIGGSYLGARAAIEMLHHSFYNALS
FT                   KEKRRTPQIIFVGNNISSTYMKDVMDLLEGKDFSINVISKSGTTTEPAIAFRIFRKLLE
FT                   EKYGKEEARKRIYATTDRARGALKTLATAEGYETFIIPDDVGGRYSVLTAVGLLPIAVS
FT                   GANIEEMMKGAAQAREDFSNSELEENAAYQYAAIRNILYNKGKTIELLINYEPALQYFA
FT                   EWWKQLFGESEGKDQKGIFPASANFSTDLHSLGQYIQEGRRDLFETVLKVEKPRHELVI
FT                   EAEENDLDGLNYLAGKTVDFVNTKAFEGTLLAHTDGGVPNLVITLPELNEYTFGYLVYF
FT                   FEKACAMSGYLLGVNPFDQPGVEAYKVNMFALLGKPGYEEKKAELEKRLK"
FT   gene            590232..590465
FT                   /locus_tag="GY4MC1_0563"
FT   CDS_pept        590232..590465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73395.1"
FT                   /translation="MHSVFCMRRHYLPPVAYQKIPSAAGRDFYLICKKSNFAVFLSQAS
FT                   VFRAYRSKFSLTPTVICNKNGLLNKKQDSPRF"
FT   repeat_region   complement(590718..591942)
FT                   /rpt_unit_range=590718..590748
FT                   /note="CRISPRS"
FT   gene            592207..592611
FT                   /locus_tag="GY4MC1_0564"
FT   CDS_pept        592207..592611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0564"
FT                   /product="protein of unknown function YugN-like protein"
FT                   /note="PFAM: protein of unknown function YugN-like; KEGG:
FT                   gwc:GWCH70_2855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73396"
FT                   /db_xref="InterPro:IPR014967"
FT                   /db_xref="InterPro:IPR036491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ5"
FT                   /inference="protein motif:PFAM:PF08868"
FT                   /protein_id="ADP73396.1"
FT                   /translation="MIEIPSQLEGKTFPLFQLEQLLKPLGYTIGGNWDYDHGSFDYKIA
FT                   DEAGYQFLRVPFEAIDGQLDSHGTTVKLGRPFLLSHKYQSGVDDHAYAGNFGAAFNQFS
FT                   EPQDPDAAVSEKYINVGKALVKDLENRLID"
FT   gene            complement(592608..593603)
FT                   /locus_tag="GY4MC1_0565"
FT   CDS_pept        complement(592608..593603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0565"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: gwc:GWCH70_2854
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73397"
FT                   /db_xref="GOA:A0A0F6BIZ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADP73397.1"
FT                   /translation="MKNWDVFISYLRLPVFMRLLIIGTIMIVIFGTLIHFVEPATFRHV
FT                   FDGIWWAIVTAATIGYGDMVPKTVAGKIVAISLILLGTGVITTYFASLSAAAVAKESAL
FT                   SNGQLRYMQKGHIIIVGWNERAREVIAKLSEYTPPVRCVIIDATLNELPVPFKNVHFIK
FT                   GNPSYDDVLHKANATEAQMILITANQHKSEADADKDSILTLLAVKGIHPSIYAIVEILT
FT                   EQNVNNAKRAGADEVIQTNLLASFTMANSLQSPGVSKAIIELLHQLHGKKLQLIAAEGP
FT                   LIGKTFLESSEMLLDKRMILIGVMREEEGYINPSPHFLIEKGDRLFVITP"
FT   gene            593731..593916
FT                   /locus_tag="GY4MC1_0566"
FT   CDS_pept        593731..593916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0566"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="KEGG: gwc:GWCH70_2853 small acid-soluble spore
FT                   protein, H-type; TIGRFAM: small acid-soluble spore protein,
FT                   H-type; PFAM: small acid-soluble spore H family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73398"
FT                   /db_xref="GOA:A0A0F6BIZ7"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ7"
FT                   /inference="protein motif:TFAM:TIGR02861"
FT                   /protein_id="ADP73398.1"
FT                   /translation="MDINRVKQIVSSPADIPVYYNGVSVWIDDYNEQEETATIHLRDGH
FT                   LREQREVPVEELTEKQ"
FT   gene            594191..595474
FT                   /locus_tag="GY4MC1_0567"
FT   CDS_pept        594191..595474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0567"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   putative permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73399"
FT                   /db_xref="GOA:A0A0F6BIZ8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ8"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADP73399.1"
FT                   /translation="MRQVISSLQWFLFIISGSIVVPVTVASLYQLETADAMAFISRTFF
FT                   VLAVAGLLQTAFGHRLPLNEGPAGIWWGIFILYASFGVALYGSRAETLRVLESALIMSG
FT                   ILFMLLSLLGIVDRLARLFTPTVTGTYLLLLAVQLSGSFLKGLLGVDETGKVSIVVAAL
FT                   STIIIFLSLWMTNHPVLRQFSIIVSMITGWILFRLFGFAPSIHWTEKWFEFPKWFAFGP
FT                   PRWEWGIVPTAFFVTLLLLTNMLASMKVVESVMKAEKANAGNPSPKRAGFMMGISHMIS
FT                   GVLAAIGSVPISGAGSFITTSKITKRLPFVIACVLIMLMSLFMPAVSLFTAMPAAVGYA
FT                   AIFPMFAGMITLGLKELEQNGGWKERAEQVSLPLFTGIGVMFVPSEAFAPLPPVIASVA
FT                   SNGLIVGTLLSILLEAVAGKKGATSASK"
FT   gene            complement(595480..596658)
FT                   /locus_tag="GY4MC1_0568"
FT   CDS_pept        complement(595480..596658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0568"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pjd:Pjdr2_2897 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73400"
FT                   /db_xref="GOA:A0A0F6BIZ9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP73400.1"
FT                   /translation="MNRTAIVYLVSLAAFLGPFTQTIYTPILPEVTKDFGTSSFLVNLT
FT                   ISIFTFFLALMQMVYGPLTDTKGRRNVLLFGVFLYITASLGCFFSNSIYVLLVFRALQA
FT                   IGIAAGSVVAATVIGDLFEGKARGKAMGTFQMMVSLGPVAGPIVGGFLGGRFNFHSVFL
FT                   VLVLAGLLIWVGNFIFLQETKPEKQLAKTFRLRDFIPILRHRTGSSIILLGFIQYYAMY
FT                   NFLVFLPSILTERYGLSAEEKGIAYLAMSCMIVIGSFIGGRIQGHWQERHIILATSYLN
FT                   VASILLFLIVSHISISLLLISIMLFGLFLGTSLPVQTTLLTYVFQANRSTAIGVYNFFR
FT                   YMGMALGPMIGSLLFSLGGYALVYGFTDIGFFFFSLWLTARVMFMNRPTSSI"
FT   gene            596758..597246
FT                   /locus_tag="GY4MC1_0569"
FT   CDS_pept        596758..597246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0569"
FT                   /product="Phosphinothricin acetyltransferase"
FT                   /note="KEGG: gwc:GWCH70_2852 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73401"
FT                   /db_xref="GOA:A0A0F6BJ00"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ00"
FT                   /inference="protein motif:PRIAM:2.3.1.183"
FT                   /protein_id="ADP73401.1"
FT                   /translation="MIRNANIEDLPAIVQIYNETIPSRMVTADLEPVTVESRKAWFFNH
FT                   DPHTRPLWVVELDGHVRAWLSFQSFYGRPAYRHTAEISIYISGAYRGKGIGKQLLQKAV
FT                   EEAPSLDIKTLLGFIFAHNEPSLRLFMRFGFETWGHLPKVAELDGIERDLLIVGKRMV"
FT   gene            597307..597564
FT                   /locus_tag="GY4MC1_0570"
FT   CDS_pept        597307..597564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ01"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2851"
FT                   /protein_id="ADP73402.1"
FT                   /translation="MNVMPIRLFTIQDGEGFVADAFQCPVTGNLIYKSSGTPSVIAYNA
FT                   LTEEQIQYLEKYGFRRMNGASAAAASSPGSSTLEELLPEQ"
FT   gene            complement(597685..598626)
FT                   /locus_tag="GY4MC1_0571"
FT   CDS_pept        complement(597685..598626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0571"
FT                   /product="nuclease (SNase domain-containing protein)"
FT                   /note="KEGG: gwc:GWCH70_2850 nuclease (SNase domain
FT                   protein); PFAM: nuclease (SNase domain-containing protein);
FT                   SMART: nuclease (SNase domain-containing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73403"
FT                   /db_xref="GOA:A0A0F6BJ02"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ02"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADP73403.1"
FT                   /translation="MKKFVSALAIIVSTAIFPGNSFAHPGALDKLGGHFRKSDCTYLLH
FT                   EPTPIAMQAKDKAALAQLIKKYNSNSECVRQLTLDKIDLQGHTLGGTSSSAASSPKQST
FT                   NQSSSLQLGQKYPAKLVTCIDGDTARFMVNGREYTTRFLFIDTPESTIQVEPYGKEASR
FT                   FTCSRLSRGDITLETDGSTLFDKYRRLLAWVWVGDKLLQEEIAKAGLVEDFYDYGDYKY
FT                   EDRIRKAMDEAKQAGAGMYGASSPKMNSADQQTKSEGQKPDIPSPDNEQKNQQADQETT
FT                   AKETSDSNTELPVFYLLVFAFIVAFFYFLSRK"
FT   sig_peptide     complement(598555..598626)
FT                   /locus_tag="GY4MC1_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            599854..600612
FT                   /locus_tag="GY4MC1_0572"
FT   CDS_pept        599854..600612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0572"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: bld:BLi01974 CwlC; PFAM: cell wall
FT                   hydrolase/autolysin; Sporulation domain-containing protein;
FT                   SMART: cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73404"
FT                   /db_xref="GOA:A0A0F6BJ03"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ03"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADP73404.1"
FT                   /translation="MVKIFIDPGHGGADPGAIGNGLQEKNVTLQIAVRVRDILLAEYDN
FT                   VSIRMSRIGDQTVSLTERTAAANTWGADFYLSIHVNSGGGTGYEDYVYPGVGSPTTTYQ
FT                   KNIHEEIIKLVDFLDRGMKQANFFVLRETNMPAVLTENGFIDNANDAAKLKSSSFIENI
FT                   ARGHVNGIVRSFGLPKKSAGTLYKVQIGAFRVKTNADHLAAKAKAKGFNVYVIYKDGLY
FT                   KVQIGAFANLENAKQLAEKAKAAGFEAIII"
FT   gene            complement(600767..602227)
FT                   /locus_tag="GY4MC1_0573"
FT   CDS_pept        complement(600767..602227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0573"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: oih:OB2707
FT                   benzaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73405"
FT                   /db_xref="GOA:A0A0F6BJ04"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ04"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADP73405.1"
FT                   /translation="MVNFKLLNKQYISGEWKDGTSNRQLIDFNPYNNEVITTFTCASLK
FT                   DVDEAYRSAKEAQKKWQHTNPIEKRAVFENAVKYIEENKESIENIIIDELGGTKLKAAF
FT                   EIDLVINIIKEAATYPFRMEGKILPSPVDGKENRLYRIPVGVVGVISPFNFPFFLSMKS
FT                   VAPALGAGNGVVLKPHEHTPITGGTLIAKIFEEAGLPKGLLNVVITEIEEIGDGFIEHP
FT                   IPKVISFTGSSKVGKHIGEVAGRHLKKVSLELGGNSALIVLDDADIDLAVSAAVFSRFT
FT                   HQGQICMSANRIIVHEKVYDEFLTKYVRKVASLKCGDPRDPETIIGPLMNERQVQMIIN
FT                   LIETGIKEGATPILKGEVKGNIVEPVIFTDVTPDMTIAKEELFGPVVCIMKVENDQQAI
FT                   EYANNSDFGLSGAIHTSNIERGAEMAKQIETGMIHINDGTINDEPIVAFGGEKNSGLGR
FT                   LNGSWSLDAFTTVKWISIQHTPRKYPYS"
FT   gene            complement(602248..603120)
FT                   /locus_tag="GY4MC1_0574"
FT   CDS_pept        complement(602248..603120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0574"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bld:BLi00758 YfmS; PFAM: chemotaxis sensory
FT                   transducer; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73406"
FT                   /db_xref="GOA:A0A0F6BJ05"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ05"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADP73406.1"
FT                   /translation="MEKVEEKEKTNVEDIELLDAFLKVAPYLNQLVHEDITVGIYDTEK
FT                   LIVNYPAKTFSLNVKPGDPLQEGDIITNAIKQNKLLSAIVPKELFGVGLIAKAMPIHDR
FT                   NGRVVGGIGIGVNMEKAMQLSEISSNLSTVMEEITATIQSMADSITELSNEITTISEKA
FT                   KEAAENVGKIEGISNLVKEIADQSNLLGLNAAIEAARAGEHGKGFSIVANEVRKMANTS
FT                   KQHVEEINEKTNQMKNLIKQLNDFIQSVSEESSAQSAAIEELSATMQEINTNIQVLAEI
FT                   AKQNIEIEK"
FT   gene            603681..604062
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0575"
FT   gene            604199..606022
FT                   /locus_tag="GY4MC1_0576"
FT   CDS_pept        604199..606022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0576"
FT                   /product="amino acid permease"
FT                   /note="KEGG: gwc:GWCH70_1210 amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73407"
FT                   /db_xref="GOA:A0A0F6BJ06"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ06"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_1210"
FT                   /protein_id="ADP73407.1"
FT                   /translation="MFSSLKRFLIGRPLKSTELGEQKLNKLKALAVLSSDALSSVAYGT
FT                   EQILLVLATIGAIAFWYSLPIAIGVLILLMALILSYRQIIYSYPHGGGAYVVSKTNLGV
FT                   NPGLIAGGSLLVDYILTVAVSVSAGTDAITSAFPTLHQYTVGIAIAMVVFITILNLRGI
FT                   NESASVLAYPVYLFVLALVILIIVGIFRIINGQVPSTLHTPVGTAVPGITLFLLLRAFA
FT                   SGCSALTGVEAISNAVPNFKEPAAKNAAKTLVMMGFILAFLFVGVTFLAYWYGIAPKAE
FT                   ETVVSQLASEVFGRSAMYYFIQGATALILILAANTGFSAFPLLAYNLASDKYMPRMYLI
FT                   RGDRLGYSNGIITLGLASILVIVAFNGQTEQLIPLYAVGVFIPFTLSQTGMIVKWVREK
FT                   PTGWVPKLLTNLLGAAITLTVLCIFFITKFTQVWAVLVFLPIIVFIFHQIHKHYDAVAE
FT                   QLRVNPNEIPDKIEGNVVLVPVAGITKVVEQSLNYAQAIGDYVFAVYVAFDRESMLRME
FT                   GKWKKWRPDVRLVTLFSYYRDLITPISKLVDTIESKAEERNYTVTVLIPQFIPKKGWHN
FT                   FLHNQSSVLLRLYLLYKKNVIVSTVPYRLHK"
FT   gene            606529..607299
FT                   /locus_tag="GY4MC1_0577"
FT   CDS_pept        606529..607299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0577"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD;
FT                   Alanyl-tRNA synthetase, class IIc-like; KEGG:
FT                   bcy:Bcer98_0478 threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73408"
FT                   /db_xref="GOA:A0A0F6BJ07"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ07"
FT                   /inference="protein motif:PFAM:PF07973"
FT                   /protein_id="ADP73408.1"
FT                   /translation="MTRELFLEDSYKKAHHAKVIEIKEDKIILDETIFYPTGGGQPHDT
FT                   GMIKQGNETFKVNKVQRENGQIVHYVDNIEKLKQGPVEILIDWDRRYKFMRYHSLLHVL
FT                   AGYLYNKFGALAIGNQIFEDRARIDFQFEEPLTNEQFNEIEDEINKLIQEDHQVSIRTV
FT                   SREEAERIDGSIKTVINLLPPSIKNVRLVAIGDIDEQACGGTHVKETKEIGPFQISKIK
FT                   SKGQNKKRLEVKSKLLCKFPFDRKHGPDDLTYGR"
FT   gene            complement(607434..608669)
FT                   /locus_tag="GY4MC1_0578"
FT   CDS_pept        complement(607434..608669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0578"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   gwc:GWCH70_1766 transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73409"
FT                   /db_xref="GOA:A0A0F6BLG8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BLG8"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73409.1"
FT                   /translation="MAQYHITLNDELLHGLFTRDEGLAKLLEQVLNQILEAQVEEQLGA
FT                   RRYERTEERKGYRNGSYPRQLTTRVGRLTLRVPRTRDGEFSTELFQRYQRSEQALVLAL
FT                   MEMVVNGVSTRKITQITEELCGTSFSKSTVSSLCKGLDPIIQDWNYRSLHEHVYPFVLV
FT                   DAIYTKVREDGRVRSRAVLIATGVNEEGYREILGLQIGNSESESSWSEFFGWLKDRGLR
FT                   GVDLIISDQHGGLVQAIEKHFQGATWQRCQTHFIRNILDAAPKYMQDALLEEIRGILHA
FT                   PNKQTARLLLEQVLAKWEEKAPKAMQILEEGFEDATAVLDYPDRYRRRLRTTNGVERLN
FT                   EEIRRRERVIRIFPNRESVYRLVGAVLIEIDEKWMSGRKYLDMSEYWRWRKMKEQGVRS
FT                   VNQEAPAIKRVG"
FT   gene            complement(608978..609061)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0579"
FT   gene            complement(609096..609545)
FT                   /locus_tag="GY4MC1_0580"
FT   CDS_pept        complement(609096..609545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0580"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: bha:BH3726 hypothetical protein; manually
FT                   curated; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73410"
FT                   /db_xref="GOA:A0A0F6BJ09"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ09"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP73410.1"
FT                   /translation="MRTRVRAAGVVVHNEHILLHKMDDFWVLPGGGVGFEATAEGLKRE
FT                   FKEELGIEIKIKNLLWVAENFFEYNNQKEQSIEFYYLIEFPENCALYNQNSFEGYEGKQ
FT                   TLKFKWHKIDNINNLTILPEFLAEYLKELRTSIPERIQHIINKTI"
FT   gene            complement(610196..611395)
FT                   /locus_tag="GY4MC1_0581"
FT   CDS_pept        complement(610196..611395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0581"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: gtn:GTNG_0752
FT                   DNA integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73411"
FT                   /db_xref="GOA:A0A0F6BJ10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ10"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP73411.1"
FT                   /translation="MASIQRRGKSSFLLVVEAGYDAKGKRLRRTKTIRIEDEALLKTTK
FT                   KLRDYLNEELLKFKMEVEAGEYIAPEKMKLADFIKEWETKYAVKELSETTLNNYLSHIK
FT                   NHILPALGHMRIDQIKPVHIVNFLDQIKRADGKKKPLATRTIENAYLTIRNILQRAVEW
FT                   QIIKSNPASAVKKPKSKKEAVKEVQVYDEKEVEALFRAVQNEPFHWRIFTTLAIAAGLR
FT                   RGELLALEWSNIDLEKGVIRINKAIVKGRKRSVEKSPKTKKSNRLVSLPKSVVAELKLY
FT                   RRHWLKQKLQAGDLWKEEKEYLFCNIDGRHFYPTTPTTWWRRFTKRAGIRYIRLHDLRH
FT                   TSATLLINQGVHAKIIAERLGHSDIRVTMDIYGHALQKADHEAANKLDHLFTNTSSQMK
FT                   "
FT   gene            complement(611426..611575)
FT                   /locus_tag="GY4MC1_0582"
FT   CDS_pept        complement(611426..611575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_2627 phage integrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73412"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ11"
FT                   /inference="similar to AA sequence:KEGG:Bcer98_2627"
FT                   /protein_id="ADP73412.1"
FT                   /translation="MAYFRKVKAKNKKGYTWSFTIDIGTGKRKQITRRGFESFYFYENL
FT                   IAEN"
FT   gene            complement(611663..612178)
FT                   /locus_tag="GY4MC1_0583"
FT   CDS_pept        complement(611663..612178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0583"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bbe:BBR47_35830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73413"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ12"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADP73413.1"
FT                   /translation="MELHRYYTTALEDWVTRFYTRLKIFRPEDISPLIISRKLGIFLRE
FT                   RPFPSTHQVVGRFRCIVVDSRLSKEKKREAFFHELCHILRHVGIQSMMPEAFRELQERD
FT                   ATHFTKYAAIPFHMLKLIDWHEPYIVEHMSNMFKVTPELCEERLTQIRNRILVKQSSNE
FT                   TKISTFQR"
FT   gene            complement(612280..613173)
FT                   /locus_tag="GY4MC1_0584"
FT   CDS_pept        complement(612280..613173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0584"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: cpf:CPF_1606 putative
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73414"
FT                   /db_xref="GOA:A0A0F6BJ13"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ13"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ADP73414.1"
FT                   /translation="MIVMGVIIIPVTDSPLRYPGGKTQLKGFINELIQTNSIKDCTYVE
FT                   PFAGGAGVAMSLLLTEKVQEVIINDIDSSIYCFWKSILEHTDNFIKLLEETPVNINEWY
FT                   KQKYIQENKDKFSVLEIGFSTFFLNRTNRSGIITGGPIGGYSQHSQYKIDCRFNKKNLI
FT                   KKILKIASYKKQITVTNDDASVFIDKVIKFLDKDKTFIFFDPPYYKQGKHLYTNFYTHD
FT                   DHVHLSKKILSLKDYYWITTYDLSKEIMEIYNIKNQKIYRLNYSANNKRKAAELLFYSE
FT                   RTTLPETNHIELISNI"
FT   gene            complement(613207..614892)
FT                   /locus_tag="GY4MC1_0585"
FT   CDS_pept        complement(613207..614892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0585"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: cbt:CLH_2100 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73415"
FT                   /db_xref="GOA:A0A0F6BJ14"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ14"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADP73415.1"
FT                   /translation="MSTHHRNLIKSIYIKKFRKLKEIKFDIAERITVIAGHNGIGKSTI
FT                   LGLIANGSELKGHYSYFDKTFQSKFEEIFHLDINYDYTQNQDEKYSVILSYKYNNNDIY
FT                   KYCTVTKHGKRLRIVPRNATKEGKQINQEIDGIGTSAKVPIPTLYVGMSRVIPIGESKS
FT                   EHYTLTHTSSIHEEDLNYLIECFKEIIGNEKLNKERASKQDLKYSTKRSIGPDFQEYSY
FT                   KSVSLGQDSLSSILTAVMSFRKLKRELGDQYHGGILVIDEIDACLHPSAQKNLLKVLDK
FT                   ATKQLDLQIICTSHSLTVIQEVLGKQINTKQNKNDQRLYYNVVYIQDTARPRIMKNPSY
FT                   KKIKNDMFLRLNSYQDDKQDVKIYFEDDEALFFFNQIEKIVSDKLEIEGLRLDKISAQI
FT                   SCDTLLKLPSKDSYFHSVIIVLDGDVSQQGMYHPIINENENICTLPGPESPERIIHLYL
FT                   KELIDNTDHDFWTNNQDNITVQFTRDTILKELDEELSATNGSNGKRKRRDMYKKWFNEF
FT                   KTVFERTNIISYWLNDNPEEAQKFIDGFNKSIKYIRTFYIQNDH"
FT   gene            complement(615228..615704)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0586"
FT   gene            complement(615742..617334)
FT                   /locus_tag="GY4MC1_0587"
FT   CDS_pept        complement(615742..617334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lmo:lmo1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ15"
FT                   /inference="similar to AA sequence:KEGG:lmo1118"
FT                   /protein_id="ADP73416.1"
FT                   /translation="MAYEIKTIDIDKIIVNVLNPRYEPQESELKEMDLIINNGKIIELI
FT                   KDIAQYGLDPSENLIVSYDKELDAYISEEGNRRITAIKILNDPDLIPSFTKNRDKLINQ
FT                   VKKIKEKARYSYIKEVNCVIIDDEDTKHHFIELKHTGENKGAGRVRWNTESQARFRSTD
FT                   KFREHLLKFLKSIHPEIKDSFGLTTVERIISDPDMRDAIGLTIDKKNQEIKLINDNSKQ
FT                   KLYFILDGLLTKKFNVNTFRHKEDRQKFAQDYLLNDEHQPWKELYIEAIKNNQTTKNNE
FT                   KIVPTQDNLNQDYYKESNSQKDLPNRNDRDKGNPNQNDRNQGNSDKNNSNKDESFIDIS
FT                   NQTSENKNNNGRKTSGRPPKDIRDFDILTKAIPFKNQYRKNKRINQILKEMSQINYKEN
FT                   PISSMYLIRSILETYVHKYIDYFASLDRHHPYKMKNIPPQRDKRRKELKNLIYEDIYNH
FT                   LKNVIQDYADTYELIRVTFTDNNQASAMQIINYYIHSGTDYPDSIELLEAWNKISTIIK
FT                   TLDELLAKHADQK"
FT   gene            complement(617625..617959)
FT                   /pseudo
FT                   /locus_tag="GY4MC1_0588"
FT   gene            complement(617995..618441)
FT                   /locus_tag="GY4MC1_0589"
FT   CDS_pept        complement(617995..618441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0589"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: cth:Cthe_2460 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73417"
FT                   /db_xref="GOA:A0A0F6BJ16"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ16"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73417.1"
FT                   /translation="MNILGKRLKYLREKFNYSQKKVAEAIGISNVQLSRYESGDRNPDP
FT                   ELIAAFADFYGVTTDYILGRTDDPQGYAPETNIDNIKDTKELNTLIKINELIKKYGIEQ
FT                   MGFFDIEKWKSLSEEEIEEIIKHFEWVVHKAKEKNKAAREGTED"
FT   gene            618628..618861
FT                   /locus_tag="GY4MC1_0590"
FT   CDS_pept        618628..618861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0590"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: tte:TTE2124 helix-turn-helix; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73418"
FT                   /db_xref="GOA:A0A0F6BJ17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ17"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73418.1"
FT                   /translation="MKNKQVDLEKIKKLRKEANISLEKMAELLGYESPNGYYYLETGRV
FT                   KFPADKLAVVSEILNVPIDQLFFEVNFAKMAK"
FT   gene            618910..619215
FT                   /locus_tag="GY4MC1_0591"
FT   CDS_pept        618910..619215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ18"
FT                   /inference="similar to AA sequence:KEGG:GK0497"
FT                   /protein_id="ADP73419.1"
FT                   /translation="MNLEQRLSELEARVSQLEKEAAAATTAETEKHLNDLPNSTKEIIQ
FT                   KEIEKAKQSELIVGIDPESYLAKEILWQSRKMIELENSVSKISSSINRLKRLLSKS"
FT   gene            complement(619222..619590)
FT                   /locus_tag="GY4MC1_0592"
FT   CDS_pept        complement(619222..619590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ19"
FT                   /inference="similar to AA sequence:KEGG:GK0498"
FT                   /protein_id="ADP73420.1"
FT                   /translation="MNDNFEHQLKTISFLISEGFNAAKYCHELIFAEDRKNNINLALTF
FT                   LNQANTFITSAKAIYVQFSLEGESQELEDFFHQFSVFNKEVLTNVRTGHSHQWSDIEFR
FT                   RLEKEFNALTDFLNIWRK"
FT   gene            619661..619846
FT                   /locus_tag="GY4MC1_0593"
FT   CDS_pept        619661..619846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0593"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="KEGG: oih:OB3324 hypothetical protein; TIGRFAM: DNA
FT                   binding domain protein, excisionase family; PFAM: Prophage
FT                   CP4-57 regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73421"
FT                   /db_xref="GOA:A0A0F6BJ20"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL: