(data stored in ACNUC7421 zone)

EMBL: CP002299

ID   CP002299; SV 1; circular; genomic DNA; STD; PRO; 8815781 BP.
XX
AC   CP002299; ADDL01000000-ADDL01000153;
XX
PR   Project:PRJNA37913;
XX
DT   07-NOV-2010 (Rel. 106, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 3)
XX
DE   Frankia inefficax strain EuI1c chromosome, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Frankia inefficax
OC   Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
XX
RN   [1]
RP   1-8815781
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Jeffries C., Kyrpides N., Ivanova N., Mikhailova N., Beauchemin N., Sen A.,
RA   Sur S.A., Gtari M., Wall L., Tisa L., Woyke T.;
RT   "Complete sequence of Frankia sp. EuI1c";
RL   Unpublished.
XX
RN   [2]
RP   1-8815781
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Jeffries C., Kyrpides N., Ivanova N., Mikhailova N., Beauchemin N., Sen A.,
RA   Sur S.A., Gtari M., Wall L., Tisa L., Woyke T.;
RT   ;
RL   Submitted (29-OCT-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ed1dbf5b9ad0b48694bf7cccdfa09357.
DR   BioSample; SAMN02232023.
DR   EnsemblGenomes-Gn; EBG00001041508.
DR   EnsemblGenomes-Gn; EBG00001041509.
DR   EnsemblGenomes-Gn; EBG00001041511.
DR   EnsemblGenomes-Gn; EBG00001041514.
DR   EnsemblGenomes-Gn; EBG00001041518.
DR   EnsemblGenomes-Gn; EBG00001041520.
DR   EnsemblGenomes-Gn; EBG00001041522.
DR   EnsemblGenomes-Gn; EBG00001041523.
DR   EnsemblGenomes-Gn; EBG00001041525.
DR   EnsemblGenomes-Gn; EBG00001041527.
DR   EnsemblGenomes-Gn; EBG00001041529.
DR   EnsemblGenomes-Gn; EBG00001041532.
DR   EnsemblGenomes-Gn; EBG00001041534.
DR   EnsemblGenomes-Gn; EBG00001041536.
DR   EnsemblGenomes-Gn; EBG00001041538.
DR   EnsemblGenomes-Gn; EBG00001041539.
DR   EnsemblGenomes-Gn; EBG00001041540.
DR   EnsemblGenomes-Gn; EBG00001041541.
DR   EnsemblGenomes-Gn; EBG00001041542.
DR   EnsemblGenomes-Gn; EBG00001041543.
DR   EnsemblGenomes-Gn; EBG00001041545.
DR   EnsemblGenomes-Gn; EBG00001041547.
DR   EnsemblGenomes-Gn; EBG00001041549.
DR   EnsemblGenomes-Gn; EBG00001041551.
DR   EnsemblGenomes-Gn; EBG00001041553.
DR   EnsemblGenomes-Gn; EBG00001041555.
DR   EnsemblGenomes-Gn; EBG00001041557.
DR   EnsemblGenomes-Gn; EBG00001041559.
DR   EnsemblGenomes-Gn; EBG00001041561.
DR   EnsemblGenomes-Gn; EBG00001041563.
DR   EnsemblGenomes-Gn; EBG00001041565.
DR   EnsemblGenomes-Gn; EBG00001041566.
DR   EnsemblGenomes-Gn; EBG00001041567.
DR   EnsemblGenomes-Gn; EBG00001041568.
DR   EnsemblGenomes-Gn; EBG00001041569.
DR   EnsemblGenomes-Gn; EBG00001041570.
DR   EnsemblGenomes-Gn; EBG00001041571.
DR   EnsemblGenomes-Gn; EBG00001041572.
DR   EnsemblGenomes-Gn; EBG00001041573.
DR   EnsemblGenomes-Gn; EBG00001041574.
DR   EnsemblGenomes-Gn; EBG00001041575.
DR   EnsemblGenomes-Gn; EBG00001041576.
DR   EnsemblGenomes-Gn; EBG00001041577.
DR   EnsemblGenomes-Gn; EBG00001041578.
DR   EnsemblGenomes-Gn; EBG00001041579.
DR   EnsemblGenomes-Gn; EBG00001041580.
DR   EnsemblGenomes-Gn; EBG00001041581.
DR   EnsemblGenomes-Gn; EBG00001041582.
DR   EnsemblGenomes-Gn; EBG00001041583.
DR   EnsemblGenomes-Gn; EBG00001041584.
DR   EnsemblGenomes-Gn; EBG00001041585.
DR   EnsemblGenomes-Gn; EBG00001041586.
DR   EnsemblGenomes-Gn; EBG00001041587.
DR   EnsemblGenomes-Gn; EBG00001041588.
DR   EnsemblGenomes-Gn; EBG00001041589.
DR   EnsemblGenomes-Gn; EBG00001041590.
DR   EnsemblGenomes-Gn; EBG00001041591.
DR   EnsemblGenomes-Gn; EBG00001041593.
DR   EnsemblGenomes-Gn; EBG00001041596.
DR   EnsemblGenomes-Gn; EBG00001041600.
DR   EnsemblGenomes-Gn; EBG00001041602.
DR   EnsemblGenomes-Gn; EBG00001041604.
DR   EnsemblGenomes-Gn; EBG00001041605.
DR   EnsemblGenomes-Gn; EBG00001041606.
DR   EnsemblGenomes-Gn; EBG00001041607.
DR   EnsemblGenomes-Gn; EBG00001041608.
DR   EnsemblGenomes-Gn; EBG00001041609.
DR   EnsemblGenomes-Gn; EBG00001041610.
DR   EnsemblGenomes-Gn; EBG00001041611.
DR   EnsemblGenomes-Gn; EBG00001041612.
DR   EnsemblGenomes-Gn; EBG00001041613.
DR   EnsemblGenomes-Gn; EBG00001041614.
DR   EnsemblGenomes-Gn; EBG00001041616.
DR   EnsemblGenomes-Gn; EBG00001041618.
DR   EnsemblGenomes-Gn; EBG00001041620.
DR   EnsemblGenomes-Gn; EBG00001041622.
DR   EnsemblGenomes-Gn; EBG00001041624.
DR   EnsemblGenomes-Gn; EBG00001041626.
DR   EnsemblGenomes-Gn; EBG00001041628.
DR   EnsemblGenomes-Gn; EBG00001041630.
DR   EnsemblGenomes-Gn; EBG00001041632.
DR   EnsemblGenomes-Gn; EBG00001041633.
DR   EnsemblGenomes-Gn; EBG00001041634.
DR   EnsemblGenomes-Gn; FraEuI1c_R0001.
DR   EnsemblGenomes-Gn; FraEuI1c_R0002.
DR   EnsemblGenomes-Gn; FraEuI1c_R0003.
DR   EnsemblGenomes-Gn; FraEuI1c_R0004.
DR   EnsemblGenomes-Gn; FraEuI1c_R0005.
DR   EnsemblGenomes-Gn; FraEuI1c_R0006.
DR   EnsemblGenomes-Gn; FraEuI1c_R0007.
DR   EnsemblGenomes-Gn; FraEuI1c_R0008.
DR   EnsemblGenomes-Gn; FraEuI1c_R0009.
DR   EnsemblGenomes-Gn; FraEuI1c_R0010.
DR   EnsemblGenomes-Gn; FraEuI1c_R0011.
DR   EnsemblGenomes-Gn; FraEuI1c_R0012.
DR   EnsemblGenomes-Gn; FraEuI1c_R0013.
DR   EnsemblGenomes-Gn; FraEuI1c_R0014.
DR   EnsemblGenomes-Gn; FraEuI1c_R0015.
DR   EnsemblGenomes-Gn; FraEuI1c_R0016.
DR   EnsemblGenomes-Gn; FraEuI1c_R0017.
DR   EnsemblGenomes-Gn; FraEuI1c_R0018.
DR   EnsemblGenomes-Gn; FraEuI1c_R0019.
DR   EnsemblGenomes-Gn; FraEuI1c_R0020.
DR   EnsemblGenomes-Gn; FraEuI1c_R0021.
DR   EnsemblGenomes-Gn; FraEuI1c_R0022.
DR   EnsemblGenomes-Gn; FraEuI1c_R0023.
DR   EnsemblGenomes-Gn; FraEuI1c_R0024.
DR   EnsemblGenomes-Gn; FraEuI1c_R0025.
DR   EnsemblGenomes-Gn; FraEuI1c_R0026.
DR   EnsemblGenomes-Gn; FraEuI1c_R0027.
DR   EnsemblGenomes-Gn; FraEuI1c_R0028.
DR   EnsemblGenomes-Gn; FraEuI1c_R0029.
DR   EnsemblGenomes-Gn; FraEuI1c_R0030.
DR   EnsemblGenomes-Gn; FraEuI1c_R0031.
DR   EnsemblGenomes-Gn; FraEuI1c_R0032.
DR   EnsemblGenomes-Gn; FraEuI1c_R0033.
DR   EnsemblGenomes-Gn; FraEuI1c_R0034.
DR   EnsemblGenomes-Gn; FraEuI1c_R0035.
DR   EnsemblGenomes-Gn; FraEuI1c_R0036.
DR   EnsemblGenomes-Gn; FraEuI1c_R0037.
DR   EnsemblGenomes-Gn; FraEuI1c_R0038.
DR   EnsemblGenomes-Gn; FraEuI1c_R0039.
DR   EnsemblGenomes-Gn; FraEuI1c_R0040.
DR   EnsemblGenomes-Gn; FraEuI1c_R0041.
DR   EnsemblGenomes-Gn; FraEuI1c_R0042.
DR   EnsemblGenomes-Gn; FraEuI1c_R0043.
DR   EnsemblGenomes-Gn; FraEuI1c_R0044.
DR   EnsemblGenomes-Gn; FraEuI1c_R0045.
DR   EnsemblGenomes-Gn; FraEuI1c_R0046.
DR   EnsemblGenomes-Gn; FraEuI1c_R0047.
DR   EnsemblGenomes-Gn; FraEuI1c_R0048.
DR   EnsemblGenomes-Gn; FraEuI1c_R0049.
DR   EnsemblGenomes-Gn; FraEuI1c_R0050.
DR   EnsemblGenomes-Gn; FraEuI1c_R0051.
DR   EnsemblGenomes-Gn; FraEuI1c_R0052.
DR   EnsemblGenomes-Gn; FraEuI1c_R0053.
DR   EnsemblGenomes-Gn; FraEuI1c_R0054.
DR   EnsemblGenomes-Gn; FraEuI1c_R0055.
DR   EnsemblGenomes-Gn; FraEuI1c_R0056.
DR   EnsemblGenomes-Gn; FraEuI1c_R0057.
DR   EnsemblGenomes-Gn; FraEuI1c_R0058.
DR   EnsemblGenomes-Tr; EBT00001643369.
DR   EnsemblGenomes-Tr; EBT00001643370.
DR   EnsemblGenomes-Tr; EBT00001643371.
DR   EnsemblGenomes-Tr; EBT00001643372.
DR   EnsemblGenomes-Tr; EBT00001643374.
DR   EnsemblGenomes-Tr; EBT00001643376.
DR   EnsemblGenomes-Tr; EBT00001643378.
DR   EnsemblGenomes-Tr; EBT00001643380.
DR   EnsemblGenomes-Tr; EBT00001643382.
DR   EnsemblGenomes-Tr; EBT00001643384.
DR   EnsemblGenomes-Tr; EBT00001643385.
DR   EnsemblGenomes-Tr; EBT00001643387.
DR   EnsemblGenomes-Tr; EBT00001643388.
DR   EnsemblGenomes-Tr; EBT00001643389.
DR   EnsemblGenomes-Tr; EBT00001643390.
DR   EnsemblGenomes-Tr; EBT00001643391.
DR   EnsemblGenomes-Tr; EBT00001643392.
DR   EnsemblGenomes-Tr; EBT00001643393.
DR   EnsemblGenomes-Tr; EBT00001643394.
DR   EnsemblGenomes-Tr; EBT00001643395.
DR   EnsemblGenomes-Tr; EBT00001643396.
DR   EnsemblGenomes-Tr; EBT00001643398.
DR   EnsemblGenomes-Tr; EBT00001643399.
DR   EnsemblGenomes-Tr; EBT00001643400.
DR   EnsemblGenomes-Tr; EBT00001643401.
DR   EnsemblGenomes-Tr; EBT00001643402.
DR   EnsemblGenomes-Tr; EBT00001643403.
DR   EnsemblGenomes-Tr; EBT00001643404.
DR   EnsemblGenomes-Tr; EBT00001643406.
DR   EnsemblGenomes-Tr; EBT00001643407.
DR   EnsemblGenomes-Tr; EBT00001643410.
DR   EnsemblGenomes-Tr; EBT00001643411.
DR   EnsemblGenomes-Tr; EBT00001643413.
DR   EnsemblGenomes-Tr; EBT00001643415.
DR   EnsemblGenomes-Tr; EBT00001643416.
DR   EnsemblGenomes-Tr; EBT00001643417.
DR   EnsemblGenomes-Tr; EBT00001643418.
DR   EnsemblGenomes-Tr; EBT00001643419.
DR   EnsemblGenomes-Tr; EBT00001643420.
DR   EnsemblGenomes-Tr; EBT00001643422.
DR   EnsemblGenomes-Tr; EBT00001643425.
DR   EnsemblGenomes-Tr; EBT00001643427.
DR   EnsemblGenomes-Tr; EBT00001643428.
DR   EnsemblGenomes-Tr; EBT00001643429.
DR   EnsemblGenomes-Tr; EBT00001643430.
DR   EnsemblGenomes-Tr; EBT00001643432.
DR   EnsemblGenomes-Tr; EBT00001643433.
DR   EnsemblGenomes-Tr; EBT00001643434.
DR   EnsemblGenomes-Tr; EBT00001643435.
DR   EnsemblGenomes-Tr; EBT00001643436.
DR   EnsemblGenomes-Tr; EBT00001643437.
DR   EnsemblGenomes-Tr; EBT00001643439.
DR   EnsemblGenomes-Tr; EBT00001643441.
DR   EnsemblGenomes-Tr; EBT00001643442.
DR   EnsemblGenomes-Tr; EBT00001643443.
DR   EnsemblGenomes-Tr; EBT00001643444.
DR   EnsemblGenomes-Tr; EBT00001643445.
DR   EnsemblGenomes-Tr; EBT00001643446.
DR   EnsemblGenomes-Tr; EBT00001643447.
DR   EnsemblGenomes-Tr; EBT00001643448.
DR   EnsemblGenomes-Tr; EBT00001643449.
DR   EnsemblGenomes-Tr; EBT00001643450.
DR   EnsemblGenomes-Tr; EBT00001643451.
DR   EnsemblGenomes-Tr; EBT00001643452.
DR   EnsemblGenomes-Tr; EBT00001643453.
DR   EnsemblGenomes-Tr; EBT00001643455.
DR   EnsemblGenomes-Tr; EBT00001643457.
DR   EnsemblGenomes-Tr; EBT00001643458.
DR   EnsemblGenomes-Tr; EBT00001643460.
DR   EnsemblGenomes-Tr; EBT00001643461.
DR   EnsemblGenomes-Tr; EBT00001643462.
DR   EnsemblGenomes-Tr; EBT00001643464.
DR   EnsemblGenomes-Tr; EBT00001643467.
DR   EnsemblGenomes-Tr; EBT00001643468.
DR   EnsemblGenomes-Tr; EBT00001643469.
DR   EnsemblGenomes-Tr; EBT00001643470.
DR   EnsemblGenomes-Tr; EBT00001643471.
DR   EnsemblGenomes-Tr; EBT00001643472.
DR   EnsemblGenomes-Tr; EBT00001643473.
DR   EnsemblGenomes-Tr; EBT00001643474.
DR   EnsemblGenomes-Tr; EBT00001643475.
DR   EnsemblGenomes-Tr; EBT00001643476.
DR   EnsemblGenomes-Tr; EBT00001643477.
DR   EnsemblGenomes-Tr; FraEuI1c_R0001-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0002-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0003-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0004-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0005-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0006-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0007-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0008-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0009-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0010-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0011-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0012-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0013-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0014-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0015-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0016-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0017-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0018-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0019-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0020-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0021-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0022-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0023-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0024-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0025-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0026-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0027-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0028-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0029-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0030-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0031-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0032-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0033-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0034-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0035-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0036-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0037-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0038-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0039-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0040-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0041-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0042-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0043-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0044-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0045-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0046-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0047-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0048-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0049-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0050-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0051-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0052-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0053-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0054-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0055-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0056-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0057-1.
DR   EnsemblGenomes-Tr; FraEuI1c_R0058-1.
DR   EuropePMC; PMC3127629; 21498757.
DR   EuropePMC; PMC5311412; 27986724.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002299.
DR   SILVA-SSU; CP002299.
DR   StrainInfo; 684005; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086229
CC   Source DNA and organism available from Louis S. Tisa (LST@unh.edu)
CC   Contacts: Louis S. Tisa (LST@unh.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type     :: bacteria_archaea
CC   project_name           :: Frankia sp. EuI1c
CC   collection_date        :: Missing
CC   lat_lon                :: Missing
CC   depth                  :: Missing
CC   alt_elev               :: Missing
CC   country                :: Missing
CC   environment            :: Host, Plant symbiont, Soil
CC   num_replicons          :: 1
CC   ref_biomaterial        :: Missing
CC   biotic_relationship    :: Symbiotic
CC   trophic_level          :: Chemoorganotroph
CC   rel_to_oxygen          :: Aerobe
CC   isol_growth_condt      :: Missing
CC   sequencing_meth        :: WGS
CC   assembly               :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy     :: Finished
CC   GOLD Stamp ID          :: Gi04370
CC   Greengenes ID          :: 11682
CC   Funding Program        :: DOE-CSP 2008
CC   Cell Shape             :: Filament-shaped
CC   Motility               :: Nonmotile
CC   Sporulation            :: Sporulating
CC   Temperature Range      :: Mesophile
CC   Gram Staining          :: Gram+
CC   Symbiotic Relationship :: Mutualistic
CC   Diseases               :: None
CC   Phenotypes             :: Non-Pathogen
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8815781
FT                   /organism="Frankia inefficax"
FT                   /strain="EuI1c"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:298654"
FT                   /type_material="type strain of Frankia inefficax"
FT   gene            152..1690
FT                   /locus_tag="FraEuI1c_0001"
FT   CDS_pept        152..1690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   fal:FRAAL0002 chromosomal replication initiator protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78089"
FT                   /db_xref="GOA:E3J251"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E3J251"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADP78089.1"
FT                   /translation="MTDRDTTPVTGSQRQLPLGEGEDPDLHEVWRQAVAGVADGTLSAQ
FT                   QRAWLRLTRPLGLVQDTALLAAPNEFTKDLLDSRLRPFLSTALTAAYGREIRVAVTVEH
FT                   LPDPEPMTGPMVLPQAALSGTGSSGSGDADDDGRVDSPLDAPTPPIQRVATGLGRDPEP
FT                   RPSEPARLNPRYVFETFVIGDSNRFPHAASVAVAEAPAKAYNPLFIYGDSGLGKTHLLH
FT                   AIGHYTKKLYPDAQVKYVSTEEFTNDFINSIRDDRQQAFQRRYRDIDVLLVDDIQFLEN
FT                   KERTQEEFFHTFNVLHDTEKQLVISSDRSPRQLSALEDRLRSRFEWGLITDVTPPDLET
FT                   RIAILSKKAAIERLPVPPDVLEYIATHIERNIRELEGALIRVAAFASLNKSHVDRTLAE
FT                   IVLRDLIPDATNTEITATSIMNATASYFGVSMEDLCGTSRSRVLVTARQIAMYLCRELT
FT                   DLSLPKIGQHFGGRDHTTVMHANRKIRGLMAERRAIYNQVTELTNRIRAETRHL"
FT   gene            2876..4039
FT                   /locus_tag="FraEuI1c_0002"
FT   CDS_pept        2876..4039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: fal:FRAAL0004 DNA
FT                   polymerase III, beta chain; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78090"
FT                   /db_xref="GOA:E3J252"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3J252"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP78090.1"
FT                   /translation="MKFRVERDEFTEAVAWTARSLPSRSATATNQQVLMGLLLDATGPG
FT                   LVVAAFDYEVAAQATLEATVHEEGRALAPGRMLADITKQLPAAPVEVETDDNKLVITCG
FT                   NARFTLQTLPVDEYPTLPPLPPITGHIEGGAFGAAVAQVAVAAGKDDTLPVLTGVRLEI
FT                   EGDTLTLAATDRYRLAVRTLKWSPSSPDAAGVALIPARTLLDTARSLGGGTAQVAIALG
FT                   TGPSGEALAGFAGNHRQTTTRLVDGQFPPYRKLLPDSCPLTAQAEKGPLLEAVKRVALV
FT                   APKTAPVRLAFSADHLRLEAGSHGGEAQASETLPATYDGPDLEVAFNPAYLQDALTAVE
FT                   SDQVEFGFASAEDAEVAAKKPAILTGKGAGDELPDYRYLLMPIQLNG"
FT   gene            4049..5173
FT                   /locus_tag="FraEuI1c_0003"
FT   CDS_pept        4049..5173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: fal:FRAAL0005 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78091"
FT                   /db_xref="GOA:E3J253"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E3J253"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADP78091.1"
FT                   /translation="MHVTHLQLVDFRSYPALELTLPAGVVTFVGANGQGKTNLLEAVGY
FT                   VATLGSHRVSGDAPLIREGAERAVIRSRIVNGDRAALAEIEIVTGRANKVRLNRRPLSR
FT                   PRELLGLLSVVLFAPEDLAMVKGDPGERRRFLDELLVARTPRLAAVIADYERVLRQRTT
FT                   LLRAHGDLRTLESWDEALARHGAELLAARLALVDDLRPRVQAAYAAVAGTADEDATEKG
FT                   VGVDYRCGVELPEGADRDAIAAALIEELARVRPREIERGVTLVGPHRDELALAVGGRPA
FT                   RGYASHGESWSLALALRLASYELLEADDRAPVLLLDDVFAELDAHRRRRLAELVAPAEQ
FT                   VLITAAVGADVPAELGGPRFTVQRGEVLDVAGSG"
FT   gene            5154..5762
FT                   /locus_tag="FraEuI1c_0004"
FT   CDS_pept        5154..5762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   fal:FRAAL0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78092"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E3J254"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADP78092.1"
FT                   /translation="MSPDPAEPDQNGAPRVTGADLARQVLAAAKADARARARGGRPGGG
FT                   GSPGRGADASAAGATPGDDDREPPRRPRLPGIAAPGREWREPTSFAASINRMLAARGWQ
FT                   TKAKDSGVLANWDVIVGPEIASHATPVSLRDGLLELEAESTAWATQLRLLAPRLLGVLR
FT                   RELGEGVVSRITVRGPSAPSWRHGPAQMPGGRGPRDTYG"
FT   gene            6077..8017
FT                   /locus_tag="FraEuI1c_0005"
FT   CDS_pept        6077..8017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: fal:FRAAL0008 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78093"
FT                   /db_xref="GOA:E3J255"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3J255"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADP78093.1"
FT                   /translation="MAYDASSIKVLEGLDAVRKRPGMYIGSTGERGLHHLVSEVVDNSV
FT                   DEALAGFCDTITVTLLADGGVRVVDNGRGIPVGMHPTEKRPTVEVVLTILHAGGKFDSD
FT                   SYAVSGGLHGVGISVVNALSTKVEVEIKVDGFHWFQRYTAQRPGPLEKRAPLKRGERTG
FT                   TTVTFWADAEIFETTEYKYETLYRRLQEMAFLNKGISISLRDERAEEPVEVTFKYENGL
FT                   ADFVAHLNATKEPIHKTIVALEAKGKGIEAEVAMQWNAGYNESVYTFANTINTHEGGTH
FT                   EEGFRAALTSAVNVYAKEQNLLKPVKAGAKSPDERLSGDDIREGLTAIISVKLSEPQFE
FT                   GQTKTKLGNTEAKKFVQEMCYSALRDWFDANRVEARSIVGKALDAQRARIAARAARDLT
FT                   RRKGLLGGTGLPGKLSDCQYTDPERCELYIVEGDSAGGSAKGGRDSKFQAILPLRGKIL
FT                   NVEKARIDRVLKNTEVQALIQALGTGIHDEFDIAKLRYHKIVLMADADVDGQHIRTLLL
FT                   TLLFRFMRPLVEAGHVFLAQPPLYKIKWGREDWEYAYSDRERDGLLERGVEAGRKLPKD
FT                   AIQRFKGLGEMNATELWDTTMDPDRRILLQVTLDDAAVADELFSVLMGEDVDARRSFIQ
FT                   RNAKDVRFLDI"
FT   gene            8100..10592
FT                   /locus_tag="FraEuI1c_0006"
FT   CDS_pept        8100..10592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: fal:FRAAL0009 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78094"
FT                   /db_xref="GOA:E3J256"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E3J256"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADP78094.1"
FT                   /translation="MVDVLPPPGDRIEPIGIEVEMQRSYLDYAMSVIVGRALPEVRDGL
FT                   KPVHRRVLYAMYDGGYRPDRGYFKCSRIVGDVMGNYHPHGDTSIYDTVVRLAQPWSLRY
FT                   PLVDGNGNFGSPGNDPPAAMRYTEARMAALAMEMLRDIDSDTVDFAPNYDGRSQEPLVL
FT                   PSRFPNLLVNGAGGIAVGMATNIPPHNLREVAAGVQWALNNPDATDEELLEALLGIIKG
FT                   PDFPTHGMIVGRQGIEDAYRTGRGSIRMRAVVNVEENKGRTQLVVTELPYQVNPDNLAE
FT                   KIAELVRDNRISGISDVRDETSARIGQRLVIDLKRDAVAKVVLNNLYKHTQLQDTFGAN
FT                   MLAIVDGVPRTLRLDQMIRYYVEHQVDVIVRRTRYQLRKAQERLHVLEGLLIALDHLDD
FT                   VIALIRNAESADAARGQLMTRYSLSEIQATAILDMQLRRLAALERQRIIDEAAELRAKV
FT                   TELEAILASPQRQREIIGEELKEVVDKFGDERRTRIVPFEGEMSIEDLIAQEDVVVTVT
FT                   RGGYAKRTKTDLYRSQKRGGKGVQGAALREDDIVEHFFVTTTHHYLLFFTNKGRVYRAK
FT                   AHELPEQARSAKGQHVANILAFGQDERIAEVMAIRDYAAAPYLVLATKRGLCKKSALTD
FT                   FDSNRAGGLVAINLREDDEVIGARLVGADDDLLLVSRNAQSIRFHADDEQLRPMGRATA
FT                   GVIGMRFDADDELLSIEVIKPDSTASLLVATSGGFAKRTHLNEYPLQGRGGKGVLTARI
FT                   VPSRGNLVGALVVEPDDQLYAIASNGGVLRTVARDVRQAQRQTMGVKLIDLETGVQVVG
FT                   VARNADADDGDGDEPTAG"
FT   gene            10645..11925
FT                   /locus_tag="FraEuI1c_0007"
FT   CDS_pept        10645..11925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78095"
FT                   /db_xref="GOA:E3J257"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:E3J257"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0011"
FT                   /protein_id="ADP78095.1"
FT                   /translation="MSEKDERPGRSGGLPTAAADSESAAGNPFFEKVGGAKKDAPAAGA
FT                   SADAAGARTATKEPVEDDDDKTAAVRPLSSPAPAPAPAPAAPAPKASAGSKGAGSNRAG
FT                   AATTKVATPAVSSPPASVSDRYAAAGRGAPAKTAAADQLAQAPRDPDTMAIVRTPARPS
FT                   GSDNGRDSGARDNGARDSGARDDRGRPGAADRGAEARTVAAVGAASVAADPDRTVVDPA
FT                   VKPNLAKSGRGPAVPAERMPTPAPGARTAAPAPGDRGREQREWARPGRGASEPAAGYSG
FT                   RHDADRPESARAGDYPADYGDSDGSRTGRRARLRLTRVSPLTVTRLAFAFSLCLFLVIM
FT                   VAVAVLWFVLNSVGVFNSITDAAGTLTSGESHSVSSWLSFGRAMQISLLVGAINVVLLT
FT                   LLATLGAMLYNLCADMIGGIEVTLSDR"
FT   gene            12025..12101
FT                   /locus_tag="FraEuI1c_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            12025..12101
FT                   /locus_tag="FraEuI1c_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12613..13872
FT                   /locus_tag="FraEuI1c_0008"
FT   CDS_pept        12613..13872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0008"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fal:FRAAL0025 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78096"
FT                   /db_xref="GOA:E3J258"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3J258"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP78096.1"
FT                   /translation="MRIALLSYRSLPTCGGQGVYVRQLSKELIGLGHEVTVVSGPPYPV
FT                   LDDGVELRELPSLDLWSEPNPFRWPAPRELTNVASMAEFVMMRSGQFSEPLAFSLRAHK
FT                   ALRPRKGTPPPFDIVHDNQTLGYGMLSLRRALAPHKIPLVATLHHPITVDRRLHLEATT
FT                   GRRARFGVRRWYSFLPMQARVARGLDGIVIPSESSRTDIISDMGLADGQMHTVPLGTDH
FT                   EVFSPDPSIAKVPGRIVVVTSADVPLKGLMVLLEALAKLRVERENAHVVCVGKARPGGA
FT                   AARQVIELGLTDAVTFRSNLEQSDLVDLLRSAEVAVVPSLYEGFSLPAVEEMSVGLPLV
FT                   ATTAGALPEVTGPDGEAALTVPPGDSGAMAVAINRLLGDPELRARLGAGGRSRVEAKFS
FT                   WRAATAATARWYAERIDAVR"
FT   gene            13876..14673
FT                   /locus_tag="FraEuI1c_0009"
FT   CDS_pept        13876..14673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0009"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: fal:FRAAL0024
FT                   putative 3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78097"
FT                   /db_xref="GOA:E3J259"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J259"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78097.1"
FT                   /translation="MLTVDFDRFPVGPGDRVLDLGCGGGRHAFEAYRRGADVVGLDYSF
FT                   DDVAGVARMFGAMALEGQVPASGRAGGVRGDAFGLPFADGTFDRVIASEILEHLPADEK
FT                   AMAELVRVLRPGGLAAVTVPAWLPERLCWALSSGYHTVEGGHVRIYRRDELLGRLTAAG
FT                   LEYLGGHSAHALHAPYWWLRCLVGVHDDNHPATKLYHRMLVWDMMKRPRTTRWTEQLLN
FT                   PVLGKSVVFYLRKPLDVRQPTVAVPGPATAQREAFAETGHGVD"
FT   gene            14660..15937
FT                   /locus_tag="FraEuI1c_0010"
FT   CDS_pept        14660..15937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78098"
FT                   /db_xref="GOA:E3J260"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J260"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0023"
FT                   /protein_id="ADP78098.1"
FT                   /translation="MASTDAFAAQPSAAPHEATVRPTVPTRRGVLAPDRLADLHPLARP
FT                   PETSPLLTAAEVRATADSIAAMQDPDGAIPWFPGGHTDAWDHLECAMALELGGRDDAAQ
FT                   RAWDWLLRNQRDDGSWATSYIGGGVRENFADSNQCAYVATAVWHHWRRTGDAAFVAGMW
FT                   PVVRAALDFVIDMQAPSGVIWWARDAEGKDYPLAMLTGCSSTLHSLRCGLGLAALVGDA
FT                   RPDWELAAGRLAHALRAHPEYFAPTSRWSMDWYYPVIGGALRGAEGLERLRGRWAEFVI
FT                   EGLGIRCVSDEPWVTGAETCELAIALHLVGETAAARTLVRDMQHLRHHDGAYWTGWQFV
FT                   GGAHWPDERSTWTAAAVILAVDTLSGGVTEAVFRGDGLPEPLPTLAPDGEELDDVEALD
FT                   RLGCDCDPAPVIGAWSNDELAGRLAS"
FT   gene            15961..16578
FT                   /locus_tag="FraEuI1c_0011"
FT   CDS_pept        15961..16578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78099"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J261"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0022"
FT                   /protein_id="ADP78099.1"
FT                   /translation="MDETLRRAALAAKGFMPDDEGDALYAAAAEVPAGGLILEVGTYCG
FT                   KSTLYLAAAARAAGARVVTVDHHRGSEENQAGWEHHDPTVVDPHTGRMDTLPFLRRNLW
FT                   DAGVEDVVTVVVGRTEEVGGWWTTPVALLFIDGGHAEEQAQADYAAWARHVAPGGALLI
FT                   HDVFPDPADGGQAPYHLYLRALAEGFKERSRTGSLRVLERVE"
FT   gene            complement(16799..18517)
FT                   /locus_tag="FraEuI1c_0012"
FT   CDS_pept        complement(16799..18517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0012"
FT                   /product="Pyrrolo-quinoline quinone beta-propeller repeat
FT                   protein"
FT                   /note="SMART: Pyrrolo-quinoline quinone beta-propeller
FT                   repeat; KEGG: fal:FRAAL0397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78100"
FT                   /db_xref="GOA:E3J262"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E3J262"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADP78100.1"
FT                   /translation="MDAEFSATAAAPGADQPWAAPTADLPAGLGQAEAAQRVQAALGSP
FT                   TTQAAQGSPTTEAPPTTPATQAILASPPAQATPTAEAAHPTPATRTTRGANPPNLPNSA
FT                   GRSGRRPWLALTVTAGLVVQLALIGTGIGVAVVATRDRGPETVGQAWSSDLVALGKPVA
FT                   ARGSVLVFSSTDENLVDRIAALDPATGRARWTAPASISRIEGDLGQFTPLVVDNGATVV
FT                   WLTPAGADDTVSVVAADAATGERRWSYGEDLSVASSPRVCENGSAICLVAAADDDAGPL
FT                   SKVVLDARSGRVRLEAPLRIGSDTREVGDDLVLSGNDETLAAVADDGTMIWQEPATKVF
FT                   GATADGVVFIGMDSVRRGDVYVGSPVNGLLADSLAPVAQTDLNALVGIRATTGERVWTR
FT                   PGATLGCPRIAFDPAHPVRCVFRGTVTSGLNADYENFGVTLEGFDLETGETTWSWDARD
FT                   AWVFTDAFGAGLAARGQSGDFVLRAGATRYVLRVRGETTVLDLGRGPVSAETPATGWCT
FT                   TWSSRWSGVEWPYACDTAGRDALPSAPVEFGGVRVGDNYVWLDRDGRPRGGPITS"
FT   gene            19371..19547
FT                   /locus_tag="FraEuI1c_0013"
FT   CDS_pept        19371..19547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_4501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78101"
FT                   /db_xref="UniProtKB/TrEMBL:E3J263"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_4501"
FT                   /protein_id="ADP78101.1"
FT                   /translation="MLAKPVKPGTPAPASGQYRPKGGGAEVTVPKGHRLPPTPRPGQVW
FT                   KIVDRTKNASGRG"
FT   gene            19811..20680
FT                   /locus_tag="FraEuI1c_0014"
FT   CDS_pept        19811..20680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0014"
FT                   /product="nucleotide-binding protein"
FT                   /note="manually curated; KEGG: sde:Sde_0715
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78102"
FT                   /db_xref="InterPro:IPR019302"
FT                   /db_xref="UniProtKB/TrEMBL:E3J264"
FT                   /inference="similar to AA sequence:KEGG:Sde_0715"
FT                   /protein_id="ADP78102.1"
FT                   /translation="MAIELKISRDRLDEQLQISIAKGYDIGKLPQGSAAERQLLLQSFR
FT                   SWDEFNGRLLEQAFVPVSWRERSPRSQYADLGDITFLSVNVLGPDQAPTLIDLISEKVR
FT                   KLESLRASLDLFDEGVGVVAASAVGGPSVSAPAAVVPRAIFLVHGRDNAARLQVQRVLE
FT                   KATPLEVIVLADQPNSGQTIIEKLEGHFENSAFAVILMTADDEGRLKGSADLQSRARQN
FT                   VILELGYAAAKLGRRNVAILFEDGVEMPSDFHGVGRTLFDSGNGWILEILAEMKVAGIE
FT                   ADLNKLMP"
FT   gene            complement(21125..21799)
FT                   /locus_tag="FraEuI1c_0015"
FT   CDS_pept        complement(21125..21799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0015"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /note="PFAM: Phenazine biosynthesis PhzC/PhzF protein;
FT                   KEGG: cai:Caci_7069 phenazine biosynthesis PhzC/PhzF
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78103"
FT                   /db_xref="GOA:E3J265"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:E3J265"
FT                   /inference="protein motif:PFAM:PF02567"
FT                   /protein_id="ADP78103.1"
FT                   /translation="MVTAHVVRVFSDEHGHGGNPLGVIEDPGNLGPDERQAIAKTLGYS
FT                   ETIFLDDVEKAEISIHNLSRQIPFAGHAAVGAAWTIARLTGHHPSVLRTTGREAESWAD
FT                   SAGVWVRAPLSMTPPWWAERLDDPREVDDLDGPLSPTQDFTQLWAWIDEPAGIARMRTY
FT                   AARVGIPEDEACGTGAMRLAAALGRRMTIHHGEGSVIYAAPGPAGYADIGGHVTEDPPR
FT                   QL"
FT   gene            complement(21935..23302)
FT                   /locus_tag="FraEuI1c_0016"
FT   CDS_pept        complement(21935..23302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0016"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   scb:SCAB_21521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78104"
FT                   /db_xref="GOA:E3J266"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3J266"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADP78104.1"
FT                   /translation="MTPRSPRPVTPPDFWQRPEVTEALARRDIGALLKIYQRWTGATQT
FT                   QIATLCEVPQSHISHILRGKRQVTSLDMYERFANGLDIPRALLGLAEPASPIAAQAPPV
FT                   VLDEPAKPDRRIVLAGAAGAMAVASADVDLGTAAASHALAFLDRYGMARLDPLTVEQFA
FT                   DDTRRLAIDYMSAAPEAILSQAVPLRARVFAAIDRPNRPDQLRDLHLIAGQLSGILAYA
FT                   TMDVGRTNVAMTNARAALLCADLAGHRDLAVWARGTQSLIARLDGRYTEAARYISAGME
FT                   LRPTGTAFARLVCGQAQCHANLGNLAGTHKALDAAKHATDQAQPDEFAVGLFGFPRTKV
FT                   HFYGTSALIWFPDRDSARISDREATTAIEMFETGPAEERYVGDELLGHIYQATSRLHLG
FT                   DVEAARESLRPVLTIPEPQRVEWHRRSLGRMSTLLATGPYRGISLAADLREEITAF"
FT   gene            23500..24006
FT                   /locus_tag="FraEuI1c_0017"
FT   CDS_pept        23500..24006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78105"
FT                   /db_xref="InterPro:IPR023817"
FT                   /db_xref="UniProtKB/TrEMBL:E3J267"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6511"
FT                   /protein_id="ADP78105.1"
FT                   /translation="MTRDLVKGLAEVAENGEHGTAAGGAVPERRDSSPGVVATPWDGDD
FT                   WALVVGSGSDLAELYDGIAGLPTGLAFVEAFGDVDLVLVYRPAGTASTSAGPLDALVDQ
FT                   AVRHGGTLVGSGGPNGLSTGEQYRTSAERAAFAAGQADALGRMRRALTGEADARPNGHG
FT                   VPIAS"
FT   gene            complement(24094..24483)
FT                   /locus_tag="FraEuI1c_0018"
FT   CDS_pept        complement(24094..24483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0018"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: fal:FRAAL5447 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78106"
FT                   /db_xref="GOA:E3J268"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J268"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5447"
FT                   /protein_id="ADP78106.1"
FT                   /translation="MGMTNDVPISPHTARGPVEGEDWEAVARTLNRRMATCRIGQQALA
FT                   DAARVSASTVRALQRGSTDRRVQNSTLTAISRALGWRDDHLLRVLLAEPPEADPKTSDY
FT                   VKMIFDSTLRIERHLREISKHFTEP"
FT   gene            24654..25067
FT                   /locus_tag="FraEuI1c_0019"
FT   CDS_pept        24654..25067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78107"
FT                   /db_xref="UniProtKB/TrEMBL:E3J269"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5448"
FT                   /protein_id="ADP78107.1"
FT                   /translation="MAIPRRIPIAFADAFPNGAYVLGVEQSNDFEKSRPGSPPVQERDR
FT                   DSNLPMWVVRIMDADPTARTAELKVKIAAETAPVMPDPIPGTPFRPVELVDVLVIPWVD
FT                   SNGSRPKQMFALRASGLRPAPPAAGRRNSGAAA"
FT   gene            25064..25411
FT                   /locus_tag="FraEuI1c_0020"
FT   CDS_pept        25064..25411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_0352 adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78108"
FT                   /db_xref="UniProtKB/TrEMBL:E3J270"
FT                   /inference="similar to AA sequence:KEGG:Arad_0352"
FT                   /protein_id="ADP78108.1"
FT                   /translation="MSGRAVKSRTRLSSHLSVCGGASVHLNVYPERSPILTLTTGDVSV
FT                   TIAMSTTDLDGTAMQFVRELADAAARFAEDCARFALNADPDAGPAAGPVNPPTGLASPP
FT                   SVGRSRGSRAA"
FT   gene            25545..27242
FT                   /locus_tag="FraEuI1c_0021"
FT   CDS_pept        25545..27242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0021"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="KEGG: fal:FRAAL5450 plasmid transfer protein; PFAM:
FT                   cell divisionFtsK/SpoIIIE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78109"
FT                   /db_xref="GOA:E3J271"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J271"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADP78109.1"
FT                   /translation="MRRINGDRRFPSLPARHDKIRIPLWWVVVGMLGRLAGRCLLVVLR
FT                   HPVAVGALVILTAFYRQTGLLGLGALAAFVVLVSGAWRLAHRASFDRAAWWTWGRLRLV
FT                   AVYRRKWRPATLHCGLAIQIPASNAETVSFDEYFPRIRGFRASVAVESLRVELLPGQTP
FT                   EQWAEQAEALRHVYRARACRVRCDQVGFIWLDFYRRDPLDRPVPPADVDGPDGPDGLDH
FT                   LPIGRREDGGPWLLPLRGSHVLVAGATGSGKGSVLWSLIRALGPAVAAGLVELWVCDPK
FT                   GGMEMAAGARLFARFAYDLPSIADLLDDAVARMQSRADGLRGVARLHTPTVGDPLIVVL
FT                   VDEIAALTAYVTDRDLKRRLSASLGLLLSQGRAPGVVVVAAVQDPRKETLPFRDLFPVR
FT                   VALRLVEAEQVDLVLGAGAHDKGARCQDIPPNLQGTGYVAEDGGGDPVRVRASWPDDAE
FT                   IRRTIDRYSAPAAGALAVLRPVPPRLELPGPTIAPEIADILRARGMGHLLGLDGPARRR
FT                   RVAWPWRKAEVPRSRPGWPAAGWVPDTDRPVDGWVPDLAEYGDPWAEK"
FT   gene            27329..28996
FT                   /locus_tag="FraEuI1c_0022"
FT   CDS_pept        27329..28996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0022"
FT                   /product="replication initiator protein"
FT                   /note="KEGG: fal:FRAAL5451 replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78110"
FT                   /db_xref="UniProtKB/TrEMBL:E3J272"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5451"
FT                   /protein_id="ADP78110.1"
FT                   /translation="MRMPLARQVVEAVAVEEGVCVRPVALRRVDLDTGETTIIPAPCGA
FT                   TLASKCPPCAERARRLRMAQCKSGWHLDDEPLPPPDPPDDEAKQLGRLRADLEAIRTEA
FT                   EKTGDTAGVADADEMIGQVDEHLADLGVRGKAAPDDRERPRRTRSTRRRQDAPDLPRLP
FT                   VVKRTIGRTYNAPDGTTWRPSMFLTLTCDTYGRVFPDGTPVDPDTYDYRRAARDAIHFP
FT                   KLVDRFWQNLRRAVGWEVQYFAALEPQRRLAPHLHAAFRGTVPRVVLRQVAAATYHQVW
FT                   WPPTDRPIYPAAGPDLPVWDEQTGGYLDPATGAELVSWDQALDAIGPDDEPAHVVRFGP
FT                   QIRADGVTSNSDTAGKLIGYLTKYLTKSLDGCHAIATDRQRAHVDRLAATLRHEPCSPS
FT                   CANWLLHGIAPKNARPGLVPGRCKGKAHRRETLGFGGRRVLVSRKWSGKTLGDHKADRV
FT                   DFVREQLQALGKHADPNSPAARATDETRAAPRVAWELVRPGDPDAPRREHLILHAVAER
FT                   QRWRTQLADPTATGPPLDSPADRDKSSDPLPAPTEEGP"
FT   gene            28993..29184
FT                   /locus_tag="FraEuI1c_0023"
FT   CDS_pept        28993..29184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0023"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: fal:FRAAL5452 excisionase (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78111"
FT                   /db_xref="GOA:E3J273"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E3J273"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADP78111.1"
FT                   /translation="MTKLLLTPAEAADQLGIGRSTVYELMAAGELESLCIGRARRIPYD
FT                   ALAAYIDRLRGQQNGTAA"
FT   gene            complement(29259..29618)
FT                   /locus_tag="FraEuI1c_0024"
FT   CDS_pept        complement(29259..29618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78112"
FT                   /db_xref="UniProtKB/TrEMBL:E3J274"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5453"
FT                   /protein_id="ADP78112.1"
FT                   /translation="MPTIKLMGAAEIAQLLDVSPSRVHQILRDDSAFPEPVAVLSMGKV
FT                   WSAEDVERWNAARKAPRPARDQAERWTLDDLQQALERYEQLLVSGGKSSTTVQTSVDRP
FT                   RRFLRWLAGDYDPLA"
FT   gene            29741..30049
FT                   /locus_tag="FraEuI1c_0025"
FT   CDS_pept        29741..30049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78113"
FT                   /db_xref="InterPro:IPR023817"
FT                   /db_xref="UniProtKB/TrEMBL:E3J275"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1736"
FT                   /protein_id="ADP78113.1"
FT                   /translation="MHIFSSGDPELWRTPETGPALVLVTLLPTGECEVTIHPGADVEDV
FT                   TAALAVVPAGAVFVEHFNDVEAVLLFRRNPAGPPAPEIVPWVPVSPLVPTAAGVSRP"
FT   gene            30304..30567
FT                   /locus_tag="FraEuI1c_0026"
FT   CDS_pept        30304..30567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbp:Sbal223_3729 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78114"
FT                   /db_xref="UniProtKB/TrEMBL:E3J276"
FT                   /inference="similar to AA sequence:KEGG:Sbal223_3729"
FT                   /protein_id="ADP78114.1"
FT                   /translation="MPENTPDPSASDSADYHPTPVELDRALAEMARVSLQGHYAYACGA
FT                   LRFVAEELVTGRADEHTIAAARYALALAEVARGASDHLPEVA"
FT   gene            30567..31760
FT                   /locus_tag="FraEuI1c_0027"
FT   CDS_pept        30567..31760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0027"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sti:Sthe_2831
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78115"
FT                   /db_xref="GOA:E3J277"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E3J277"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP78115.1"
FT                   /translation="MAEQKNEPDGAASAEEKKSRRAHGEGGLYQRASDNRWVGVVDLGW
FT                   IDGKRRRRTVYGRTQKEARGKMNALREAAGKGQDLAAKPQTVAEWLSYWLDEIKGHDGT
FT                   RPSTLSRYRYAIDGHIVPVLGKIRLDKLSPADVRRLHAARRDSMKPASLAKIHAVLRVA
FT                   LADAERMDLVSRNVAKSVQPPKLGDSDPRDLAVEDARRFLEVAAGDRLEALFVVALTMG
FT                   LRRGELLGLRWDDVDLDAATLRVVRSAQRVSGTLRLVDTKTRGSRRPVPIPAMTLEALK
FT                   RHRKRQDQERADAGKAWKENGLVFASTVGTLIEPRNVTRRVQQLRGRVNLPTLRLHDFR
FT                   HACASFLLAAGIEPRTVMEILGHATMRMTMERYGHALPERLRAASDAMDKLMGQRLP"
FT   gene            complement(32321..32396)
FT                   /locus_tag="FraEuI1c_R0002"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(32321..32396)
FT                   /locus_tag="FraEuI1c_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(32653..34095)
FT                   /locus_tag="FraEuI1c_0028"
FT   CDS_pept        complement(32653..34095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_3011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78116"
FT                   /db_xref="GOA:E3J278"
FT                   /db_xref="UniProtKB/TrEMBL:E3J278"
FT                   /inference="similar to AA sequence:KEGG:Mjls_3011"
FT                   /protein_id="ADP78116.1"
FT                   /translation="MSEIAAGDWEDTPDAASGLARPYVAVDPDETLRPGPAEGAEEVSQ
FT                   PAVPPAAPDGTLDNSHRGTHHIATTTPTDSPIPDNTVTPTVGPASASEPAAPPQAPSVD
FT                   VTKPAPAALSLTKAGKPAVAEPEASPGVVSGAAVADPGPAGSGPADVAVAEPPVPAATG
FT                   GDGDGDGEQTLAAGDLEAPASGDETIRSADTPVGTPEAPVAASDSAQPGLDANDLDSGG
FT                   DPEAAGEDDPEATVVGLAPGALPDPSPRLPIDDSAEINEIDRAAAIGAADGGSASRRPG
FT                   PRPQRDARKWIHVVRHGYVLRSRSGMTIAAAIVLIVLTLFGLTGLLLSNSNSPAGSGKA
FT                   IVFVDTEAPTIDFGSFPAVIEPPTTAPPPTQAGLNAVQAQSVGRADARPRGSSANAPAS
FT                   HQPQPTPPAAAAPTAPTSQAAPNSPGARLQQLQVRLLDELPRHRDAAQAHGRLLAPSSP
FT                   LLAGPTAKRHPTWADRSRPGQT"
FT   gene            complement(34266..34769)
FT                   /locus_tag="FraEuI1c_0029"
FT   CDS_pept        complement(34266..34769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvi:Dvir_GJ22796 GJ22796 gene product from
FT                   transcript GJ22796-RA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78117"
FT                   /db_xref="GOA:E3J279"
FT                   /db_xref="UniProtKB/TrEMBL:E3J279"
FT                   /inference="similar to AA sequence:KEGG:Dvir_GJ22796"
FT                   /protein_id="ADP78117.1"
FT                   /translation="MPIRMPLSHDRLPEDVTDRFTWRHRVDAPASRPAGRFPLAALAGF
FT                   ALTGVIIVVAVILFARNPALDTTQTVASGKPQTSLATPASIVAAQEATPAPTPAAASAS
FT                   LATTSAALATRQSAAPTTRRLFGGPKPTATTGAGRDDAVAAATTCRNSPIAQYLLRHGL
FT                   PLPC"
FT   gene            complement(34840..35946)
FT                   /locus_tag="FraEuI1c_0030"
FT   CDS_pept        complement(34840..35946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0030"
FT                   /product="ParA family protein"
FT                   /note="KEGG: fal:FRAAL6830 ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78118"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J280"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6830"
FT                   /protein_id="ADP78118.1"
FT                   /translation="MALFNNKGGVGKTTLTFHLAHMLARQGHRVLAVDLDPQANLTAQF
FT                   LDEDDLATLWREQIVGASTSGRGSTASSAPRHDILGGRRSRIVEGTGTIATAIAPIMEG
FT                   VGDVSLFEPVSVDDNLWLLPGDVDLSVFEDKLSAAWPNSFLGKDVAALRTTTALHRVVD
FT                   HSGKAVRAEIVLIDVGPNLGAINRAALLSADTVLMPLGADLFSLRGLRNLGPTLRDWRS
FT                   TWQGMVLPKVPDRIAAPRALMMPIGYVIMQPASGRDRPARAFDRWLDRIPEVYATSVLG
FT                   TQRADPYDKSFEIASLPFYQTLMPLAQDARKPMFELRSGDGALGSAQTYVRKCYQEFRD
FT                   LAVNVRERLRYLDPTLPRLPVSAAGTRQ"
FT   gene            complement(36443..37285)
FT                   /locus_tag="FraEuI1c_0031"
FT   CDS_pept        complement(36443..37285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0031"
FT                   /product="mycothiol-dependent maleylpyruvate isomerase"
FT                   /note="KEGG: fal:FRAAL6831 mycothiol-dependent
FT                   maleylpyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78119"
FT                   /db_xref="GOA:E3J281"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3J281"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6831"
FT                   /protein_id="ADP78119.1"
FT                   /translation="MATETRAGVRESGLPPSARATHTTPAGAGYLPSPVPHDLLAGVSA
FT                   SHRRLLALAAALDDATVARPSLLPGWTVGHLLRHLTVGARGHTSLVQAACAGAAPIALN
FT                   SSDPAADDPTAHPGTDSAERLRDDLAAAIAGLERAWDATHVEVWRTGLGMCRLEPAAGS
FT                   RLDGPVTLADLVFLRWREVEIHGVDLGLADRGGPGWADLPAPYVDAEWDWTTARLPERL
FT                   PPGVSVVLAPGDRSSRAFGAGPRPAVVRTSTAETLRWLLGRLPRPAAPSGWPDLCSWE"
FT   gene            38326..39561
FT                   /locus_tag="FraEuI1c_0032"
FT   CDS_pept        38326..39561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0032"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; KEGG:
FT                   fal:FRAAL6832 polyamine ABC-transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78120"
FT                   /db_xref="GOA:E3J282"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J282"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADP78120.1"
FT                   /translation="MRVLAVTADGVSTSVPAVSTPTVPTGGTGAAAPAIELIGVAKDYA
FT                   SRRGAVTAVETVDLQIAEGEFFSLLGPSGCGKTTTLRMIGGFEEPSRGQILLHGSDVTA
FT                   TPPNRRDVNLVFQSYALFPHLDVAGNVAFGLKRKGIRGQAMRDRVTNMLELVELGALAD
FT                   RKPKELSGGQQQRVALARALVNEPRALLLDEPLGALDLKLRETMQIELKRIQREVGITF
FT                   VYVTHDQSEALTMSDRIAVMNKGRIEQLAAPRDLYERPRTRFVAGFIGTSNVLRRTVKT
FT                   VTTDGTGPVAILDAGIDEQLMVPLHDDLGSVTTGSVVELTVRPEKIGMTVERPDGDVCL
FT                   LRGRVTEVVYLGTNTTYTVFTPGGDEITVFWQNSSDSADIARRGDEVWLSWREDHSFAL
FT                   APGAGSSTPAAA"
FT   gene            39683..40927
FT                   /locus_tag="FraEuI1c_0033"
FT   CDS_pept        39683..40927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0033"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   Twin-arginine translocation pathway, signal sequence,
FT                   subgroup; KEGG: fal:FRAAL6833 ABC-transporter
FT                   polyamine-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78121"
FT                   /db_xref="GOA:E3J283"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:E3J283"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADP78121.1"
FT                   /translation="MTTHDSTDRPGAQSPPPAVDPALLRGLTQPRLGRRQFLQAGGAAG
FT                   LAAFLAACGVKGEKKAPATADDVATFWSDKKKAGTLDFANWPLYMDTDDAGKHPSLVQF
FT                   EKDTGIHVNYRESIQDNGEYFAKVQPQLAAHQSISADLIVITNGVYLDKFIELGFLAPL
FT                   DQTKLPTFAKNADPSVKNPSYDKGNKYTVAWQSGLVGIGYDPEKTGREITSYEDLFDPA
FT                   FKGHVGMFGDNEDLPNFCMVGMGIKPETSTEADWKNAAAKLTKQRDDGIVRKYYDQGYI
FT                   DALASGDLWLSMAWSGDVYQQQAGGKNLKFVVPKEGGLFWTDNMCIPITAAHPVDAITY
FT                   MDYVYKPDVAAMLTDYINYITPVPGAKSLVDPALSGSPLIFPTADDLKKTYRYRDLTAA
FT                   EEKTWNSIFQPIVQS"
FT   gene            40938..41861
FT                   /locus_tag="FraEuI1c_0034"
FT   CDS_pept        40938..41861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0034"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6834 putrescine
FT                   ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78122"
FT                   /db_xref="GOA:E3J284"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J284"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78122.1"
FT                   /translation="MTETVAAAPETGAAGGHGKKPKHWRSPWTPYLLSTPGGLYLAIFF
FT                   VVPMLVMLSVSLQTGNVTDGFAQTFNFGIYPHAISEYSTQLIRSFIYGGACTLLSIVLA
FT                   YPMAYWIAFHGGKRRATYLFLVLLPFLVSFIIRTVSWEFLLADDGVILGNLKHIGLLPD
FT                   GFRVMATSAAVIGGLTYNSFPFMLLPIYVALERMDPRLLEAAGDLYANKAGVFGRVVLP
FT                   LSMPGVFAGVLLTFVPATSDYVNASILGGTHNTMIGNIIQTAFLTNADYPLASALSFIL
FT                   MVILLVGILIYARVLGTRDVFEMATR"
FT   gene            41858..42733
FT                   /locus_tag="FraEuI1c_0035"
FT   CDS_pept        41858..42733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0035"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6835 polyamine ABC
FT                   transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78123"
FT                   /db_xref="GOA:E3J285"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J285"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78123.1"
FT                   /translation="MSAPTVATTAPAPAARRRPRVRWGAHLMHAYTWLILLWLVAPIIF
FT                   MIVFSFNDTHSRQNTHWQGFTFKWWGRLGAYPDLTSSLVNSLTIGVLSTLIATAFGTMI
FT                   GMAIGKHSFRGQGGVNLLLFANIAAPEVVLGSSLLSLFITMNIPRGYLTILIAHVMFNL
FT                   AYVAVVVSTRLASFDMSLEEAARDLGAGPWATFRLVTLPIILPGILSGAMLAFSLSIDE
FT                   YIITAFNAGGTLTFPLWVMGATKNGVPPQVNVMATIIFVGGIVLAVGGFVVGRGAKARA
FT                   PEEDLGVVSA"
FT   gene            complement(42802..42933)
FT                   /locus_tag="FraEuI1c_0036"
FT   CDS_pept        complement(42802..42933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78124"
FT                   /db_xref="UniProtKB/TrEMBL:E3J286"
FT                   /inference="similar to AA sequence:KEGG:Sare_0018"
FT                   /protein_id="ADP78124.1"
FT                   /translation="MMRRLALIAAVASAAALAARWRKDKSGQVDLWHEATSADQGGN"
FT   sig_peptide     complement(42877..42933)
FT                   /locus_tag="FraEuI1c_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 19"
FT   gene            complement(43066..43608)
FT                   /locus_tag="FraEuI1c_0037"
FT   CDS_pept        complement(43066..43608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0037"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: fal:FRAAL0033 Raf
FT                   kinase inhibitor homologous protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78125"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:E3J287"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADP78125.1"
FT                   /translation="MSLADRAPAPDPIDLLPPAPTFAVTSTDFADGAPLPLAHAHGSAG
FT                   GGDLSPQLSWSGFPSETQSFVVTCFDPDAPTGSGFWHWVLVDIPASVTELATGAASGDL
FT                   SGLPAGAYHVACDWGAKSYGGAAPPAGDRPHRYVFVVHAVDVPKLEINDAVAPAVVGFN
FT                   LAFHTLARAVIRGTYQR"
FT   gene            43722..44060
FT                   /locus_tag="FraEuI1c_0038"
FT   CDS_pept        43722..44060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0038"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   fal:FRAAL0032 regulatory protein (P-II) for nitrogen
FT                   assimilation by glutamine synthetase (ATase)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78126"
FT                   /db_xref="GOA:E3J288"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E3J288"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADP78126.1"
FT                   /translation="MKLVTAILRPHRVADVRAALTTFGIHGMTISQASGYGMEVWRTSS
FT                   YRGRRFHDESVSNVRMEVVVDDADAEDIVNVILSSAASTASGAGKIWITPVVSLTRVRT
FT                   GERGMDAI"
FT   gene            44094..45620
FT                   /locus_tag="FraEuI1c_0039"
FT   CDS_pept        44094..45620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0039"
FT                   /product="secretory lipase"
FT                   /note="KEGG: fal:FRAAL0030 putative exported lipase;
FT                   manually curated; PFAM: secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78127"
FT                   /db_xref="GOA:E3J289"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J289"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ADP78127.1"
FT                   /translation="MFFGVATRPRRTCNVWLVPVDVPLESPRIDGYVTGTPYCPASSPT
FT                   GTSIGAFLLPGDCGSGRSAHRATAGAPGRRWSGAGLRRDPRETSRRQPGEYARSVVRRA
FT                   NLGASGRGRTCRLLACLVAALALAAPLAGCSAGSSAAPGGQMAQSLPPGAPGSLITATP
FT                   VAGAPAGIAAWRVIYHTRDQNGADVAASGLVLSPAPGHGGAVPSGGRRVVAFGHGTTGV
FT                   ADACAPSLAQPPLTAVGNTFSLVQQGYVVAAADYIGLGTPGDHAIYVATPAAQALLDVV
FT                   RAARALPAAHAGSEVIIWGYSQGGQAALAAGVMTDGYAPELKVRGVVAMAPLADLPRSL
FT                   ASLRDENDTGVAYILMAAYGVSVAYPGVNLAADLTTQGKRLLSILQHKCAVDLVTASTG
FT                   LTDAQVFLRDPLTIEPFVSRFAAQRKAVIGAMPPLLLLQGDADNVIRQPITDGVVRDLC
FT                   AAGTAVDYHRYPVAGHSTVFSTSSRDMYTWIANRFRADPAPMHSICGPAL"
FT   gene            complement(45647..46213)
FT                   /locus_tag="FraEuI1c_0040"
FT   CDS_pept        complement(45647..46213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0040"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78128"
FT                   /db_xref="GOA:E3J290"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E3J290"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADP78128.1"
FT                   /translation="MPKLVIIIASTRPGRIGPSIGTWVAEQATAHGAFDVELVDLAEVD
FT                   LPMFNEPRHPRLGDYAHDHTKEWAATVAAADAFVFVMPEYNHSFTAPLKNAIDFLAAEW
FT                   RYKPVGFASYGGIAAGTRAVQAIKPVLTALDLVPVTPAIALAMVGQKIGSDGQLVADAA
FT                   MNAAAKVMLDEIARWTAALAGLRTG"
FT   gene            46454..47548
FT                   /locus_tag="FraEuI1c_0041"
FT   CDS_pept        46454..47548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0041"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: rrs:RoseRS_2512 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78129"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E3J291"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADP78129.1"
FT                   /translation="MTQGGPQARTRPQQAQARTRPQEAQARMWPQEPHARTGPQEVEPR
FT                   SGTVLGLDLGGTSIKWVTLTDGQVTRKGRVPTPHSGVDDVLRALADVAAQVPEARAIGV
FT                   AAAGALDPVAGRLLVVPNIAGEWSTRAVGPELADATGRPVNLANDARAFAYGQLRHGAA
FT                   AGALDAIFVTLGTGIGGAIASDGQLRMGLARRGGEIGHMPIEPVDGRKCGCGSVGCLET
FT                   IAGGRALAEMGADLVRTGAAPALAAAVGGQPEAVEPADVVRLAAVDPACARLVARAGHA
FT                   LGIALAGLTNALAPEVIVVGGGVAAGLPAFRPHLDEVMSRYTVLVETPRIVTAVDGFAG
FT                   AVGAAAWAAEPPSGYPAPIQPSGH"
FT   gene            47857..48576
FT                   /locus_tag="FraEuI1c_0042"
FT   CDS_pept        47857..48576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: alv:Alvin_0519 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78130"
FT                   /db_xref="UniProtKB/TrEMBL:E3J292"
FT                   /inference="similar to AA sequence:KEGG:Alvin_0519"
FT                   /protein_id="ADP78130.1"
FT                   /translation="MVHVWAEAPPTVRWRALRELSESRASLQAMTVHQLLPETTEEGTR
FT                   RGVGAVARALGVTTSWISQLAAMPSKHSGLFSWGRALALATELVALAERAPSTRLSDEL
FT                   AGIVRRGLHDTSPRHDLESATSRWAMAARRQRRGPEADVLVDRIDALLVDVTPSLDLDW
FT                   LARAEIAIGYQTARGPVPRGEDVPRPALAPAGPPRPSATVPTARQAEPEEPPASQPRSR
FT                   RGTNDPLPWSRYRLRDR"
FT   gene            48673..49341
FT                   /locus_tag="FraEuI1c_0043"
FT   CDS_pept        48673..49341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0043"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: pla:Plav_2612 alpha/beta hydrolase fold;
FT                   manually curated; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78131"
FT                   /db_xref="GOA:E3J293"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J293"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78131.1"
FT                   /translation="MADSAPVVLVHGFASSSEHGWGPAGWIEMLREAGREVIAVDLPGH
FT                   GTAARSTDPADYADVAATVAAAFADRGPVDAVGFSAGARTLLEIAARGIASFDRLALMG
FT                   IGPAVLEIREAAPFAIDNDDPTDVRARLFRGLAKSAGNDLGPLAAFARRPVESLTAVEL
FT                   AAITCEVLVVTGERDQAGDPEALAAMLPNATGVLVERADHFSLQSNMRAMAAVLDFLGA
FT                   "
FT   gene            complement(49394..50275)
FT                   /locus_tag="FraEuI1c_0044"
FT   CDS_pept        complement(49394..50275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0044"
FT                   /product="methyltransferase"
FT                   /note="KEGG: fal:FRAAL3616 hypothetical protein; TIGRFAM:
FT                   methyltransferase; PFAM: Leucine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78132"
FT                   /db_xref="GOA:E3J294"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J294"
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /protein_id="ADP78132.1"
FT                   /translation="MRAEGGSRTAVLTCQGRAVADGSSAAGRFADAVAADLLRPDERLV
FT                   VEQVRAGTPPKGVAARMAYESAKACASVMVPRTIAADDAIRDRPGGVASQLVLLGAGLD
FT                   ARAWRMPELAGTDVFEVDHPASQRDKRDRLAGRPSLARSLTFVPVDFSRDKLAEALAAA
FT                   GFQTSEPTTWVWEGVVPYLTPAEVSATTAAAGELSAPGSRLVVLYLTPNARASVGVLVA
FT                   RTMSALARQRSVWADEPRRSAWTPPKLAALLATHGFAVTRDESLLAISERLGLPGTRGA
FT                   SIAHAHLAVADR"
FT   gene            complement(50278..51627)
FT                   /locus_tag="FraEuI1c_0045"
FT   CDS_pept        complement(50278..51627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0045"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; Methyltransferase type
FT                   11; KEGG: cwo:Cwoe_1969 OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78133"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3J295"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADP78133.1"
FT                   /translation="MVAPAETAAVRPTPPTHSYSVTCEWSGSTGVGYDRYSRAHVGHAP
FT                   PAATAVRLSSDPAFRGDPSLLNPEQLVVLAAASCQLLAFLAIAARARVDVRDYQDTGSA
FT                   VMTEDGRGGGAITEITLRPRITVVTDATEERLRRLAQLAHEQCFIAASLNCPVNVSPTF
FT                   EILTPYAFRDTDTAARRLALVSDVFDPGSRAFIHDRVRAAGLSDVRLAVDLGCGPGHTT
FT                   RLLAAATGAARTVGLDASTAFVATAVGTEPVSAQGGGLSADGATELAFLRHDVSRLPFP
FT                   AQARKADVVYARLLLPHLVDVTDAIGGWITQVAPHGLLLLDEVESIDTDQPALAAYLDH
FT                   ARHLLAARGTTLHAGRLVNTALHDLAAHSPGTSFEVEYNATEPVRPPVPAAAEMFGLNL
FT                   AVWRDDPLYRDRQPELDRLAADLAALAAGPEHDGHITWTMRRVAVRRLAG"
FT   gene            51823..52440
FT                   /locus_tag="FraEuI1c_0046"
FT   CDS_pept        51823..52440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0046"
FT                   /product="protein of unknown function DUF308 membrane"
FT                   /note="KEGG: tcu:Tcur_3375 protein of unknown function
FT                   DUF308 membrane"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78134"
FT                   /db_xref="GOA:E3J296"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:E3J296"
FT                   /inference="similar to AA sequence:KEGG:Tcur_3375"
FT                   /protein_id="ADP78134.1"
FT                   /translation="MLRSESTSFLLRGAVAVALGIVAIAWPGVTVSALIVLFAIYVFCD
FT                   AIGHFHRATASDRSGSAAGSIALGVLDIAAGVVALVWPAMTVFVLTIWLGVWAVVTGVV
FT                   EVGAAFTMPARRGVRTGMVLVGLASIVFGIVVFTHPSIGVLSVTLLFGLFLLVYGVDLV
FT                   TTGVRMRRRGATGGDALGGGWTDSTPYPGSARRADQAAPRYR"
FT   sig_peptide     51823..51921
FT                   /locus_tag="FraEuI1c_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.247 at
FT                   residue 33"
FT   gene            complement(52431..53669)
FT                   /locus_tag="FraEuI1c_0047"
FT   CDS_pept        complement(52431..53669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0047"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   afw:Anae109_1815 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78135"
FT                   /db_xref="GOA:E3J297"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J297"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78135.1"
FT                   /translation="MLTPDLDLLCAPDTASALTVVPAPMAPSPELWTLATRLAPAPRRA
FT                   PESVGAGPARAARPDPAQHWLGTATGIRYPVLAGIPLLLSDYAHDAAGPLGATAGIPRR
FT                   ELDHYSAVSLRLAADVADDPTLAELRALATVAERSGTVLDETWVDAPYDGPAQLRCYEF
FT                   LRPLVRGGTAVQIGGSGTHALKFLLAGAARAVIVSPVVGELLLADAFARALGLADRLLP
FT                   VAGTGEGLPLAAGSVDVLYCGGTLHHLDTARAGRQFARVLTAAGRFAAAEPWKVPLLHT
FT                   AGTRLLGKRGPVDCQPIDAARLGALRGGFAGWVDDRRHGAFTRYPALALGKAGLRLPAR
FT                   TLLRVMLREDELDLPGAALGSSISLTGCQAPSPLTAAAGLPHARATATRAADSTETAGD
FT                   LPAVSVSGERGQR"
FT   gene            53976..55667
FT                   /locus_tag="FraEuI1c_0048"
FT   CDS_pept        53976..55667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0048"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   sti:Sthe_2752 capsular exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78136"
FT                   /db_xref="GOA:E3J298"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J298"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADP78136.1"
FT                   /translation="METDSAVGGGRNLAGVLARRWHLLLAVTVAFGAAGVLLSSLQSTL
FT                   YSSTATMLLNDPGSTSVFSQNNRVIVDPSRYVRGQASYLTSTEVLTAATKILHNRLSLD
FT                   ELRSRVTATSSDQLEQVTVTATEPTAAGAAEVANAVCQAYRETVRSSAAQNAKSTTDEL
FT                   DQTISRLRDSISELDGQLASTKDGSADPALSAARQAAATQLLTVQSRADEIAVDTATYG
FT                   DGVQMFEEAKQPSSPTQPKPMVGGVVGAFVGLLLAATVVWWRAEYRRRADEKQEPATVL
FT                   GVPLLGEVPEFVASAGGRALPAAYEPSSPAGEAYNFLVESIDFAVAATARAWPEGGAGG
FT                   RVIAVTSPRQGDGKTVTTLNLAIAMARDDRRVAVVDGDERMRGLTRLAEVPDEPGLSDL
FT                   GADVPVDQVLRSLDLDSTEGLDVIAAGARLEDPASFFRTGRFRGAVGRLRGHADIIIVD
FT                   SPPLLAVSDAAAIAAQADAVVLIVGRGTPLRVLAEVRHRLEFVGTPLLGYVFNKSTGSR
FT                   RRYGHYGYGYGYGQQPARTAALPAGTAGRVPDQRLGSGGRHAEAKR"
FT   gene            55780..57180
FT                   /locus_tag="FraEuI1c_0049"
FT   CDS_pept        55780..57180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0049"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gbm:Gbem_1624 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78137"
FT                   /db_xref="GOA:E3J3D5"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP78137.1"
FT                   /translation="MRVTIVSQYFWPEQFRVNDLAVGLRERGHHVTVLTGQPSYPRRDS
FT                   FPRRRRPSREWYEGVEVVRVRLASRGNGEPWRLALNYLSFAASASVLGVPRLPPSDVVL
FT                   VYQMSPVTTALPAFLLRRIRGAPVVVWVQDLWPRTLRATGTIRSERVLGVIDRVVRAGY
FT                   RRCARVLGQSEDFLPLLRAAGVPAERLDYLPNWAEGQYRPEPPDEEVRRAAGIPDGFVA
FT                   MFAGNLGVAQALETLVGAAELTRDRPELADMHWVVLGDGQRGAWLADEVRRRGLTGRVH
FT                   LLGQAPPQQLPALFAHADVLVTALRRDSVWALTVPSRVQSFLACGRPVVSSADGTTGRV
FT                   VAAAGGIAVPAEDPAALADAVAQVHALGPTERAAMGVAAREYYVTHYERAALLDRVERH
FT                   LRDAAGLSAAPVRVPTPAPAPTRPTAHGGPAVPAQPSVAAGAAGSGGPAKAKPAGPEVP
FT                   AADVTETA"
FT   gene            57180..58106
FT                   /locus_tag="FraEuI1c_0050"
FT   CDS_pept        57180..58106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0050"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   geo:Geob_2135 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78138"
FT                   /db_xref="GOA:E3J3D6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D6"
FT                   /inference="protein motif:PFAM:PF04321"
FT                   /protein_id="ADP78138.1"
FT                   /translation="MRVLVLGGAGMLGHELASALAGRHDVGVTVHGPRPPRRRDRSDPW
FT                   AGALPANRIFAGLDVRCQDDLAGLLADFRPEAVVNAVGLVKQRPEGRTALPAVEINTVF
FT                   PHRLARLCRIAGVRMVHVSSDCVFSGRRGRYTEDDQPDPVDVYGMSKLLGEIREAPVVT
FT                   LRTSIIGLEPAGRGSGLVEWFLAQTGQVSGYRRAIYTGLTTMEFARVVDRLLTKHEDLT
FT                   GLWHVATAEAITKHELLTRLADRLRRAGGSRAVAEVVAAEGPACDRSLLADRFAEATGY
FT                   TAPGWDAMLDELVERITLRDDGGRRDG"
FT   gene            58099..58215
FT                   /locus_tag="FraEuI1c_0051"
FT   CDS_pept        58099..58215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78139"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1143"
FT                   /protein_id="ADP78139.1"
FT                   /translation="MADNGLDGAARVGEEPGGSGMLTGRRAPTTGGHLDLLR"
FT   gene            58225..59550
FT                   /locus_tag="FraEuI1c_0052"
FT   CDS_pept        58225..59550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0052"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   fal:FRAAL2071 UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78140"
FT                   /db_xref="GOA:E3J3D8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D8"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADP78140.1"
FT                   /translation="MQSTYQWPARVAPTRVKVMVIVGTRPEVIKLSRVIAALERHVDVR
FT                   LVHSGQNHAYELGQIFFDELGIRPPDHHLDAVLPGATAADTIGQVIARVDRVLAAERPD
FT                   AVLLYGDTNTCLAVIPAKRRHIPVFHMEAGNRCFDDRVPEEINRRLVDHLSDVNLPLTE
FT                   HARRHLLAEGLPANRVFVTGSPMKEVLTQHWAQIEGSTVLADLGLTVGRFLVVSAHREE
FT                   NVDHPDLLRALLATLTVLADRFDMPVVVSTHPRTRARLDELGADAFAAPGGPSAVADLD
FT                   PRVRFLRPFGLADYVALQRGAHCVISDSGTLTEEAALLGFPAVMIRESHERPEGFDHGV
FT                   LVSSVLRPDRVLAAVAAVTDQPTGQRGGGQTQLGPSGLAAGNSGRGLPPDYDVDDVSTR
FT                   VLRIILSYVDQVNRTVWHRSPAPVAVPAPRAALEPDVALTSG"
FT   gene            59567..60472
FT                   /locus_tag="FraEuI1c_0053"
FT   CDS_pept        59567..60472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0053"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   rci:RRC32 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78141"
FT                   /db_xref="GOA:E3J3D9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D9"
FT                   /inference="protein motif:SMART:SM00331"
FT                   /protein_id="ADP78141.1"
FT                   /translation="MTARSTARRPADSAPKGPAVRVAGDAVRTALLLGPDHPGLGEVAL
FT                   GGLSVEGDGAPTMLGAALSAGWRPKAVPAVEPNEDGALLAVGPAGALLAVADGHNGSAA
FT                   STAALRALAARAPVLLAHRTGDEAELAAAFAAAAHGAVARPPAPGGSEAGAEGEPRPAR
FT                   TALSLVVVTAAAFAAVGYGDTTAAVVRRGRLHLLDEPSEFLGPTSPADPLAGHPVTRRR
FT                   RGPGDLLVVVSDGVTDYLGRAFGAAIEAASRAGADGGQPDAARATARSLIARAGAAGAG
FT                   DNLTAAVLLAARPRRTFGWF"
FT   gene            60627..61433
FT                   /locus_tag="FraEuI1c_0054"
FT   CDS_pept        60627..61433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: krh:KRH_03110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78142"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E0"
FT                   /inference="similar to AA sequence:KEGG:KRH_03110"
FT                   /protein_id="ADP78142.1"
FT                   /translation="MRTDRVWAPPAHWRSCTAVALAAFGLAAAAGCGSPATEAGTATVT
FT                   ASRSDYRPVAPLPARVLPATLSTAAVASDAVATEAAIPVAASDEAAAGAPSDTATAAAA
FT                   ASPSVAQTTDLSPPAAVVAAAPVCPPRGLTGALRHTEGTAGHVYNDLVLRNKGSVACRL
FT                   TGYPDVRFVDADGAVFGAPADDTDDGPATAVLLPAGGTATAMLRITQAGIQRGCTAASQ
FT                   TRLAAALRVTPPDGGAVTLSVPLSGGITACVSSSVRQLLIGPLTST"
FT   sig_peptide     60627..60746
FT                   /locus_tag="FraEuI1c_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.750 at
FT                   residue 40"
FT   gene            61563..62177
FT                   /locus_tag="FraEuI1c_0055"
FT   CDS_pept        61563..62177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78143"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1370"
FT                   /protein_id="ADP78143.1"
FT                   /translation="MVDVGPPSREEPDPTGSEPAGPGIQSAMVALIQDTRGDGSAVVRY
FT                   IQCDNCEGPTPHHAEVQIFSATSRNPTFVASPPEVVCGVCGSVHPRVVGDEPACDTRIT
FT                   CVARRVPRLPLDRLGLDRLRLDRLPLGRLRDRAGLDRLPFGRVLPDAVRQLRWPGACAH
FT                   RFLVPAAAPTVICPRCSSTQAGPPYRLRAPYPDQEPDPRNA"
FT   gene            complement(62364..63506)
FT                   /locus_tag="FraEuI1c_0056"
FT   CDS_pept        complement(62364..63506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0056"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="TIGRFAM: glycerate kinase; KEGG: fal:FRAAL6785
FT                   glycerate kinase I; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78144"
FT                   /db_xref="GOA:E3J3E2"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E2"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ADP78144.1"
FT                   /translation="MADRLKVVIAPDSFKGSLAADRVAAALAEGWLSVRPTDEVVRLPI
FT                   ADGGEGTLDVFAAAVPGARRRPATVTGPRGQLVDAEWLALPDGTAVVELARGSGLPLMG
FT                   DRRDARAAHTVGLGQLLAAALDDPGIRQIIVTLGGSASTDGGTGALAALGARFLDATGA
FT                   ALPPGGGSLVRLAGVDLGGLRKPPPDGVLCLTDVDAPLCGPRGAAAVFGPQKGATEADV
FT                   PALDEGLRRLAALLGGAPDAPGAGAAGGTGYGLAAAWGARLVPGAATVAEHAGLPDALA
FT                   EADLVITGEGRFDATSLTGKVVGGVLGLAAARPGASGPVPVLLVAGQLGAPAPSGVRTA
FT                   LALATLAGGVAPAVAEPEHWLTRAATRLATATTNQLGDRP"
FT   gene            complement(63573..64562)
FT                   /locus_tag="FraEuI1c_0057"
FT   CDS_pept        complement(63573..64562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0057"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="TIGRFAM: adenosine deaminase; KEGG: fal:FRAAL6786
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78145"
FT                   /db_xref="GOA:E3J3E3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E3"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ADP78145.1"
FT                   /translation="MRDLRALPKGHLHLHFELGMRPSTLADLAARNGVPTPPTTGFTEF
FT                   GGFGVVIGGILPMFREVADFERLVDEVVEDAAQEGVVYLEPSFYPYPYLDVFGTAEAAW
FT                   ETVLARSALAAERHGVTVRWMAAVDRVFDTPAQAVEVAKLAVRNRDAGVVALGLHNDEN
FT                   GYPPEPFADAFRYAKDAGLLSTPHAGELDGPASVRGAIDVLLADRLQHGIRAVEDPALV
FT                   EVLAARGTVLDVCPTSNLQLSVVPSLAEHPLPELLAAGVRCSINADDPLLFGPSILREY
FT                   ELCRDAFGLDDELLATCARSSVTGGAAPAEVQATALAGIDAWLAAPAG"
FT   gene            64872..65861
FT                   /locus_tag="FraEuI1c_0058"
FT   CDS_pept        64872..65861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0058"
FT                   /product="band 7 protein"
FT                   /note="KEGG: ami:Amir_1211 band 7 protein; PFAM: band 7
FT                   protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78146"
FT                   /db_xref="GOA:E3J3E4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E4"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADP78146.1"
FT                   /translation="MSSGDAPREPEGPVGAQVRPELDPRETIDMPAPRVGERVITGISG
FT                   AVGFFGTLGALLVAAGLIVLAGVLFAHGVGVGGTVALVVGILLFLASLICFGGLTAVAP
FT                   GQARVVTFYGRYVGTIRHTGLRWVNPLTSRRRVSTRIRNHETGVAKVNDADGNPIEISA
FT                   VVVWQVADTAQAVFEVDDFIEFVAIQTETAVRHVATRYPYDAHETGQMSLRENADEITA
FT                   MLSVEIAARVASAGVHVIESRITRLAYAPEIAQAMLRRQQANAVVAARARIVEGAVGMV
FT                   EAALARLESRDVVELDEERKATMVSNLLVVLCSEQSTQPVVNAGSLYH"
FT   gene            65870..66217
FT                   /locus_tag="FraEuI1c_0059"
FT   CDS_pept        65870..66217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_4354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78147"
FT                   /db_xref="GOA:E3J3E5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E5"
FT                   /inference="similar to AA sequence:KEGG:Caci_4354"
FT                   /protein_id="ADP78147.1"
FT                   /translation="MTERKKILLRLDPAVHDALARWAGDELRSTNAQIEFLLRGALASA
FT                   GRLPSAVGRMPRRGRPPAAEADGAREPDPVLAPDPVLGADDTEAPDEITDEAPDDGAGE
FT                   TPPGREPTPDA"
FT   gene            66315..67019
FT                   /locus_tag="FraEuI1c_0060"
FT   CDS_pept        66315..67019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78148"
FT                   /db_xref="GOA:E3J3E6"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E6"
FT                   /inference="similar to AA sequence:KEGG:Kfla_5865"
FT                   /protein_id="ADP78148.1"
FT                   /translation="MELPDSLPAQLYLLTYNPESERMAGRHRSGYLGPGLRAAAVLELE
FT                   RRGRVAVADGKVVPVAPERRPAVAAGPGVAMLPDDPILTRVLDQIEGSGRHRSLRHWIA
FT                   KDNRVTTRCARDYLEAGRWLRVDRYRVIGLIPRTSVTVRDTRLVRKLIGDVRQTLVGAA
FT                   PAARVADRDRQLAALGVLAEMGVLFSRRERRAHRDRARELVADLGPVGEALRKVVRDQK
FT                   ADAAAAAATSGG"
FT   gene            complement(67053..68330)
FT                   /locus_tag="FraEuI1c_0061"
FT   CDS_pept        complement(67053..68330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0061"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ape:APE_2269.1 putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78149"
FT                   /db_xref="GOA:E3J3E7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78149.1"
FT                   /translation="MTNQQATGGDGSASRWGALASYAAIAACTQLLWLTFAPITTDAAQ
FT                   HYGVSEGAIGWLANVFPLLYVVLGIPAGRLLDRSMRTWLAVGAVLTAAGGLVRLAGGGF
FT                   GVAIAGQLLVAVAQPLVLNAVTALAGGYLAHRHRAAGIALGSASLFVGMIAAFVLGAAV
FT                   GASRMTALLAVQAALTVVATVAVLFALRRPGPFAAAAGAGAVAGDGELVPGEAAARGAV
FT                   RRLWADEVVRRLVTIVTLGFGVFIALTTWLQALLKPAGVSTGVAGALLIGMVAAGTAGS
FT                   AVLPAWAARRGRRTEVIRLSVGVTVVGCAVLAVAPGVTTAAVAVCLMGLLLLADLPILL
FT                   EVAENRPGGDVATLAALVWLAGNAGGVVVSLAVQGLLHHPAAAFALLAVVLLAGVPVLR
FT                   TRWLDAPPGGDASPAAAAAAAVGEAV"
FT   gene            68446..69081
FT                   /locus_tag="FraEuI1c_0062"
FT   CDS_pept        68446..69081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0062"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: kfl:Kfla_4998 two component transcriptional
FT                   regulator, LuxR family; PFAM: regulatory protein LuxR;
FT                   response regulator receiver; SMART: regulatory protein
FT                   LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78150"
FT                   /db_xref="GOA:E3J3E8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E8"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADP78150.1"
FT                   /translation="MLAEDLALLRDGLIRLLTAFDFEVVESVDNGPALLRALVTHRPDV
FT                   AVVDVRLPPTFTDEGLLAAIEARGQVPGLPVLVLSQDVQPVYARELLSSPGGGVGYLLK
FT                   DRVGDVGQFVDSVRRVAAGGSAMDPEVVAELLTRRSRDQPLQALTAREREVLGLMAEGR
FT                   SNAAIAGRLFITEKAVGKHTNNIFAKLSLPPSADDNRRVLAVLAYLNS"
FT   gene            complement(69104..69805)
FT                   /locus_tag="FraEuI1c_0063"
FT   CDS_pept        complement(69104..69805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0063"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ara:Arad_9385
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78151"
FT                   /db_xref="GOA:E3J3E9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78151.1"
FT                   /translation="MTGTKDLYTSGEYLGLNPGRHDGDGAWKALQIARILERNNLRPNS
FT                   VCDVGCGTGRVLRELSHHLPGTPRMVGFDIAAAPLGLNEDTGEGVELVTGDARASDEYF
FT                   DLLMMVDVFEHVEDYLGFLRSFRDRAGVFVFHIPLDMSVQTVLRAKPLLGARRGVGHLH
FT                   YFSRETALATLADAGYRVIDEAYTRGGVELAVSGRRRVARVPRQVAHRLNPDLAARVLG
FT                   GSSLLVLAEGA"
FT   gene            complement(70301..71116)
FT                   /locus_tag="FraEuI1c_0064"
FT   CDS_pept        complement(70301..71116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0064"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: fal:FRAAL6784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78152"
FT                   /db_xref="GOA:E3J3F0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F0"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADP78152.1"
FT                   /translation="MAATRYPSATWRPVVNTSGTMIEPTRGLIPHVQQGNGSLYGMFNT
FT                   PSTQVSSHLWLSKGGGWEQYVDLADKAWAEAAGNPYWISVECEGFDTEDYSPIQVQRLA
FT                   EFYAWGMTEFGWKAEITDSVDGYGIGTHRMGGTAWGGHSCPGDIRANRRQDVLSAALAL
FT                   NGTPPPTPNPSQAQQRYVNMPTLRSGSKGSAVVTLQNALNIIFGHEAPTGDPNRLVPDG
FT                   SFGPATLARVGSLQRLNSPYYGPIGVDGVVGRQTWLKIGYILTGMNRSV"
FT   gene            71634..72650
FT                   /locus_tag="FraEuI1c_0065"
FT   CDS_pept        71634..72650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0065"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6783 putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78153"
FT                   /db_xref="GOA:E3J3F1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78153.1"
FT                   /translation="MLPGPPPAAARALRTAVFVEEQGVPAELEHDAADLAADHAVVWDE
FT                   AGEALATARLLDPAAIPDLDLGPAPVGPVPDGPVANRFGESVGVIGRVAVRPDARGRGL
FT                   ARAVTIALERRAAERGLTGIRLHAQAAVAGLYLGLGYETFGPPDRTAGIDHVWMRRSIL
FT                   PGLRPVRDDDGPAVQRLIGAVWAEYPGCVLDVDGEEPWMRAPATAYTGDLDPARYRGRM
FT                   WVVEDRAVEDEDAGRPGVLAASVAVRETAPGRVELKSLYVAASARRRGLGQALVFLVER
FT                   EARRRDAQVVELWSDTRFSDAHRLYERLGYRGAGRTRDLHDLSNTTEIHFTKDLLSE"
FT   gene            72846..75383
FT                   /locus_tag="FraEuI1c_0066"
FT   CDS_pept        72846..75383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78154"
FT                   /db_xref="GOA:E3J3F2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6779"
FT                   /protein_id="ADP78154.1"
FT                   /translation="MSTPPGPSESRDPTPGGRSGAFWTSAARLAGQRGGIVAVIALVLT
FT                   VGLGFGISQLKFSTDQSNYLNSNSQVAKDNHAYQSLFGGESMITDFTVDPGKNLTDLFT
FT                   PNNLKAFAAVTKELEADKRIVAVVTPVTALQFTHNLVSSPDGNPINSPAAKMLLSAQQR
FT                   DTDPTSQATRLQDAIKTLGRVNAIPPAQQTIGSPAWDNFLLYDNSGKVREALVPFFPNR
FT                   TNAQMVVRLEGNASIKDEGAAASLVQEAMAKQHFENAHVVTTGASVLLKDINDYLRGGF
FT                   LTLGAIALALMVGLLLVAFAVRWRLLPLGVVVVGLIWAFGLAGYLGIHLNVVTIAGLPV
FT                   LLGVGIDFAVQLHSRVEEEAQLDRADNPVAATLRNLMPALLLATVAAVVAFLALEFNAT
FT                   PMIRDFGVLLAIGLPVIVLATVLLTSATLAWREDKRPTQPKDYTRGPLGRATVTLGSLP
FT                   RVAALPLVVIAIAVFVGGAFVEGGQKIQTDPQKWVNQNSQVIKDLDYLGDHAGTTSELG
FT                   VYIQADNLFDDKTAAFVNTVARDQIAKHPDVLTNASSLVTTVGYLLDVPGAKMVPPTGD
FT                   DVRAAYAVAPAAIRSSTVNLSSPGGTAGAMNLIFQTGPSSLVQRAVVVKDIRATVQPPA
FT                   GVRATPSGLAVVGTSLLDNIGHNRALLTYYALIGVFLVLLLRYLSLAKALLSVVPVLIA
FT                   VGLTSLIARGSGLELSPLTAVSGPLVIALCTEFTTLIVQRHLEERALGLAPRAAVDEAA
FT                   ARTGRAFLVSAAAAVVGILVLAFSPLPLLRDFGLIVALNVAVALLSALVVLPPLLVWAD
FT                   ERGWVYRPQGGAGDAAAGRSASPADTPTGSSVA"
FT   gene            75721..77157
FT                   /locus_tag="FraEuI1c_0067"
FT   CDS_pept        75721..77157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0067"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; KEGG: fal:FRAAL6781
FT                   S-adenosyl-L-homocysteine hydrolase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78155"
FT                   /db_xref="GOA:E3J3F3"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F3"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADP78155.1"
FT                   /translation="MSFDFKVADLALAEFGRKEIRLAEHEMPGLMATRAEYAASQPLKG
FT                   ARIMGSLHMTIQTAVLIETLVALGADVRWVSCNIFSTQDHAAAAVVVGPNGTKDDPQGV
FT                   PVFAWKGETLEEYWWCTDQALAWPDGGAPNMILDDGGDATLLVHKGAEFEKAGAVPATD
FT                   ASDSEEYAIVLETLRTTIAAKPGRWTAAAESIKGVTEETTTGVHRLYEMHKGGNLLFPA
FT                   INVNDSVTKSKFDNKYGCRHSVIDGLNRATDVLIGGKVAVVCGYGDVGKGCADALRGQG
FT                   ARVIVTEIDPICALQAAMDGFQVTTLEDVVGIADIFVTTTGNFNIITADHMGAMKHQAI
FT                   VSNIGHFDNEIDMAGLARVSGIEKINIKPQVDEWVFPDGHSILVLAEGRLMNLGCATGH
FT                   PSFVMSNSFTNQVIAQIELFTKTDEYPTGVYTLPKHLDEKVARLHLDALGVKLTTLSKA
FT                   QAEYIGVAVEGPYKADHYRY"
FT   gene            complement(77564..77761)
FT                   /locus_tag="FraEuI1c_0068"
FT   CDS_pept        complement(77564..77761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0068"
FT                   /product="Domain of unknown function DUF1918"
FT                   /note="PFAM: Domain of unknown function DUF1918; KEGG:
FT                   fal:FRAAL6778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78156"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F4"
FT                   /inference="protein motif:PFAM:PF08940"
FT                   /protein_id="ADP78156.1"
FT                   /translation="MHATAGDRVCVRSRTVGQAERHGVVLEVRGKPDGPPYLIRWDDGH
FT                   EGLCFPSADSVLEIFAKQHT"
FT   gene            complement(78051..79271)
FT                   /locus_tag="FraEuI1c_0069"
FT   CDS_pept        complement(78051..79271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0069"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   tcu:Tcur_1472 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78157"
FT                   /db_xref="GOA:E3J3F5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP78157.1"
FT                   /translation="MPEAVIVATARSPIGRAFKGSLKDLHPDDLAATIVRAVLDKVPAL
FT                   DPTTIDDLMLGCAQPAGEQGFNMARAVAVQLGFDFLPGTTVNRYCSSSLQTTRMAFHAI
FT                   KAGEGDTFISAGVEMVSRFGKGSADNLPDTHNPRYADAEARTKARAEAGAPVWTDPHEA
FT                   GLLPDIYIAMGQTAENVVQYTGLTRADQDEFALRSQQNAAKAIADGFFEREITPVTLPD
FT                   GTVVSTDDGPRPSTTLEALAALKPVFRPDGSVTAGNACPLNDGAAAVVVMSDTRARELG
FT                   LTPLARIIATGVTGLSPEIMGLGPIGAVRQVLGRAGMTIDDVDLVEINEAFAAQVVPSA
FT                   RELNIDFDKLNVHGGGIALGHPFGSTGARILTTLLNGLRTRDKTIGLETMCVGGGQGMA
FT                   MLVERLS"
FT   gene            79568..81577
FT                   /locus_tag="FraEuI1c_0070"
FT   CDS_pept        79568..81577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0070"
FT                   /product="peptidase C2 calpain"
FT                   /note="KEGG: fal:FRAAL6773 hypothetical protein; PFAM:
FT                   peptidase C2 calpain; SMART: peptidase C2 calpain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78158"
FT                   /db_xref="GOA:E3J3F6"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F6"
FT                   /inference="protein motif:PFAM:PF00648"
FT                   /protein_id="ADP78158.1"
FT                   /translation="MARDRDHADDQAARLPAVVGSAAARLRDASLALRRLAVTTSTLLE
FT                   PVAELNTTDTWSSPWQRRSTARVDAWQQALTAGAGVLVIRSGWYSRVADVLDAATRAVT
FT                   AGSTGGRVGGPGVVGDPNSAEGSVVAPTVVVPAMPRGWDDPDLALVRALGAGLSDRADP
FT                   ADPPGGDVGGDGPVWFDAGQLGALAGSLRAAGTAAARLAGAVDATEDQALRAAALALTE
FT                   LVASTGDGLGGAVGAAAAVRPPETFRVAGLAATTDVLRLGAHVIAVDGPRLAASLDRRM
FT                   AHFAAAEDAVRAGGVLIDQRAWFDDAPPPSLGQIRSVAAGLVALIGTEPKALSAGEVRE
FT                   VGRRLAALSPAAREAVISRLRGAPLAVFAAAVTRLRKRLVARTRAELTALTAVPDLLLA
FT                   SAPAAMLDELVRLLPDLEPAAPGAGGQRGGAPGRDGADADRTDAVVRDGISSSDVGQGG
FT                   VDDCYLAAALVGLARQRPALLADGIRENANGTFTVTLYRDGRAFPVTVTRDLPGLASAD
FT                   GSGDAGGRPARTGMAAYDVNGRPELWAAVYEKAYARAHGGYDSINGGDPGVATSDLTGR
FT                   PHRTLRPGEVSTGELAARLAAGDVVIVSTGGEAPRVDSGLVRRHAYTVLAVDVTGGRVL
FT                   LRNPWEHVGGELTAWYRWDDLRPGLVAVSLTPPR"
FT   gene            complement(81818..82603)
FT                   /locus_tag="FraEuI1c_0071"
FT   CDS_pept        complement(81818..82603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0071"
FT                   /product="putative alkylated DNA repair protein"
FT                   /note="KEGG: fal:FRAAL6410 putative alkylated DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78159"
FT                   /db_xref="GOA:E3J3F7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032854"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6410"
FT                   /protein_id="ADP78159.1"
FT                   /translation="MSADEAQRVDPPRAEPLPAVDTPRDPAAEARTEEDPAAAVRGLVQ
FT                   ALAAAPVQRHWLDQTSWVDVGRGWLPGAEELYQHVRDTAPWHEGAMWRYEKYVVPPRLS
FT                   AWYPPGKPPPYPQLSAAHLALRRRYGISFDGYGLSYYRDGADSVAMHRDKELRWLDDTV
FT                   IAILTLGARRPWTVKPARLPSGRRILNDATDTTGLLDLAPGPGDLLVLGGRAQRDWLHG
FT                   VPKVTGHVGGRISVQWRWTSRTGQPEQGPGYMASRHFGR"
FT   gene            83211..84899
FT                   /locus_tag="FraEuI1c_0072"
FT   CDS_pept        83211..84899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78160"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6769"
FT                   /protein_id="ADP78160.1"
FT                   /translation="METGQTVRTDETMRQLSLPGVLVLVSTPSADHLVADNVGWHRTVA
FT                   QAGLPRATKLVALVLSSHVQPADGTDPDLPAGAAFCAPGLPVLVEQTGYSRTHVQRQLA
FT                   KLRELGWLSTVGRPAAGRPARFVLTLPAEVARLAGVGLAVPSQAPVAGQAPAPGPVPAS
FT                   HRPARPEPLAATARVAMQGWRPLDDVPARAGFAMPERNAPTRAPDEVVASAVAGRPKSR
FT                   RAAGHRVEGATETAVVEWEEDEEQVTEEDGPLTATGDRPRVIVGRHVFRRRGGRPLDNS
FT                   KAAVRRRAQVVGAFLGSRPTTDGRDDTPLGRLADQLLPPTRIITDESVTPTRIIIEDRN
FT                   FAPGTEPFEPARPTPAEPAVGAEGAQPVDPAATGAPPVDTAVASGPPVDSTVAGGPTPP
FT                   EREVSSVGEAAPGEGPPPVEEAPDPVVVAARQVVTTLAQAMRCEPEMFDDSVDGLTDIL
FT                   REGGWTAPTLATHLVHMVVGGVKVGSDSPGDNLAWRLKHLPRASDQCPCAACRSWRNAV
FT                   AQTPAQTRSDRAGEDSPALPDVAEIERAAALGAEQAALLARARAS"
FT   gene            85025..86947
FT                   /locus_tag="FraEuI1c_0073"
FT   CDS_pept        85025..86947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0073"
FT                   /product="GMC oxidoreductase"
FT                   /note="PFAM: GMC oxidoreductase; FAD dependent
FT                   oxidoreductase; KEGG: fal:FRAAL6768 cholesterol-O2
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78161"
FT                   /db_xref="GOA:E3J3F9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F9"
FT                   /inference="protein motif:PFAM:PF05199"
FT                   /protein_id="ADP78161.1"
FT                   /translation="METGGAGPARDDDGQFDVDVLVVGSGFGGSVTALRLAEKGYRVTV
FT                   VEAGRRFTPSPAATGSTAADAGRPAEAGSGDRRGGGASPLPRNSLDLRRYLWLPWLGCH
FT                   GIQKITLLGRVLVLSGAGVGGGSMVYANTLYRPLEAFYADPQWAALADWRAELAPYYDQ
FT                   AERMLGVVPNPTTTYADEVFRSVAEEMGVGDTFRLADVGVYFGPPGRPAPGETADDPFF
FT                   GGAGPRRTGCLECGECMSGCRHDAKNTLDRNYLYLAERLGVTVVPDTTIQSVTPLPGGG
FT                   YQVLGAPAGAWPAVTPRGRARARRRGRAWRAEQVVFAAGALGTQRLLLAMRDAGRLPDL
FT                   SPRLGYLTRTNSEAILGATTVRPDRRITHGVAITSSFYPNEHTHVEPVRYGIGSNALAP
FT                   LASVMTDGGGRIPRWLKFVGACLRRPHLALLAGLPWRWSERTMISLVMQSHDNSLIVRR
FT                   RRGPGGLSWLTSRQGHGGPNPTWIPEGNDATRRVAARLGGHPAGSITELANIPITAHIL
FT                   GGATIGESAEHGVVDAYQRVYGHPGLHVADGAAVTANLGVNPSLTITAQAERAMAFWPN
FT                   RGEADPRPPLGAPYRRIEPVAPRNPAVPAAAPAAYRPAGLPVVPVGDLFRSARTTGAAE
FT                   GPARA"
FT   gene            complement(87041..88570)
FT                   /locus_tag="FraEuI1c_0074"
FT   CDS_pept        complement(87041..88570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78162"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6767"
FT                   /protein_id="ADP78162.1"
FT                   /translation="MSGGKRVPGESGGSRTSDVGGEPRRPSTGKRVAAHIGRGVQNLRR
FT                   LWECGSRRGRPMGTSNMRDRLSRVTDAPVQSARRGGLGGLLRGGAADQHSHDRDGGPMS
FT                   ALRGQIGQQSRHQDGPGFQQAAWGAAGRAGTAMAGAAGIAARAGQSAGSALAGRMSDVS
FT                   GRMSEHAEDPGWSGRQGARLGGRGPGRQWDDAGQSSREQRGGRAWDQPRSRGGWDEPAR
FT                   QQRWGQRDDAGYGWDEARRNGNASHGVSARMGRADEGEGLGGALGLRGSTRGDLRTGDD
FT                   RPGRDWEQHGGQLGPQGREQRGRGRRRGQRGHEQLGDWTDQAGRRPAQRWERPDLRSRE
FT                   ELLGGHGLPKRHTKRIEKAHDAADDSARRAFEASERAMRHSHSRRAMKDERKAVAQADR
FT                   AQRLLDQHLARAQHRMASAQRRRRRGVGLVMLAGAGAGIAIAARRMLSQPGGGQPAAGG
FT                   LDQTGASTTRVTTTTTRYPTDERLSDGLRDDVTAGHRAGTDSMSDSTSRRF"
FT   gene            88934..89461
FT                   /locus_tag="FraEuI1c_0075"
FT   CDS_pept        88934..89461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0075"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: fal:FRAAL6765 peptidyl-prolyl cis-trans
FT                   isomerase B (PPIase B) (rotamase B) (cyclophilin ScCypB)
FT                   (S-cyclophilin); PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78163"
FT                   /db_xref="GOA:E3J3G1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G1"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADP78163.1"
FT                   /translation="MAEELYATLRTTQGDIEVRLFPDHAPKTVRNFVGLATGDQEWTDP
FT                   STGAKKTGTPLYSGTIFHRVIPGFMIQGGDPLGSGRGGPGYKFADEFHPDLTFSKPYLL
FT                   AMANAGPGTNGSQFFITVGPTDWLNRKHTIFGEVTRGTEIVDAIAKAPTGAQDRPKTDV
FT                   VIQEIAIETRPA"
FT   gene            89705..90877
FT                   /locus_tag="FraEuI1c_0076"
FT   CDS_pept        89705..90877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0076"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: fal:FRAAL6764
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78164"
FT                   /db_xref="GOA:E3J3G2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G2"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADP78164.1"
FT                   /translation="MSVEEPGGPVSGSSEAEPAPSAAPSPWDRPTGAGTPPTMPKQSEP
FT                   GDSAPGQGHQQGWGAPQQGGSPGQWARDASGMPVWEGPRADEPSGRSTPGPGQPAPGLP
FT                   AAGGQAGQSNRCYRHPDRDAFVSCQRCGRPICPDCMRPAAVGFHCPEEAAAARTPASPT
FT                   QFGGRADRDSSGLITKILIGICLVAYVLEGVPGLTGTSHINQFTLDYSLIGVDIAQKHE
FT                   YWRLVTAAFLHGSVLHIAFNMYALFLLGTQLEAILGRVRYLALFFACAIGGNTLSYVIH
FT                   DEKAFSYGASTAIFGFFAAYYLIARRLRVNTNQILIVVGINLLITFSISGIDKWGHIGG
FT                   LATGVVLGLLYAYVPARRVAIQALGTVAVLAILVVAAVLNTQSLTALHTF"
FT   gene            complement(90984..92105)
FT                   /locus_tag="FraEuI1c_0077"
FT   CDS_pept        complement(90984..92105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0077"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G3"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADP78165.1"
FT                   /translation="MTSTGPMLARRHGGSIMQASAAPGPLRGAGRARTSGDGPPTSAPS
FT                   ARSGQPAGPHRPGEVARPEESREATSPFSIANLTSVDSQFHSDGPFAPVGPVHPVELGG
FT                   PGGGLAPIGPGGFRPAGDLNERPSPAGVYDALLGGTAHRRVDRRSALAILLAWPDAPAA
FT                   ARAMKDFLVRAVRFAARNGVNQFLALGGGAGTVDPVHEVACAVAPESQTVYVEPDPLVI
FT                   ARSLPDIRDRQVALVQADVSRPAEVLRHPGVLAHLDVTQPIAIVMVPGLPEIADHEDPR
FT                   EVLRGYREVTARGSLLLFSQLCDEGSARGLRALFERAGQPGAPRPHEQTVELVSTWEPI
FT                   EPGLVPAEEWNAPDERGHPHFGRLPVYASVGWH"
FT   gene            92781..94685
FT                   /locus_tag="FraEuI1c_0078"
FT   CDS_pept        92781..94685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0078"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   fal:FRAAL6761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78166"
FT                   /db_xref="GOA:E3J3G4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G4"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ADP78166.1"
FT                   /translation="MAHSPTRRLGGSPFPPIAEYAFLSDCETTCLVAPSGNVEWMCVPR
FT                   PDAPSVFGSILDRSAGGFRFGPERIMIPAGRRYLPGTNVVETTWQTPNGWLIVTDCLVV
FT                   GRWHRTAARSKTHRRTPMDWDAEHVLLRTARCEHGTVDLSLVCEPNFDYGRKPESWEYE
FT                   GDGYASGIIRNADTDVTLRLRTDLRLGFDGRRALVRTTLKEGDTAFVALTWRAHEPMLP
FT                   TTYAQAMAAVDSTTEFWRQWLSRGMFPDHPWRRQLQRSALALKGLTYAPTGALLAAATT
FT                   SLPETPQGQRNWDYRFSWIRDSTFALWGLYTLGLDYEANDFFSFIADVCEEADDIQVMY
FT                   RVGGESDLQEQVLGHLSGYDGATPVRIGNDAYKQRQHDVWGTVLDSVYLHTKSRDYLSE
FT                   RLWPVLVQLAESAATHWRDADRGIWEVRGEPRHFTTSKMMCWVALDRGRRLAQMRGDLK
FT                   TAARWKTVAEEIHADVCARGVDERGVFTQYYGSTSLDASALLLPLLGFLPASDDRVKAT
FT                   VLAIADELTVDGLVLRYRTEETDDGIGGEEGAFLICSFWLVSALVEIGELHRARQLCER
FT                   LLSMASPLDLFAEEVDPPTGRHLGNFPQAFTHLALITAVMYVIRAEDAEAYARPSPST"
FT   gene            94745..95116
FT                   /locus_tag="FraEuI1c_0079"
FT   CDS_pept        94745..95116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78167"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6760"
FT                   /protein_id="ADP78167.1"
FT                   /translation="MAKLVVGGGRVEVVLSQAERLAALRGDVSAALDEIADVQVSPHPF
FT                   GELRGIRAPGTGVPGVIALGTWRHRGGKDFVAIYRRRPAVVVLLAAGCEFERLIVGVED
FT                   PDQTVAAIRAATGLVIGGA"
FT   gene            complement(95250..95513)
FT                   /locus_tag="FraEuI1c_0080"
FT   CDS_pept        complement(95250..95513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0080"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   scb:SCAB_45631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78168"
FT                   /db_xref="GOA:E3J3G6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G6"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADP78168.1"
FT                   /translation="MPESRRRKPKKATAARPASTVTAKRRSPSPRWFGGMIMAFFLIGI
FT                   AYLLTYYFSNGGVLGMEALGGWNILIGFGFVVIGLGVATQWH"
FT   gene            95736..96512
FT                   /locus_tag="FraEuI1c_0081"
FT   CDS_pept        95736..96512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0081"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   fal:FRAAL6757 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78169"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G7"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADP78169.1"
FT                   /translation="MAAALAGLLLVLGWGSAGGARPPAGSALAGEHRALAGVVAADQAG
FT                   VDRSRDRLAQVRAALASPGPLAAPDPAGASRVPLAAGCTSADGSAGPPDCAGQAALLAQ
FT                   VGLTPVRGTAVVVSLDDTPRGRRAGPWPSGVRAPVADDLVVHQQDVQAVVNALWTGGAR
FT                   AMTLMGRRVTARTAVRCVGNTLLLEGNVYSPPFVVAAIGDPARLTAALDADPGVVLYRE
FT                   YVDAYDLGYHVETKANMTFPAATEPPTAVYATPLRD"
FT   sig_peptide     95736..95795
FT                   /locus_tag="FraEuI1c_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.436 at
FT                   residue 20"
FT   gene            complement(96546..97196)
FT                   /locus_tag="FraEuI1c_0082"
FT   CDS_pept        complement(96546..97196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0082"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: fal:FRAAL6756 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78170"
FT                   /db_xref="GOA:E3J3G8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G8"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADP78170.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLDAECVVRRNDEVDPERVGELGV
FT                   DGVLLSPGPGTPEAAGMTIPMVTAASAAGLPVFGVCLGHQAIGVAFGATVDRAPELLHG
FT                   KTSVVHHNGAGVLADLPNPFVATRYHSLAVEAATLPPEIEITARTDSGVVMAMRHRTLP
FT                   IEGVQFHPESVLTQGGHLMLARWLDACGDGGASRALAPALSNEVETLRQAAFA"
FT   gene            complement(97220..99244)
FT                   /locus_tag="FraEuI1c_0083"
FT   CDS_pept        complement(97220..99244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0083"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: fal:FRAAL6755 putative
FT                   serine/threonine-protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; PASTA domain
FT                   containing protein; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; PASTA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78171"
FT                   /db_xref="GOA:E3J3G9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78171.1"
FT                   /translation="MTDVTDLYGTEPRLVGDRYELGAGIGYGGMAEVYRGRDIRLGRDV
FT                   AIKVLRSDLARDPNFLKRFQREAQSAAGLNHPAIVSVYDTGEDIINGTRLPYIVMEFVE
FT                   GRTLREVLQQEGPFPERRAMEITSDICAALDYSHRLGIIHRDVKPANVMLSPDGSVKVM
FT                   DFGIAKANNATSSTMTATQAVIGTAQYLSPEQAQGKKVDARSDVYSTGVLFYELLTGEP
FT                   PFRGDNPVAVAYQHVREIPDPPSRHNPQLSAAADAVTLHALEKEPDDRYASAGEMRDDL
FT                   ERALAGRRVVAQQSGRPTGGASAAATQIARGGYRDDPRTGGYDTYDRYGDTGYQDSGYE
FT                   AGAYRQSGETRTRGGYAPVGGYTDQFERFPPDDDRYGGSGGAAPPPQRGSNAWKWVLAG
FT                   LAVVLTFVVVSLVATSLLSNKGGGSGGGSSTDATIPTGLKGQPLTAVKNQLTDLGFTNI
FT                   TSTSQKVTDGTAPDTVIKIAPNEGSKVPLSTAISLTVAAAPDQKPVPDVVGQTASAAQA
FT                   ALTAAGFEVQQQPYSDSTNPPKQKPGRVEKTDPAAGQPWGVGTTVTIFVVSSQVNVGSY
FT                   IGQSVSSAQAALTQLGLNNTVQQQPSDQAPGTVIDQNPKNATVNRGDTITLVVAAQATS
FT                   SPTGTPSTGVTPTLPGLPTSGNTGGPGHGGGTATPSPTG"
FT   gene            complement(99237..101051)
FT                   /locus_tag="FraEuI1c_0084"
FT   CDS_pept        complement(99237..101051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0084"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: fal:FRAAL6754 serine/threonine-protein kinase PknA
FT                   (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78172"
FT                   /db_xref="GOA:E3J3H0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78172.1"
FT                   /translation="MNNPSGQPAHQPAQPFAGAVPANTVLDNRYRLDGRIATGGMGEVW
FT                   RGVDQTLGRPVAVKLLRPEYASDESFLVRFRGEARHAARLSHPGIASVYDYGEVATVDD
FT                   HPTAYLVMELVEGEPLSAVLHREKRLSPERMLDILGQAADALQAAHALNIVHRDIKPGN
FT                   LLIRHDGVVKVTDFGIARAVDAAPLTATGIMMGTAYYVSPEQASGRPVTPASDVYSLGV
FT                   VAYECLAGRRPFDDRNPIVVVMAHQQDNPPPLPGDVPHQVRQLVEQAMAKNPNRRPPSA
FT                   GGFARSAAAIQRELFSPEPRWAAGAGGVSPDMTARHPGPAGPPPRGRTRAASWLADGPA
FT                   GVPAAGGTSTPGSAAARGGYPGSAGASAAPGANYPGQNPGGRGGPATSYQQGATGYPPA
FT                   QPGGTGYQSPAGQTGYQAGGGFANRADGATGYQPGATGYQAGGTGYQQGANGYQPGATG
FT                   YQPGATGYQPEQAGYQPAPTAYQPTPTSYQPAGGGWADEQGDETSLAAAHLAPAGDLDE
FT                   PAGWQPGTRAARRAGSTRAGAAAGRRRRLSLPVLLVLLAITVVVCALITRSLAGSGGSN
FT                   HAASSVTQAVTTGTRGGGIVVVEANAGD"
FT   gene            complement(101048..102511)
FT                   /locus_tag="FraEuI1c_0085"
FT   CDS_pept        complement(101048..102511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0085"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: fal:FRAAL6753 putative penicillin-binding protein
FT                   PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78173"
FT                   /db_xref="GOA:E3J3H1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADP78173.1"
FT                   /translation="MNRPIRKVTIVCAVLFAALLVNANWVQVGDQHSLKQEPTNTREIA
FT                   ARLDRQRGGLLAGPANDRVTMASSTPVDDEFKYLRQYSDGRLYEPITGYFTLYSATGLE
FT                   HTENLFLNGDDDRLLASRVSALLSGSGRKGGYVLTTIDPKIQQAASAALNGRKGAVVAM
FT                   DPRTGAILAMVTAPTYDPNDLAGHNPDQVQKNYDALNADTNQPLLNRATQQTYPPGSTF
FT                   KLITAAAALSTGQYDINSVLPAPDRLKLPQSNTELPNFGGERCGNGQTDTMIHALTISC
FT                   NTAFASLGMQVGGDKLRAQAQAFGFNTTIDGFELPEAKSVFPSSLDQAQTAQSAIGQFD
FT                   DRVTPLQMAQVVSAIANHGRMMKPYLVDELEGPDLKQISKTQPKELGQPISSSVADELT
FT                   TMMKSVVTSGTGTKARISGVSVAGKTGTAEHGTNEPPHAWFVGFAPAENPSIAVAVVVE
FT                   DGGGESGTGGSVAAPIAQKVMQIALDVQG"
FT   sig_peptide     complement(102440..102511)
FT                   /locus_tag="FraEuI1c_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.977 at
FT                   residue 24"
FT   gene            complement(102508..103995)
FT                   /locus_tag="FraEuI1c_0086"
FT   CDS_pept        complement(102508..103995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0086"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: fal:FRAAL6752
FT                   putative cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78174"
FT                   /db_xref="GOA:E3J3H2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADP78174.1"
FT                   /translation="MTLPPLRRPRPADLTATFAGFPLPPGLEIPPYRRRELGLLVFAGV
FT                   LATGALAALMLAHNGTLTFQVATYGLGFFALWGLGHLAVRWFAPAADPMLLPLVAALNG
FT                   IGLVMIYRIDLARADAQRAAHKTVTAGAAQTQLVWTLLAIIVFVLVLAIVRDHTTLTRY
FT                   TYTAGLAGILFLILPAVPGIGASINGARLWLRVGPFSFQPSEVSKILLMIFFAGYLSRM
FT                   RDVISVASPTFLGLKLPRPRDLGPVLVAWAASLGVLVIENDLGSSLLLFAIFLVILYTA
FT                   TEQVSWVAIGLALFCCGALLADHLFSHVQVRVDGWLHAFDGSNPSGKSYQLVQGLYGFA
FT                   AGGITGTGLGQGNPRKVPFSNTDFIMASLGEELGLTGVMAILVMYALIVMRGLRAAIGA
FT                   RDPFGKLLATGLSASLAFQVFVQVGGVMRLIPLTGITLPFVSYGGSSIVANAAIIALLL
FT                   RISDSTIRSPREEAAPAPLYDPDAVAGARTQVVVKSP"
FT   gene            complement(103992..105350)
FT                   /locus_tag="FraEuI1c_0087"
FT   CDS_pept        complement(103992..105350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0087"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6751 serine/threonine specific
FT                   protein phosphatase; PFAM: Protein phosphatase 2C-like;
FT                   SMART: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78175"
FT                   /db_xref="GOA:E3J3H3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H3"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADP78175.1"
FT                   /translation="MSLRLHYAIRSDVGHVREGNEDSAYAGPYLLAVADGMGGHAAGEV
FT                   ASSTVIAALADLDTEIDADELVEALVSAMHDANANLRAMSARDGSLDGMGTTVTAVLAS
FT                   GDQFGVLHVGDSRCYLLRDEVLSQITHDHTLVQDLVDQGRITPEQANSHPQRSLLMRAL
FT                   DGREVDPDLSLRQARVGDRYLLCSDGLSGVVSGETILEALLGTSPQDAVDRLIELALKG
FT                   GGPDNITVVVADVVDDEESAQSAMVAGAAAEKESVPGATPARVGPNPRNPDSDSAAARA
FT                   ARIGRASRGGLSPEDFADGATPGRGRRRFVFVGATVAVLIVVTAIASWAWVRSQYYVGV
FT                   HDNKVAIFQGVQSLDALSSVHATFMPISEVAEPDQSAVRSGLHADDLADAQKKVSNLRT
FT                   VPASGSTSKPTTTPTATPTNKSTLPGTAASIAACATSDPAAALNCVSLTSPSP"
FT   gene            complement(105347..105907)
FT                   /locus_tag="FraEuI1c_0088"
FT   CDS_pept        complement(105347..105907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0088"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: fal:FRAAL6750 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78176"
FT                   /db_xref="GOA:E3J3H4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H4"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADP78176.1"
FT                   /translation="MDPSQPNELVLLLVKIGYLALLWTFVLLVVRAIRADLLEPARRRV
FT                   QRRGTPVRAGGGGGDAVARPRGHQQPAQPPAGLPAPAPPNAPNAYPPSKVVVTKGPLAG
FT                   TVIPLTGEPITIGRAPDSTLVLDDDFASGRHARLVPHDGRWFVEDLNSTNGTFLEHTKV
FT                   TTPMPVSLGAPVRIGKTVLELRR"
FT   gene            complement(105914..107746)
FT                   /locus_tag="FraEuI1c_0089"
FT   CDS_pept        complement(105914..107746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0089"
FT                   /product="Protein of unknown function DUF2662"
FT                   /note="KEGG: fal:FRAAL6749 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2662; Forkhead-associated
FT                   protein; SMART: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78177"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H5"
FT                   /inference="protein motif:PFAM:PF12401"
FT                   /protein_id="ADP78177.1"
FT                   /translation="MGVLQRFERRLGGLVEGAFAKVFKGGVEPVEIAGALAREADDRRA
FT                   ISSNRVLVPNEFAVELASPDYNRLSPYSRALCDELAEMVREHAAEQRYTFVGPVSIRLS
FT                   EAPDLDVGVFRIRSSVASAEGMVATPQRRGSRAAPGVPRLLITNKEAPPGREREYELTA
FT                   ESTLIGRSVECDIRLTDTGVSRRHGEIRRMPDGNWLYVDAGSTNGSIVNGRPATQVKLV
FT                   NGDLIELGAALVTFQRDDGRGGRDSREPGRLGVEPPEPFGRPNDREPGGGPDAFRGGRG
FT                   VDRDGRLDPRDRLEPRDRLEPRDRPGPRGDQYRDRPDGPVRPDRPAGNRPDEPFNDRSG
FT                   ARGEPYRDRPPGPARADRPDRLGARPDEPFNDRSGARGEPYRDRQAGPARADRPRADEP
FT                   FDDRSGPRGEVFRDRSGARGEPYRDGPNGRPARPGPPRPEPQRDERPRHDPQRKDSPRP
FT                   GPPREPAQPEGPRPLGARRPAPADDRSGPRGARPRDEAYGGPSSARNEPNRDGPARLPR
FT                   DGRDARDARPRQDGDSDEYAGQGRGYGRRGDGSGPHPAGARRAGGRDAGGRDGRPPEEI
FT                   YDAETVLPSRAPGRPRSDDPRRRPGPPPPSDRSW"
FT   gene            108174..108256
FT                   /locus_tag="FraEuI1c_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            108174..108256
FT                   /locus_tag="FraEuI1c_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(108435..109181)
FT                   /locus_tag="FraEuI1c_0090"
FT   CDS_pept        complement(108435..109181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0090"
FT                   /product="Domain of unknown function DUF1994"
FT                   /note="PFAM: Domain of unknown function DUF1994; KEGG:
FT                   fal:FRAAL6747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78178"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H6"
FT                   /inference="protein motif:PFAM:PF09352"
FT                   /protein_id="ADP78178.1"
FT                   /translation="MGTWVAGRLAAVVAAAATVAVLASGCNGVSTALSDTSTASPSGAL
FT                   PSGFAANGSDVGADGSALAALGTLKIAPLATSPKYDRDAFGTAWKDVDHNGCDTRNDVL
FT                   HRDLHSVTVRTTDNCIVLTGELNDPYTNRIIRFNRGKDSAAVQIDHVVPLGDAWRTGAY
FT                   AFPESEREAIANDPENLLAVDGPTNVKKSDSDASEWLPPAVGYRCTYVARQIGIKARYH
FT                   LWVTQAEADAMRTVLSSCASQPELGG"
FT   sig_peptide     complement(109110..109181)
FT                   /locus_tag="FraEuI1c_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.395 at
FT                   residue 24"
FT   gene            109446..110108
FT                   /locus_tag="FraEuI1c_0091"
FT   CDS_pept        109446..110108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0091"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6746
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78179"
FT                   /db_xref="GOA:E3J3H7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78179.1"
FT                   /translation="MSSGGPQVVGVAASVPRPLRRDAERNRERILCAARELFVAHGLAV
FT                   GVDEIARRAGVGMGTLYRRFPNKDALVEETLAAAVGRVRELAVIARETSPPGRALREFL
FT                   MTSISDDACRWAFVSRRLWTGRTSALVFDDVVPLLGLMFTDAQEAGLIRADAVLADLIV
FT                   LLRAVRVVLELTDAPVGQTWRRYIDLLLDSLRPSEHNTSLDGPPMTLRALASSAIEP"
FT   gene            110176..110535
FT                   /locus_tag="FraEuI1c_0092"
FT   CDS_pept        110176..110535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0092"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: fal:FRAAL6737 metallo-beta-lactamase; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78180"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H8"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADP78180.1"
FT                   /translation="MAGMGPDQVPTVTVADIPAEPTGDDKLFLLDVREPDEWAAGHIDG
FT                   ATHIPMGDLVSRLDEVPRSARVIAVCRSGNRSGMVTGYLTKGGWDAYNLAGGMMAWAAG
FT                   GRPMTADSAGAPFVL"
FT   gene            complement(110573..111451)
FT                   /locus_tag="FraEuI1c_0093"
FT   CDS_pept        complement(110573..111451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0093"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="manually curated; KEGG: fal:FRAAL6736
FT                   formamidopyrimidine-DNA glycosylase; PFAM: DNA
FT                   glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78181"
FT                   /db_xref="GOA:E3J3H9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H9"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ADP78181.1"
FT                   /translation="MPELPEMEALASVLRDRAVGKVVTRAEPVAINALRTVSPGPADLV
FT                   GATLVDATRHGKFLDLVFAGTGGERLDLVAHLSRAGWLRWKDSQPTTPGRGGRGGLAWR
FT                   LVFDDGSGFDLTEAGTQKRLAVYLVRDPAEVPGVARLGIDPLDPAFTVEALAALLTAAG
FT                   RSQVKGVLTDQSVLAGVGNAYSDEVLWAARLSPFAPSSGLSGDQVAALHEALVGTLRAA
FT                   VEAAGGLGAADLKAEKKANLAVHARTGEACPRCGDTVRQVSFADRSLQYCPTCQTGGRL
FT                   LADRRLSRLLK"
FT   gene            111524..111727
FT                   /locus_tag="FraEuI1c_0094"
FT   CDS_pept        111524..111727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78182"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6744"
FT                   /protein_id="ADP78182.1"
FT                   /translation="MTNGGAVDGPWISCPWCTGTVPLTYFAESDEEPGAQEAVCEACGR
FT                   RVSFLPPRPPDEPGDQAPSAAA"
FT   gene            111937..113706
FT                   /locus_tag="FraEuI1c_0095"
FT   CDS_pept        111937..113706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0095"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: fal:FRAAL6745 putative serine-threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78183"
FT                   /db_xref="GOA:E3J3I1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78183.1"
FT                   /translation="MTEDVAGAERRPASGLSGDPLAAHDPRRVGPYPLLSRLGTGGMGT
FT                   VYLGRGERGRLVAVKVIRPDLAADEEFRRRFRQEVAAARRVAPFCTAEVLDADPDAAAP
FT                   YLVTEFIDGLRLDQAIARGGPLTPSTLTGLAVGVATALTAIHRAGLVHRDLKPSNVLLS
FT                   LSGPRVIDFGIAQAVAHGSTAKPTSWGFGSAGWMAPEQINGQPIGPAADIFTWGILMAY
FT                   AGTGQHPFGEGKDIDLAYRTVSAAPDLTGLVPPLRDLIDAALAKDPAARPTARDLLLAL
FT                   IERGHTGEPGVPPGEELLGLAADRAEVMASPAVVALTGPDPSSGLPRTRVAPPGYGAAT
FT                   AQVEGAGQPGGPGYDPRQASARYQRPGEAPGGIVPPRRPSTPAAGVRPGGAGYPGQARS
FT                   GMPLRAGGRRPGGSRLGLWLTIILIILGALAITLIALNPGDSSEPGSSVPPSRTPTPTA
FT                   TGPNSRVYTDGSLQFQIQSLRCGVQKIGIIPRKPDGQYCLVKINVRNVGSSSRTLVANQ
FT                   QFMYDQNGGRHEAYSALETRLYYPFDSLWNKIQPNAQVSGTLIFDIPVDTGPTRLELHD
FT                   GLIGQGAQIPVEG"
FT   gene            113800..115215
FT                   /locus_tag="FraEuI1c_0096"
FT   CDS_pept        113800..115215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0096"
FT                   /product="haloacid dehalogenase domain protein hydrolase"
FT                   /note="KEGG: kfl:Kfla_5922 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78184"
FT                   /db_xref="GOA:E3J3I2"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I2"
FT                   /inference="similar to AA sequence:KEGG:Kfla_5922"
FT                   /protein_id="ADP78184.1"
FT                   /translation="MSSAPLVVGFDLDLTLLDARRGIVATYAEIAARTGVPIDGELAAS
FT                   RLGPPLEQELANWFPADEVAGAATLYRELYVDHAVPVSEAMPGAARAVEAVRREGGRVV
FT                   VVTAKAEWLARASLAAIGIEPDVVVGWLWAAAKGDAIREHGVHIYVGDHEGDMRGARAG
FT                   GALSVGLTTGSHDADALSAAGADVVLGGLADFPDWLAGAVLDRRLAALSTRLTELGSVL
FT                   VAFSGGADSAFLLAWAARTLGPGAVVAATAVSPSLPAAELDAARAFVAALGVRHVLPST
FT                   DEQSRPGYLANGADRCYFCKAELTETLGPLAADLGLAHVVTGTNADDAVAGFRPGIRAA
FT                   AERGAATPLLDAGLTKRQVRAASRRLGLVTADKPAAACLASRIAYGIEVTPSRLARVEH
FT                   AEQALRLALADAELPCRDLRVRDLGDRARIEVDAELVPTLTARPDLTSAVTGFDLIEVD
FT                   PRGFRSGSMNELL"
FT   gene            115543..115938
FT                   /locus_tag="FraEuI1c_0097"
FT   CDS_pept        115543..115938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0097"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: fal:FRAAL6743 CspB; PFAM: Cold-shock protein
FT                   DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78185"
FT                   /db_xref="GOA:E3J3I3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADP78185.1"
FT                   /translation="MPTGKVKWYDVDKGFGFLSRDDGGDVFVHKAALPAGVEKLRAGDR
FT                   VEFGVAAGRKGDQALSLRILAEPPSVAKAVREAARRSPDELHAMVEDMIKVLDDVQRDL
FT                   RRGRYPDRRIAQRVAKVVHAVASELEA"
FT   gene            complement(115952..116851)
FT                   /locus_tag="FraEuI1c_0098"
FT   CDS_pept        complement(115952..116851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0098"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   fal:FRAAL6735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78186"
FT                   /db_xref="GOA:E3J3I4"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I4"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADP78186.1"
FT                   /translation="MSQVTAASEADQRERTGLTLAISPCPNDTFAFHALAHGLVPGVPP
FT                   VSVTFADIDVLNARAADGLDDLVKVSYAALPWLLDGYRLLPAGGALGRGCGPLVLMSAG
FT                   GPTAAGAQGDAAVLRGARVAIPGTRTTAYLLFRLWAAGIDVATIDVLPFEKIMPAVQAG
FT                   RYDAGLVIHESRFTYPSYGLVSVADLGDWWEGATGLPIPLGAILARRDLPAESGDLAAA
FT                   VRASVAAAFANPAASAAWVLEHSQELAPEVVQAHIDLYVNDFSLDLGDEGYAAAEELLA
FT                   RAAAENLVPPLPSPLRQP"
FT   gene            complement(116903..117847)
FT                   /locus_tag="FraEuI1c_0099"
FT   CDS_pept        complement(116903..117847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0099"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: fal:FRAAL6734 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78187"
FT                   /db_xref="GOA:E3J3I5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I5"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADP78187.1"
FT                   /translation="MSRTLIVTAVQAEADAVCAGLMGSWSRSRGPSSEVPSAPVSPDWD
FT                   RQLLTTSTLGPYVGRRRGPVTVLAAGTGGPAAAAGTAVALAVAAATGDPFTLVLSMGVA
FT                   GGFRGWAEVGDLAVASRLVAADLGAESGLEDLREPAGKVHEMDRSLGFHSTGAPPLPRA
FT                   TSSSADGKFLTLDDLDLGSSTIIPKSGLVERLATVVGITGRRVVTGPVLSVATVTGTEL
FT                   RAATLTARLDPVAEGMEGYAVGTAAAAFGVPAGEIRAISNQVGRRDRASWNLPAALASL
FT                   RTAAGALVAHPDGLLAAAADASAADGSRPPVGR"
FT   gene            complement(118217..119155)
FT                   /locus_tag="FraEuI1c_0100"
FT   CDS_pept        complement(118217..119155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78188"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6731"
FT                   /protein_id="ADP78188.1"
FT                   /translation="MIEPLADPTAEVAPPADGDDEDDQEDPATPRGTRSRATGPDPVCA
FT                   AAVDVARAAAVEEAGDEGAVGEHLGVEAEGDRLVLHRFASLARAYRGWVWTVVTTRAPR
FT                   VRKVTVDDVVLTPGDDALLAPAWVPWSQRLRPGDVGVGDLLPTAVDDPRLALRQADVEE
FT                   FVDTDAFLELGLGRPRVLSAVGREEASARWYAGESGPDAHVAKVAPATCLTCGFHVRLA
FT                   GALGRLFGVCANELAPDDARVTSIDHGCGAHSEALVAPSAHPESVPFDEDPSDLTPTDV
FT                   ELVGATAGGTAPEPAHAGHPAVGRPEPYGHA"
FT   gene            119652..121715
FT                   /locus_tag="FraEuI1c_0101"
FT   CDS_pept        119652..121715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0101"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: fal:FRAAL6732 hypothetical protein; manually
FT                   curated; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78189"
FT                   /db_xref="GOA:E3J3I7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78189.1"
FT                   /translation="MAEPGAATESPTGTVGRVRASLGTGVGRIRATTRRDGADRSGLAA
FT                   LLDLSVINAAGDALVTVALAGSLFFSVPTGQARSKVALYLLITMVPFVLLAPVIGPLLD
FT                   RVAHGRRTALAALCLGRCLLAWQLAAQLSGLQVYPLALGLLMLSRAFGIARSAVIPRVA
FT                   PPELTLVKVNSRMSMVNIVASSVIAPIGLGIAHIPYVGYAWVLRLCALLYLVGVLLAIN
FT                   LPKRVDSNAGERALRDIVAGATGPRAAAAPGQPVAAGLQYQAVAGTVVDAESRGRRLAG
FT                   KHARWHALVRAVLGASPVALRSTLVLRAIVGFLTFFLAFLLRTEGGTNLWLGALAASAA
FT                   VGSGLGVVIGGRLGRRRPERILTLALLLTTVGCLLAAIDYAKFPALFAALLAMLAAAMA
FT                   KLALDAIIQRDTADDVRNSAFARSETVLQLGWVAGGALGLIEMPGQLGFLIAGLVPAAA
FT                   LFPQAREIRRARGAADRAERLRASGGDPAAWPGAATGTWVQPDGTTVLPVMMPAPDRPF
FT                   RPVAGQAPDDATRPWRAAPEPPMPAGGPVVPGYPSVSPPPAAPPTLWYPGSGEYQGSGE
FT                   DQANGGYPGSGGYAGSGEYPGNGGYPGPGGYPEVGAYPAPGDQTAGQPVGPWVRAPGPV
FT                   DETTTRPARRRPWGRARRADSEADPDTTLPLGSDRRFPDVPPPRDTPNQSAD"
FT   gene            complement(121885..122877)
FT                   /locus_tag="FraEuI1c_0102"
FT   CDS_pept        complement(121885..122877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0102"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: fal:FRAAL6729 putative
FT                   amino acid ABC transporter amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78190"
FT                   /db_xref="GOA:E3J3I8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I8"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADP78190.1"
FT                   /translation="MADTASVYRHSRGQRNPGRAVGIAALLTLALGAAACGGSGGSAKG
FT                   GGGTNGVPRGHLTVADAGFTESKILADIYAQLLTKAGYGVDRTSIASTEIAESSLESGQ
FT                   IDVMPQYVATYADLLSSLVNGKDTPPVSSSDLTASLAALRRFAAGKGLTALNPANAVDQ
FT                   NAFAVTKDFASAHQLRTLSDLGASGVAVTVAATTECPTRPFCQPGLERTYGIKIAGLVQ
FT                   TGFDTAQTKAAVRDGLAQLGLVATTDATVDDYGLVILTDDKKLQNADNLVPIVNTRSLT
FT                   PEISAALNVLAPVLTTADLADLDRRVDSDGEASAAVATEYLTRKRLLPA"
FT   gene            complement(123093..124022)
FT                   /locus_tag="FraEuI1c_0103"
FT   CDS_pept        complement(123093..124022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0103"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: sma:SAV_2178 ABC
FT                   transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78191"
FT                   /db_xref="GOA:E3J3I9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I9"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADP78191.1"
FT                   /translation="MYRKTTSAFVALALPVVLTLAACGSSGSSGSSASPSAGASAAADA
FT                   GSLTIGSADFTESALLADIYADALAAKGVKITKKLNIGERSVYVKALQDGSIDFIPEYN
FT                   GSILAYLDPKATAKSTAEVTAALPAALGSKLTALTPATAQDSDTITVTKATADKYHLTS
FT                   IADLTSVADKLTFGAPAAFQTRPDGIPALKSVYGVTFGNFTALSASGTVTVTSLKNGTI
FT                   DGADIFSTDPSFASEGFVALADPKNMFAAQNVTPVVATAKVTPTIKDTVNAVSAKLTTA
FT                   ILADLDAKVGTGDPDAVAKQWLTSVGLA"
FT   sig_peptide     complement(123921..124022)
FT                   /locus_tag="FraEuI1c_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.333 at
FT                   residue 34"
FT   gene            complement(124032..124871)
FT                   /locus_tag="FraEuI1c_0104"
FT   CDS_pept        complement(124032..124871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0104"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rop:ROP_23160 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78192"
FT                   /db_xref="GOA:E3J3J0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78192.1"
FT                   /translation="MSAATTLASSNLPSLGLVPGWLTTASHWWGPHGLLVSLREHVLYT
FT                   VVAVVVAMIIAVPIGLLVGHTGRGGFAIAGLANAIRAVPAFGLLILLYVVVSPKIHYHG
FT                   SISWLVPRGAFGSLIPVEAMLVVLAIPPILTNTYAGVQGVDPDVRDAARGMGMRGWQVV
FT                   TRVELPIALPLVLAGVRSAVLQVIATATIAGYLPFLGGLGYQIFINGLPQINDPDVGYP
FT                   AMIGAALLVAVLAVVADLLLLGLQRLVVSRGIAGRYRTTLPAPVPPASAAPPASAEI"
FT   gene            complement(124868..125521)
FT                   /locus_tag="FraEuI1c_0105"
FT   CDS_pept        complement(124868..125521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0105"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: nml:Namu_1405
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78193"
FT                   /db_xref="GOA:E3J3J1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78193.1"
FT                   /translation="MNHIWQYLSDNHSQVLDWLRTTVWLSLVPLVVALVLSLPIGWLAS
FT                   RYRWTYAPVISLGGLLYTIPSIVLFLALPGVLGTGILDPLNVAVALTVYSVALLVRVVA
FT                   DGLRSVDATVLDAAAAMGYTERQRLLAVQLPMAVPVIGAGLRVAAVSNVSLIAVASSLG
FT                   VSQLGSLFTLGATTSDTAPIWLGLILFVLLALVLDALILLGVRLATPWRRAVAR"
FT   gene            complement(125518..126669)
FT                   /locus_tag="FraEuI1c_0106"
FT   CDS_pept        complement(125518..126669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0106"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nml:Namu_1406 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78194"
FT                   /db_xref="GOA:E3J3J2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78194.1"
FT                   /translation="MIRFESVTKRYPDGTVAVDALDLVAETGKITVLVGPSGCGKTTSL
FT                   RMINRMIEPTSGRIWLDDRDTATIRSDQLRRGIGYVIQHAGLFPHRTVLDNITTVPRLL
FT                   GRGRREARGQALELLERVGLPAAFAGRYPAQLSGGQQQRVGVARALAADPPVMLMDEPF
FT                   SAVDPVVRGQLQDEFLRLQHELRKTIVLVTHDIDEAIRLGDQVAVLRVGGRLAQLAPPG
FT                   ELLASPADSFVAGFVGRDRGYRALGFTHAGELPLLDEPTVTVGAPLKSAPDLARDGWVL
FT                   ALDEERRPLGWLATSATAEVGAATATGEGTVDADKLNLGGTLTPEAGTLREALDAALSS
FT                   PSGRGVVVHADGTFAGTVTASDVLVRIEQERAAPPGSPEQPAP"
FT   gene            127008..128087
FT                   /locus_tag="FraEuI1c_0107"
FT   CDS_pept        127008..128087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0107"
FT                   /product="SEC-C motif domain protein"
FT                   /note="KEGG: fal:FRAAL6720 hypothetical protein; manually
FT                   curated; PFAM: SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78195"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J3"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADP78195.1"
FT                   /translation="MARRTTTARPRTSAAGAPAAGAHAADVPQVGPREQCPCGSGRRYK
FT                   ACHGAKSRPAPVLRPFAGRVDEADLVALRELIPSATAPLTLHADHLAKHPEHADRKITL
FT                   GTMLPQAAPALVRDTGEILVATQTLAPGLDPSADIAGALLAALAAEPGTVIATGPVSAL
FT                   TAVERLPEGLAGLPRLVDVLDPAPLTITVHAGFDWWLPPSEDGAGLSGEVASSLERANA
FT                   TVVPTARLSSVEAAYWTQPGDKRHLRWVLPFLEVEGVSDPDVARSRSEEQLLDALARLA
FT                   AANALSAGEGSRFVGSFRADGLVVPVWDLAPDADADSCEAPAAALRKSMDEVLAERRPL
FT                   TSEERRIRAGVVGRTLTLR"
FT   sig_peptide     127008..127082
FT                   /locus_tag="FraEuI1c_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            128098..129309
FT                   /locus_tag="FraEuI1c_0108"
FT   CDS_pept        128098..129309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0108"
FT                   /product="geranylgeranyl reductase"
FT                   /note="KEGG: fal:FRAAL6718 putative hydrogenase; TIGRFAM:
FT                   geranylgeranyl reductase; PFAM: FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78196"
FT                   /db_xref="GOA:E3J3J4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J4"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADP78196.1"
FT                   /translation="MADTSMREFDVVVIGAGPAGAAAARSAAVAGARVCLVERAELPRY
FT                   KTCGGGLVGISRDHISGAGLDLAQLARAEVDALTITLDGRYRVTRRRRDGSPIIAMVMR
FT                   PELDAALVDAARAAGVEVRTSTVVTGVRDDGPAGAVVEIRGGPDLRASVVVGADGTSSR
FT                   AAGYVGVRCDQVDLGLEAEIKAPAHVAARWERRMLLDWGPVPGSYGWVFPKGDVLTVGV
FT                   IGAREDGPALRSYYERFVAQLGLADLPRLHDSGHLTRVRADGSPVRRGRVLVAGDAAGL
FT                   LDPWTREGISFALRSGRLAGSAAAAAAGGDQGALDAYPDRVDAVFGPEVTAGRTLLGLF
FT                   TRRPEVMHGLMAGFPGAFGLFTRIIDGRSTVARQLARPGVTRTVAALSRQRNQRPDPGP
FT                   APTP"
FT   gene            complement(129406..134013)
FT                   /locus_tag="FraEuI1c_0109"
FT   CDS_pept        complement(129406..134013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6717 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78197"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6717"
FT                   /protein_id="ADP78197.1"
FT                   /translation="MRDDADIDAGNGYPPSSRYTAPPRVDVARAPAGAGPLGPTALPFA
FT                   DGYLGRAAAGEPMTGPDDPPGYGAPYDRPPGAGRLLGVGAPPRPSVPPPPPPIPPPGGE
FT                   NPRPGASRRGPAGFAEQAGPPGRRPAPGGTGWRAASPVGPQSFADPAGGGRPPGRAYGD
FT                   PASNGAANPNGHPGLNGYADPSGYANPNGNGGPNGGYGGPNSHDPLGYPSPSGQGGPSS
FT                   HDPLGLSGLNGYAGPPNGRAAANGQAGSNGYAGSNGHGAPTGHGSQNGYTAQNGYGGPD
FT                   GYTGQNGYGSQNGYGAQNGYGGSDGYGGQSGPGGQGQPGRHRLAGGPGSPGPGLQPGTP
FT                   GPTGRGSDDRGAGRGPGSHGAPGPTGRADGPGWRPAGTDIDVSGPRPAQPRPVPQQPTA
FT                   SPGASRSGFGAGSTPSAPPSDGFGPYGARPGPPAGPPPNASPWPSDSWNRPGPPAPPPP
FT                   PPPAAAARPAQAPAGRPAAPSDQTGFRAQSQGRDGFDAGFSVDSPAARPANGMPNGWSV
FT                   GAPEHPATRLAALTSAPPAPGRPLPGAGVPPPGPPAAVGVGEPADHRQNGYPGGRPATV
FT                   PGPPASWDPLAPSGARPPAELTPARLPMDPFATRAAAAPAPGGQDAFGQTGRPGPDPFG
FT                   RDGRAGSDPFGPTGAQRSAPAPNGAANPARPAAPSPNDPFGVTGYGTAPAATASGPADP
FT                   WSTANSAWAPPPAPAQPSWLLTGLSVENPNAPAAPAPTAGHRGTPTAVAGPGSGPGRAG
FT                   GYPGAAGGTPSSAAQRPGDPFVLGGPAQPRPVAAGINVDGGPVAGRGPTGTNGPGGTAN
FT                   GFLVNGQNPGAGNGQLTAAGGPGHGHPTRNGSAFPQGAGPGRAPANGSHLGAGIAVGGG
FT                   PVPDRPGAAPAGPWIVEGSADQRSPGGQPAQRLAAGQQAQSGQHLAAGQRFATGQHLAA
FT                   GHQQAGQQRPGVDPRGAAQPAGAQPPAPVGPPTQAFDPLFGDLPFGPGAAPSDAFPGAL
FT                   TGQRPASQPAGQPGGPLGVPGGPPMPAGVPGGPTAGPSGPRPAAPGAAGPGYPARPPMP
FT                   PPGTPGPPMMPGAPTAFAPLHDRQPDFQPSTQFPAPAPSPLPVPPSATAQRPMAPADGR
FT                   APMPPRPPAAPPGFADPRRGANAYLPTSPDPVGRSETGRGQAPPARQRPGRDDLDLFDV
FT                   SSAPSAIQPAGPPPRRRNTSSDPGRSGLDISGPGRSNGRHATGHPNAALYSDALLGPAQ
FT                   ETAARGWRKVVYQVSGGAVNPGPSPDEARHNRLLGHIRTPLTDCHRIAVMSLKGGVGKT
FT                   TTTIGLGSTLADLRDDRVVAIDANPDRGTLGTKAQQPSPFTVRDLLEDSHRLSRYVDIR
FT                   NYMARSDSRLDVLASADDPEISEAFADSDYHAVDDLLQRYYSILLTDCGTGMLHSAMGG
FT                   VLALADTLVIVTSSSADGGTSASATLDWLDAHGYAAQVRDAVAVISMFPQNGDDVDVDA
FT                   LEAHFAARTRRVVRVPWDPHLATGGRISLHALKRETRRAYQELAAAVAERFAPPELDDL
FT                   SYPGVNPYRDDRLFS"
FT   gene            complement(134307..135869)
FT                   /locus_tag="FraEuI1c_0110"
FT   CDS_pept        complement(134307..135869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0110"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   sna:Snas_6460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78198"
FT                   /db_xref="GOA:E3J3J6"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J6"
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /protein_id="ADP78198.1"
FT                   /translation="MSGPAPAAAGRVGWLDLSCGVSGDMLLGALVDAGVPLAVPAAAID
FT                   TLGLPIRLEARQVRRSGLAATKVDVIAPDGGHSRTWADIRELLAAAPLADATRDLATAT
FT                   FAALAAAEARVHGIDPAEVHFHEVGALDAIADIVGVSAGFAHLALAGLVATPIALGGGR
FT                   ARTAHGVLPIPGPAVLELLRAAGAPALGGPVAVELCTPTGAALVVTVASGFGDLPAVRV
FT                   TAVGCGAGTRDLPGRPNLVRLVVGDALDATAVPPPVPRPQHAAHDHLAHDHQLAHDRQL
FT                   AHDHAGHRHAEAEPHRHDPRPDRATGDANAQGAGQPTAVAGIDVADGVAVTAELVLEAN
FT                   VDDLDPRVWPSVLAALLAAGAADAWLTPILMKKGRPAHTLRALVAPGRLPAVRAAIFRH
FT                   TSTLGLREIPVRKHALARSMRAVEVAGHPVRVKVSPGPDRAFDQPAGPVPVAQPEWEDV
FT                   ALVAEKLGWPAREVLAAACALAYAGQWSDLPPTADGPDDHQHGTEPAGQGTGDQGVDPG
FT                   HAP"
FT   gene            complement(135866..136780)
FT                   /locus_tag="FraEuI1c_0111"
FT   CDS_pept        complement(135866..136780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0111"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: gob:Gobs_1560
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78199"
FT                   /db_xref="GOA:E3J3J7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J7"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADP78199.1"
FT                   /translation="MDTDQLRALLTDVAAGRVDTDTALARLAAGPLGDGAGFVDLGYAR
FT                   VDTHRGVRTGDPEVVFAAGKTAAETVGIVAALRAASTGDGRPTLVTRANRETVDALVAR
FT                   WPDADVTGRWSPDPAADPRPAGDAGRLATVAVGALPPARGRVVVVCAGTSDAPVADEAA
FT                   LTVAASGAGVEVLRDVGVAGLHRLLAVRDVLAAADCLVVVAGMEGALPSVIGGLVGVPL
FT                   VAVPTSVGYGAAFGGLAALLGMLTACAPGIAVCNIDNGFGAGLFAARVARAAAGASPES
FT                   ASAAATSPGAGLRAAAAGSAGYR"
FT   gene            complement(136884..137864)
FT                   /locus_tag="FraEuI1c_0112"
FT   CDS_pept        complement(136884..137864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0112"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="KEGG: fal:FRAAL6715 hypothetical protein; manually
FT                   curated; PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78200"
FT                   /db_xref="GOA:E3J3J8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J8"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADP78200.1"
FT                   /translation="MTSGRPRDEPDDQRDRATPRDTGRPAGEGGGRFTAAASRRALAAV
FT                   CAAAGLDDTGAIALKLTVNSVYRLPRAGAVVRIATSGAMAFRVPKVVQVARWLAAEGVP
FT                   AVRLMPGTPAPVRVGETLATVWVDVGPGVEPPPDTADLGAVLSRLHALERPRPALPRWD
FT                   PLGDVRRRMSDAEALAPDDRAFLEDLTAEVAAGLRTIRYRLGTTVLHGDAHLGNLIRGA
FT                   SGQVVACDFDSVCLGPAEWDLVPVAVGVLRFGHPPAGQELLAAAYGFDVTRWDGFEVLR
FT                   AVRELKLATSVLPILASSPTVAAQFRVRLDSLRRGDRDARWSLYR"
FT   gene            complement(137861..139621)
FT                   /locus_tag="FraEuI1c_0113"
FT   CDS_pept        complement(137861..139621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6714"
FT                   /protein_id="ADP78201.1"
FT                   /translation="MPPATGGLPQEPSDDSDDAGHTPADDTTAERPAADGRGIVIPPAR
FT                   RSPDDYPADYPRLTGRHERAHAARGPGDRAPGDRAASGQATGAHPVPIRPASPLLATAA
FT                   LFTTPPAATRPAGRASVDRVVDLPAKPRPLDTGRPVRAAEAAFAAGGTGALIGVGQPVG
FT                   KETTAKTTPSPPAASCGADDSGTGTSDRRQFHRIAGAVIGALLIEGQILEVSGMLAASP
FT                   VQLALDRAEHILTQALGAHEIIPPAHILAQTARLHRGLERLARRRMPDSQWRRLRLLAG
FT                   RVAVLRADAAFKQGNVTAARVLTAQGYAAGLAAGDGPLCGSAREVGAVTEFYDGRPDEA
FT                   LRLARDGQRHVGSGPVRARLVCQEARALAALGDVQGAAKALDQAYDLADQISPDRWGRP
FT                   GPSFDEFNPVEVAYNATTALCLLGRPRTAEQHAELALPKLDAMDAPGFRSVIRLDLSLA
FT                   LARAGRLELERVCHLASEAIQISWGRTVSSVSSRADQLLEATRVHGEVPEVRDLAALVR
FT                   EWQRSAAQQSPAAGLATTQLSTGQLAGAAIVAAGGVTLAKAAGRTTKAATKMITSGDTE
FT                   PGLTHPEASD"
FT   gene            140268..141185
FT                   /locus_tag="FraEuI1c_0114"
FT   CDS_pept        140268..141185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0114"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6711 GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78202"
FT                   /db_xref="GOA:E3J3K0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78202.1"
FT                   /translation="MSWRGEPGTDPLVGPRRFTDQAVDPAVARISGFTDRTALTRELEE
FT                   LAFRGWSALRTERVDGWVLRDSEGATRRGNSVWPHDDVADLPEALARVDRFYGRAGRPA
FT                   FVQLTPASRPSGLRQALDVAGYEPEQGPTDVCVAGLAGIVAGVAGLAERAAPPAGRARG
FT                   PVRVALAETPDDGWLDVCAAGGMSMFGQHRAASVAVLRRIETPAIYVTATVDGVPVGAG
FT                   RGVADGDWLGIYSMATLPAARGQGAATTVMAALSTWATSVGARRALLQVEEQSTAARRI
FT                   YAALGFLPVYRYTYRRRATGPAAP"
FT   gene            141182..142048
FT                   /locus_tag="FraEuI1c_0115"
FT   CDS_pept        141182..142048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0115"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   fal:FRAAL6710 7,8-dihydropteroate synthase (partial match);
FT                   PFAM: dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78203"
FT                   /db_xref="GOA:E3J3K1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K1"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADP78203.1"
FT                   /translation="MTVDAMARLLAAGPTRVMGIVNVTPDSFSDGGTFAEPSDAVRAGL
FT                   RMVADGADIVDVGGESTRPGAARVDAAEERRRVVPVIERLVAAGVTVSVDTTRAAVAAA
FT                   ALDAGAVLVNDVSAAADPDLLALCAERDAYYVLMHARGESIDMAKRAHYGDVVADVVAE
FT                   LRERLAAVYAAGVRPDRVILDPGIGFAKRFEHNWSLLAQVGAFAELGRPLLVGTSRKSF
FT                   LGALLAAPDGTPRPVEQREDATQATTTLLAAEGVWAVRVHAVRPAVDAVRVVGAWRRAR
FT                   GWPRETG"
FT   gene            142212..142628
FT                   /locus_tag="FraEuI1c_0116"
FT   CDS_pept        142212..142628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0116"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="SMART: dihydroneopterin aldolase; TIGRFAM:
FT                   dihydroneopterin aldolase; KEGG: fal:FRAAL6709
FT                   dihydroneopterin aldolase (DhnA); PFAM: dihydroneopterin
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78204"
FT                   /db_xref="GOA:E3J3K2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K2"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADP78204.1"
FT                   /translation="MGFERVAERVATAAPAGEIRDRITLRGLRVRGRHGVLAAERELGQ
FT                   EFVVDVTLWLDTAPAAATDDVTQTVHYGELAEALAAVVGGEPVDLLETLVARLADVCLA
FT                   DKRVARAEVTVHKPAAPIPLPFADVAVTIVRDQS"
FT   gene            142625..143191
FT                   /locus_tag="FraEuI1c_0117"
FT   CDS_pept        142625..143191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0117"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: fal:FRAAL6708
FT                   hydroxymethyldihydropteridine pyrophosphokinase (partial
FT                   match); PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78205"
FT                   /db_xref="GOA:E3J3K3"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K3"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADP78205.1"
FT                   /translation="MTGQPADPAQPSAAGGSGHAVLALGSNLGDRAATLRAAVALLEKR
FT                   LGVLAVSPVYETVPVGGPPQDDYLNAVVLTRPAPVRELLAAAREAEQAAERVRTIRWGP
FT                   RTLDVDVIACGDVTSDDPEIIVPHPRAHLRAFVCVPWLDVDPDATIPGYGSVAALVAGL
FT                   AAAGETAGLRRAGTATDLAAAAGLG"
FT   gene            143188..143622
FT                   /locus_tag="FraEuI1c_0118"
FT   CDS_pept        143188..143622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0118"
FT                   /product="Protein of unknown function DUF3180"
FT                   /note="PFAM: Protein of unknown function DUF3180; KEGG:
FT                   fal:FRAAL6707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78206"
FT                   /db_xref="GOA:E3J3K4"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K4"
FT                   /inference="protein motif:PFAM:PF11377"
FT                   /protein_id="ADP78206.1"
FT                   /translation="MRPTRARELAAAVLVAGVLAYLLLVWTYRTLPQLPRTGPLSVFVI
FT                   AVLELQTASITRRRLAGRPGTKPIMPITVARLAVLAKASSLTAAVMAGGWAALLAYTTA
FT                   HLNTYGTAGADLITAGLGLGSAVALAVAALLLERVCRVRR"
FT   gene            143686..146229
FT                   /locus_tag="FraEuI1c_0119"
FT   CDS_pept        143686..146229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78207"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6704"
FT                   /protein_id="ADP78207.1"
FT                   /translation="MSSPALEPDGEPATLPAWLRARSDDELTRLFELRPDLATPPPPDF
FT                   DILAARLEIRVSVLRALDTLDTFALEVGAVLTLLPCPVSVGRLAELCGGLDVRSAVAAL
FT                   RARGLVWGDGDQLRLVGTAADLLGDRALGLGRAARDCLAAYRVPQLARLATALGVTRAG
FT                   RIAPAGRVAPAVAAGQERGAAVAKETLVAEVAERLGDPAVVRGLAAECSPAAGRILARL
FT                   AEGPARGATAEAGRLLAVSAARTPVEELLARGLLVGVDADEVEMPREVGLALRGDRPTG
FT                   TLHPAPPQLTGRQVAAASVDPAAALAAETVVRHVATLLQAWGTSPIVPLRTGGLSVRDL
FT                   RAVARLLEIPEPEAAFVVELAASAGLVDTTSGVDVRIVPTTAFDRWSVDLTAHRWALLV
FT                   EGWVRSASVASLVGDRDERGRQVSALSVDVRRSAAPATRAEVLAALAAAPDGVAPSPAD
FT                   VRALLTWRAPRRGGALQELLVDATLQEAELLGLTGRGAAATTGRLLAELLVESAGALGP
FT                   APIGAGLTAKPGSFVDALADALAPLLPEPVDELLLQADLTAVAPGPLVADVAAELARLA
FT                   DIESTGAATVYRFSEESLRRALDAGASPGDIHDLLARLGRGGVPQALTYLVDDTARRHG
FT                   RLRSGPAESYLRCDDTALLSEVVASRRTQTLGLRRIAPTVVISRLPVAELLDGLRAAGF
FT                   APAAEGPDGRVVVSRPETHRTPARARSAAADPAAVRRGQLRDAVKLVRRGDESARALRL
FT                   AGGAATTFGNSAVEGLVRSAPLILVRLQAAVRERSRVLLGYVDQQGTPSDRVVRPTALD
FT                   GGWLTAWDETAAAPRRFVLHRVTAVADVVDPFASA"
FT   gene            complement(147685..148392)
FT                   /locus_tag="FraEuI1c_0120"
FT   CDS_pept        complement(147685..148392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0120"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: saq:Sare_2570 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78208"
FT                   /db_xref="GOA:E3J3K6"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K6"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADP78208.1"
FT                   /translation="MTRPYVVLSCATSIDGYIDDASETRLRLSNEADFDRVDEVRAGCD
FT                   AILVGAGTIRADDPKLLIRSPARRRARMSRGLPSHPLKVTLTATGDLDPSARFFTAGDP
FT                   DGTDGAGQVVYTATDAAARARARLGAVATVVEAGDPIDLPTVLADLATRGVARLLVEGG
FT                   GAVHTQFLTEDLADELHLVVAPFFVGDPRAPRFVGPGTFPHDPTHPARLAETTQLGDVV
FT                   LLRYALSPRYPGA"
FT   gene            148528..150165
FT                   /locus_tag="FraEuI1c_0121"
FT   CDS_pept        148528..150165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0121"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: fal:FRAAL6703 ATP-dependent DNA helicase;
FT                   PFAM: helicase domain protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78209"
FT                   /db_xref="GOA:E3J3K7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K7"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADP78209.1"
FT                   /translation="MADGPLIVQSDKTLLLEVDHPQAKLARAAIAPFAELERSPEHIHT
FT                   YRVTPLALWNARAAGHDAEQVVDALVTYSRYAVPNALLVDVADTMDRYGRLRLENDPVY
FT                   GLVLRAIDRAVLVEVSRAKRIAPMLGNKIDDDTIAVHPSERGRLKQALLKLGWPAEDMA
FT                   GYVDGEAHAIELRQDGWELRDYQKGAVAGFWEGGSGVVVLPSGAGKTIVGAAAMAQASS
FT                   TTLILVTNTVAGRQWRSELLRRTSLTEDEIGEYSGERKEIRPVTIATYQVMTARRGGEY
FT                   LHLSLFGARDWGLIVYDEVHLLPAPVFRMTADIQSRRRLGLTATLVREDGREGDVFSLI
FT                   GPKRFDAPWREIEAQGWIAPAECTEVRVTLTEDERMSYAVAEADERYRMCATALSKHGV
FT                   VERLVRKHSGDRVLVIGAYLDQLDALGRSLDAPVIQGSTRNKERERLFEAFRTGEIKTL
FT                   VVSKVANVSIDLPEAGVAIQVSGTFGSRQEEAQRLGRVLRPKADGRSAHFYTVVSRDTL
FT                   DQEYAAHRQRFLAEQGYAYTIVDAVDIA"
FT   gene            150740..151636
FT                   /locus_tag="FraEuI1c_0122"
FT   CDS_pept        150740..151636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0122"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fal:FRAAL6118 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78210"
FT                   /db_xref="GOA:E3J3K8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78210.1"
FT                   /translation="MSTTMPKFILREPTISIVIPTLNEAKNLPHVFEKLPGDAEIVLVD
FT                   GRSTDGTIDAARSLRADVVVVHQTRKGKGNALACGFAAATGDIIVMLDADGSADAKEIE
FT                   AFTKALKAGAHFAKGSRFMPGGGSEDITRIRRIGNRFLSFLVNSLFRCRYSDLCYGYNA
FT                   FWRTCLPVLGLDAGTPAREGDSAERRWGDGFEIETMINLRVAKAGLQVIEVPSFEYSRI
FT                   HGVSNLNAISDGLRVLRTIVSERRRSRAPLAIEATLPAQTLPAGVTPIGPSERDPGAGI
FT                   IRQRERADGESKSVGMA"
FT   gene            151747..152751
FT                   /locus_tag="FraEuI1c_0123"
FT   CDS_pept        151747..152751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0123"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; KEGG: kfl:Kfla_2567 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78211"
FT                   /db_xref="GOA:E3J3K9"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K9"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ADP78211.1"
FT                   /translation="MTVELRSSVGAAGARILGVGAYRPPRVVPNSEISEAIDSSDEWIV
FT                   SRSGIRSRRFAGADEPLGSMAAGAAGKAMAHAGISAADLGCVLVATMSNVVQSPSLATD
FT                   VAARLGAEGVAAFDVSAACAGFSYALAMANDMIRAGSARYVVVVGAERMTDIIDPYDRG
FT                   TAFLFGDGAGAVVVGPSDTAGIGPVVWGSDASKRDVIGHDSSYLEWRESPERPWPVMRM
FT                   DGPQVFRWASWQMAPVAQRALAAAGIEASDLAAFIPHQANIRIIDTMCRVLKLPKSVVV
FT                   ARDIATTGNTSGASIPLAMEDLLARQLAPSGGLALLVGFGAGLVYAAQVVRLP"
FT   gene            complement(152842..153240)
FT                   /locus_tag="FraEuI1c_0124"
FT   CDS_pept        complement(152842..153240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tetratricopeptide domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78212"
FT                   /db_xref="GOA:E3J3L0"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3L0"
FT                   /inference="similar to AA sequence:KEGG:Tbis_2379"
FT                   /protein_id="ADP78212.1"
FT                   /translation="MKMWRPGSADPDGSANRWALSHRARLIAAIVAALMVVGALSAWFA
FT                   TERAAAARKNRQAVLCEVADVIVATPSYPELEKFLAVEWRFLTGTAAGTHDAAFSKLVA
FT                   GLPPRPDPAAVKPVAAYCHAHGMGIVTN"
FT   gene            complement(153237..154211)
FT                   /locus_tag="FraEuI1c_0125"
FT   CDS_pept        complement(153237..154211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0125"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   fal:FRAAL5881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78213"
FT                   /db_xref="GOA:E3J4P4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADP78213.1"
FT                   /translation="MAVVTKVLVVLAWVAAAGLAVAVLGRLTHLDDVLWPYVLVNALTP
FT                   VLFLPAYPAFAVGVATHRYALAAVALVAVVAHLVWLWPEVRPGSASAAPAGSAQFRLLT
FT                   TNLEMDNGRAGTLGRQIRADSPDVVVVEELSNVTYYGLMKSGALAGYHYSASRPQFGAF
FT                   GAGVWSRYPLSDVAAPLVGGLDSLRVTVTLPTGQRFRLFAVHTLSPQSSSNVRVWRTQL
FT                   ADLRREVRATTLPVVLAGDFNATRDMRPFRNVLAAGVTDAHDDVHAGWAPTWNAHFPIL
FT                   PPVWRLDHVLISPQFTATGLRVGKSYGSDHLPLVADLALRPSS"
FT   sig_peptide     complement(154143..154211)
FT                   /locus_tag="FraEuI1c_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.758 at
FT                   residue 23"
FT   gene            complement(154276..155301)
FT                   /locus_tag="FraEuI1c_0126"
FT   CDS_pept        complement(154276..155301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0126"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fal:FRAAL6119 putative succinoglycan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78214"
FT                   /db_xref="GOA:E3J4P5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78214.1"
FT                   /translation="MAFDETKPGDASGTAGNEYKSAGTSTTRLPSSAETVTASVVICAY
FT                   TLRRWDDLTAAVASVRAQSVTASDIIVVIDHNEELLERSLSSFSDAVVVPNAGKPGLSG
FT                   ARNTGVERATGDVVFFLDDDARAQPDWLAHMLAHYADPAVQGVGGAALPRWPEQGARSG
FT                   RPSWFPPEFDWVIGCSYIGLPTSVGPVRNPIGAGMSIRRSAFATVGGFSDGLGRVGSIP
FT                   LGCEETEFGIRLRRDVADAVILYEPAAVVLHGVTPDRITWRYYRRRCFSEGISKAVVAR
FT                   RVGQESALEAEKAYVRHVLPRAVRRDLRHPRTWGRAAMVLVGVLFTVAGYGRGAIARAT
FT                   P"
FT   gene            155915..157669
FT                   /locus_tag="FraEuI1c_0127"
FT   CDS_pept        155915..157669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0127"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; GMC oxidoreductase;
FT                   KEGG: mes:Meso_2585 glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78215"
FT                   /db_xref="GOA:E3J4P6"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P6"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADP78215.1"
FT                   /translation="MTVFDLDKLPPDTELTTEVCIVGSGPAGATLAAELAGSSLRVLVV
FT                   ESGGREPEAAVAALNEVENVGAARVADQALMRTRALGGTSRIWTGRCGELDEIDYADRP
FT                   WVAHSGWPVTGSELRPFLDRARPYLGLGPNLYDERLWAVLGRRPARPPLPEARLVPRFW
FT                   QFSRGVTDPAGPTRFGLDVLPDAVGDDAVDEPRGLAGAGNVNVLLHATVTHIDTDDTGA
FT                   VVRGVEVASTSGRQARIRAAVVVLAAGGIENARLMLASNRVVPHGVGNGNDLVGRFLMD
FT                   HPGSVIASVDPGSARRLRDRFGRYWLDGPDGRQVYLHGVGLSPKAQRDAELLNCAAFLE
FT                   EYPAPGDPWHAGQRLASRLRGGGGPAQDEVALASFWRREDEVPEPTAVRDALTLARNAP
FT                   ALATGAYRMTRRHRPPIFQASRVDLYCLVEQEPDPSSRVTLSDRVDGLGVPLSRVDWRV
FT                   SERERTSIGRLAGLLAQELGSLGYASPEPAVWLKGGDAWRENVIDRAHPIGTTRMADDP
FT                   RAGVVDRNCQVHDTEGLFVAGSSTFPTAGHVNPTLTIVALAIRLADHLKARGRADQLAW
FT                   APSPSVSS"
FT   gene            157757..159103
FT                   /locus_tag="FraEuI1c_0128"
FT   CDS_pept        157757..159103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78216"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P7"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0438"
FT                   /protein_id="ADP78216.1"
FT                   /translation="MAKSRLIGRPGEARGIPISGRDLICLHMRTVAYLGPIEAPSPEQV
FT                   RGALRRLAELLPAHRILRRVDRAAPRWVTVPAAELPGHCDAMVIDMTDTTAASATSVPA
FT                   TAATAATPETIVARLYNWPVTDLPFQIAVGADFCALLVDHACIDGLSINEIWPELIRCA
FT                   VTGEYPVSIAKPSIRFPLIRALDNYYRRKPKRLVETVRVPHPTPPADATEPGPLVPWHQ
FT                   EFGVVSVRFGKDVLAEIRSWRLANAKGITRTMVLFAAARAALETSDLPPVRPGVNISVD
FT                   MRKFLPQGAVLYGNFAPSIYVCPADGCDPAQLNAVIDEVMSVARPLATMALVASTAKRR
FT                   FKRTAQPPTLAEATARPALSLIHCGRLKAFEKLPWTGSPADRRYVIGSTPGDPDGISVF
FT                   ISEIHGGVDVTATFNVSTFDPAVVRGALEILATEPTRALDARRQVPSAR"
FT   gene            complement(159218..162343)
FT                   /locus_tag="FraEuI1c_0129"
FT   CDS_pept        complement(159218..162343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78217"
FT                   /db_xref="GOA:E3J4P8"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P8"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05770"
FT                   /protein_id="ADP78217.1"
FT                   /translation="MPPADNEPTVRVEIPPAPLGGDERPAARKPSTGQEQTTRVKRPQV
FT                   TTDRAAPGAGKPTTTATEDSAATAEANPPKAHNQDKPTTASDRRPPVAATPPRRPATSR
FT                   TVPPAAGDEPAPAAEKAKAELRPTDGQQPAAPSETKPAAPADTKATTPVSERPAASADT
FT                   KPAAPVDRKATAPADRKPATPGGRRPAAPAAEEPTTRIDRRPAADAGTKRPAPADPRPA
FT                   TPAIRTPPAPVGARPAAPGGERPPAPAATKPATPVETKPPAAEAPTAPPDAGTPAGTGE
FT                   SQLLPEYVTRLRPLLKPPPAAVPEPAPAGSRIQRIRDALADVLWWNSAYQPADPERAAE
FT                   TLHGRLLLSGASLLSFTVGVLSVAAGLTHLRIAALLVFCLIGIGSAPWALDTRMRLTTR
FT                   MAMTTLVSFSVLTFVATFMLSLGRWHPALAFTLVSLICVPLHWIGFRRAVVERRDARPA
FT                   VDLTPLRDGTWNDVVDRLRLREFSALYCAVAGAVLCMYAALRHRHIVDPGVYGYLTHVG
FT                   PAWYLGLALIVVAIVIAPRADERVMAAVVLLLVVAVLLTPSLVYDAPRQPSATKHVDLV
FT                   QQIRHAHHLDALVLVYNGWAGMFAAMAWLCDITGIREPMGLATFWPPLIGFFKVLALRY
FT                   FAGKVLPTAYQAWIAVILGVLADTIGADYFSPQSVGYVIGLVAFGLALSHRRSVQRTLL
FT                   LVSAGLLISVTHQLSPYIVGGALVILVVFRQIRPWWTPVTVLGPAAAWALLHWSQVKGF
FT                   INLHDIGSSQNFHPPKTAGAVGLVRQPIVGETVHALMLGVGLIGLIGGLAVLRNRRTGA
FT                   VWAYACCPAVGLVVVAVNPYGNEGIFRAILFALPWLSVLAARMFTSKRRLLPRIPLLAV
FT                   MATMTATFLVAAFGLDDINVVRWSDLNTLRYFQTVGYSNSPANAYYVLQLGAGDLPASI
FT                   PTRTNSHRPLKIEDLQDAQAANVDLPPATRMRILTSRLITYSGEPASQARIYTIWSPVS
FT                   SEYGYDYGVETPAEFAELRDAFAAAPYWSIAKDLDGTVLFKFEPARYPVPTP"
FT   gene            complement(163300..164640)
FT                   /locus_tag="FraEuI1c_0130"
FT   CDS_pept        complement(163300..164640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0130"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG: glycoside
FT                   hydrolase family 16"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78218"
FT                   /db_xref="GOA:E3J4P9"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P9"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADP78218.1"
FT                   /translation="MFTSVGVLAVVALGVGIGLSRAGNLSASPMPAYASLVGDFTCITS
FT                   TDGSCAVAPGLNATPDQLTVEAWAQDGGSDTKVPVVATNVGAYGFVLRANGPDGAPVER
FT                   RRIHGSYVAWFHCASNAGPPCKHQRGGGHTAGGTATALPTEQSTDPATTPDDSTTSPVP
FT                   GPTSTVLPSSVPTSPAGIPQPGQSTPAVVHTAPTVTTAPATTAPAPANGAALQWADEFD
FT                   GAAGTGVNKADWTAVSGSHHGELECYTPKSSNVAMDGKGDLVLTARREAGCDGMPYTSG
FT                   RLEGVNKRTFKYGYFEVRARMPTTTGAFPAFWTLGANYPSVGWPRSGEIDIVEITANLP
FT                   SSVHTNIHGVDASGKSWQSGWGGVGTFASSSNVGDSFHTYGLNWTSTALQFYFDGKLIH
FT                   TINKSSVPVWLWDQENYLLLNLAITSSSGPDVQTMDVDYVRVYSTKP"
FT   gene            165487..166776
FT                   /locus_tag="FraEuI1c_0131"
FT   CDS_pept        165487..166776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0131"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; Di-glucose
FT                   binding within endoplasmic reticulum; KEGG: aau:AAur_0779
FT                   putative beta-1,3-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78219"
FT                   /db_xref="GOA:E3J4Q0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR021720"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q0"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADP78219.1"
FT                   /translation="MRVAALAVLVLTVAGPLAGCGLTHSGSSTARPSGPAERWVAGSVG
FT                   ITDSRGTTWQPDVSVAQGGQVTTPGSAVAGTGNPALYRKARVGGQGYELPVARPGTYAV
FT                   VLHVLAPQDVRAGQNVFDITVDGRTVISAIDVAARVGAGHALAVLVPVTETGDSIDLGL
FT                   RVRHGEARVSAVSVAFESTAAARTTFADDFTGPAGATVDSRWTFETGGGGWGNNELGVY
FT                   TSSTRNVSLDGKGNLAITARRENIRDTDGKTYQYTSGRLTTKRSFDLRYGHVETRLKLP
FT                   TGGGLLPAFWAVGSNVDNVGWPVSGEIDMLELPAPDGSIYASIHGPTQSDAAYAHVAGI
FT                   YPLPPESVAGFHTFAMDWYPGVFQFSVDGMVYGSVSEDDMPSGQTWVFDHPYYLIFNLA
FT                   VGGNWPGSPPAGTPFPQQMVVDYVRVTGHN"
FT   sig_peptide     165487..165579
FT                   /locus_tag="FraEuI1c_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.558 at
FT                   residue 31"
FT   gene            167364..170147
FT                   /locus_tag="FraEuI1c_0132"
FT   CDS_pept        167364..170147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0132"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gob:Gobs_0428 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78220"
FT                   /db_xref="GOA:E3J4Q1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q1"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78220.1"
FT                   /translation="MTRPTLDGSEQAAAVPGQTTDTVRPESTWCGEVELSSPDLPSLPR
FT                   TADGRLFEDARVLIRVHGDPVGYVQLPLAEGRLDAAEVLRQAVDQFGPSIRGHLAAEGL
FT                   EDADLSPAPAATARCSLATPRATRRRSAAAVPVQPAVTVVVCTRNRPETLLVCLDRLRR
FT                   LRHPNIEIVIVDNAPSDESTKVAFTSAVADLPHFRYVREERPGLSWARNRGVAEARGEI
FT                   IAFTDDDVAVDEAWIAGILRGFAQADDIGCVTGLVATASLTEVAERYFDSRLNWSASCA
FT                   ARRYDLVDHREPSPVYPFSAGIFGAGANIAFRRTALASIGEFDTALGAGTAAAGGEDLD
FT                   IFLRVLLAGYAIYYEPASLVWHTHRSSVDELNRQMFAYGSGMAAYLTKHLTDPTIARRL
FT                   MARVPRGLWEMRKISTDSQGAAGSDDALQRRLLAWELAGYAAGPALYAKSRRRSAGLGG
FT                   SRPATTVVAPDLLGAAALPETAEPSAGSPTGLICGELELAGPRVRLPAGEHDGAYGRAR
FT                   LLVRVHGEPVGYVELPLAADGDGPVAVDVTQAVSLAVETLGGPIRQHLADDGVTLPAAP
FT                   DPGVVVKAVRSGAPHRPCRRLAGAAPRISVVVCTRNRPGLLTACLDGLLGLRYENFEVV
FT                   VVDNAPTDDGTRVAFTAAVGTDERFRYVVEPVPGLSSARNRGLAEASGEIIAYTDDDVR
FT                   VDADWLLGIARGFARRDDVACVTGLVGSADLATDIEQYFDAKVSWSTSCAPRVYDMDPA
FT                   NAPGPLHPFTAGVFGTGANLALRTETVRALGGFDTALGAGTKTRGGEDLDIFVRILLDG
FT                   HALAYEPAALVWHSHRSDLTELSRQMFGYGSGLTAYIVKYLVDPATCRRVVAGIPGGVR
FT                   HARQLGSRTREIPTAPKPEIMRRLRTREMAGMLAGPVLYLQARRRSARASARGAQQ"
FT   gene            170144..171541
FT                   /locus_tag="FraEuI1c_0133"
FT   CDS_pept        170144..171541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0133"
FT                   /product="membrane protein involved in the export of
FT                   O-antigen and teichoic acid-like protein"
FT                   /note="KEGG: membrane protein involved in the export of
FT                   O-antigen and teichoic acid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78221"
FT                   /db_xref="GOA:E3J4Q2"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q2"
FT                   /inference="similar to AA sequence:KEGG:Trad_0522"
FT                   /protein_id="ADP78221.1"
FT                   /translation="MTSVTDEAAAVAGAEQPRRKMSMLYRNGLAGVANSVLSALLGAGF
FT                   WVIAARESSTAAVGVGTALVSALMALATLSQMSLGGALSAYLPGAGEHQRALVLRSYGM
FT                   AVLISVVLGGAFAVAAPRFDHSFHVLAPVGAAIGFTLSVTVWAIFSLQDLVVTSLRKAI
FT                   WLPLENTTYSLTKFVVLVAMGSGTTALMLLSAWVVPAAIATVVVSSIVFGKLLNKRDPG
FT                   AEPAALTEAPQLEGYRRFLAGTTLALIFEQLAVTLLPVFIVAGLGTEKGAEFGIAWMLI
FT                   QALDQFPMILGFSMTVEGAQPGADVRPIHRTLRKRTLAGMGGLVVVGILAAPIITTIFG
FT                   GAYRHGSTTVLQLLLIGSLGRAVNSLALCAALARRRLAPLIGIHGAIAVMVPIGALILG
FT                   RWWGLVGVGIAWSVAQSVVALGVLVAERREERSERVDTPPGLRRPAAIEANIETTMRLT
FT                   PIQRRSR"
FT   gene            171868..172953
FT                   /locus_tag="FraEuI1c_0134"
FT   CDS_pept        171868..172953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0134"
FT                   /product="Scramblase family protein"
FT                   /note="PFAM: Scramblase family protein; Protein of unknown
FT                   function DUF2510; KEGG: fal:FRAAL4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78222"
FT                   /db_xref="GOA:E3J4Q3"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q3"
FT                   /inference="protein motif:PFAM:PF03803"
FT                   /protein_id="ADP78222.1"
FT                   /translation="MSQNSPVPGWYPDPSGAPGTRWWDGVQWTGHTQAPPTQPPAAPVP
FT                   QQQPTPAPAPQQPAAPVLYQKPPQPQGAFQPAGAPPQQQPGGFPPGPGPQGPGWQQGPQ
FT                   GHPGPQGHPGAPGQPGAPGWGTAQGNFPPAPVHTGFTPDKIQEQVQQRAGVAPSGPGGG
FT                   TIFTEPVLVVNQKTQFIEVTNQYAIFDQGGRQIGSVVEVGQSTAKKVARVLTSLDQYMT
FT                   HKLEVRDPAGNVMLVLTRPAKLVKSKVVVTRPDGSEIGQIVQQNAIGKIRFGLMVGGQQ
FT                   IGLIKAENWRAWNFSIVDHAEVEVARITKTWEGLLKTMFTTADNYVVQLHFQLPDPLLS
FT                   LVIASALTVDTALKQDSRGWN"
FT   gene            173091..173801
FT                   /locus_tag="FraEuI1c_0135"
FT   CDS_pept        173091..173801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0135"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   fal:FRAAL6702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78223"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q4"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADP78223.1"
FT                   /translation="MTPTSGPPEARKKNLFAPPPAGAVTQPSRRRLPTVALPAPPVTVA
FT                   ALDAIDADDGRVELLDGLCVLRPWPTPLRTRVTQRLAELLTAAAPSGAHVFPHGLRVEI
FT                   SARTLVIPDLVVGPVPTPTGPPADADPSATPSPAATTPARITEPPFLVIEVADEHTRRY
FT                   NRTLKLDLYRDRGIPSCWLVDPDPAGRTVTIEIYDLVDGGYVRAGQASEATPLSVTRPF
FT                   PVTFIPADLVDPGD"
FT   gene            complement(174270..175889)
FT                   /locus_tag="FraEuI1c_0136"
FT   CDS_pept        complement(174270..175889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0136"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: fal:FRAAL6701 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78224"
FT                   /db_xref="GOA:E3J4Q5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q5"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADP78224.1"
FT                   /translation="MPKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGV
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTNDVAGDGTTTATILAQALVREGLR
FT                   NVAAGANPLGLKKGIELAVESVSEELSKQAKEIETKEQIASTASISAGDPAIGALIAEA
FT                   LDKVGKEGVVTVEESNTFGLELELTEGMRFDKGYISPYFVTDADRQEAVLDDPYILIVN
FT                   SKISAVKDLLPLLEKVMQASKPLVIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLGDIAILTGGQVISEDVGLKLESTSIDLLGKARKVVVTKDETTIVEGAGDADQI
FT                   TGRVSQIRNEIDKSDSDYDREKLQERLAKLAGGVAVVKVGAATEVELKEKKHRIEDAVS
FT                   NAKAAVEEGIVAGGGVALLQASVSAFDKLDLTGDEATGANIVRLALEAPIKQIAFNSGL
FT                   EGGVVVDKVRNLPIGHGLNAATGEYVDMLATGIIDPAKVTRSALQNAASIAGLFLTTEA
FT                   VIADKPEKNPAPAMPGGGDMDF"
FT   gene            complement(176492..177775)
FT                   /locus_tag="FraEuI1c_0137"
FT   CDS_pept        complement(176492..177775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0137"
FT                   /product="threonine synthase"
FT                   /note="KEGG: fal:FRAAL6700 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78225"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q6"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADP78225.1"
FT                   /translation="MTLAPERAAQSGSTTDDANPAVSLSCRHCGATYPLGPQHVCFECF
FT                   APLEIAYDEDRLRRVTRASIEAGPQNLWRYVGLLPAGHDPARRVSLGAGFTPLRPAPRL
FT                   AAELGMKTLWVKDDSANPTHSFKDRVVSVALSAARDLGFTTVACASTGNLAHSVAAHAA
FT                   HTGLRSIVLVPHDLEDGKTVSTAVYGGTLVAIKGNYDDVNKLCSQLADEYEWAFVNVNV
FT                   RPFYAEGSKTLGYEVAEQLGWRLPAQVVIPIASGSLLTKVDKAFRELGKLGLVEPTPYK
FT                   VFGAQAAGCNPVAAAFERGVDTVSPVRPSTIAKSLSIGNPADGPYALDVARRTGGAITD
FT                   VTDDEIIEGMRLLARTEGIFGETAGGVTVANLRRQLREGLLDPDAETVIYNTGDGLKTL
FT                   DPLVGIAGPTATIPPTLSAFEAAGLGDD"
FT   gene            178341..179162
FT                   /locus_tag="FraEuI1c_0138"
FT   CDS_pept        178341..179162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0138"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; KEGG: fal:FRAAL6699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78226"
FT                   /db_xref="GOA:E3J4Q7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q7"
FT                   /inference="protein motif:PFAM:PF08282"
FT                   /protein_id="ADP78226.1"
FT                   /translation="MSIRAVYTDLDGTMVGPKGSFFVAEDGSHTLEAAQALVDLHAAGL
FT                   TLVLVSGRTRPQLVEAAAIFGADGFIGELGAIVGWDHGRSSEILRGAMPESYTQVPEEL
FT                   LHELIAANPGRLELHTPWHTGRELDVMLRGKVDVATADAWLRDAGFDWLSMRDNGLIAP
FT                   HLMPGLGVNPHVYHLVPEGVGKGEAVAWDLRRRGIDPADAIAIGDSASDLTMARFVGRM
FT                   HLVANALRHPDIPTLLTSYDNVVVEKEAVTLGWASAIRAAVAGRAPLAATS"
FT   gene            179326..181017
FT                   /locus_tag="FraEuI1c_0139"
FT   CDS_pept        179326..181017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0139"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: fal:FRAAL6698 trehalose-phosphate synthase;
FT                   PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78227"
FT                   /db_xref="GOA:E3J4Q8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q8"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ADP78227.1"
FT                   /translation="MLAGPDPAAAGTARVLVASNRGPVAFSLSDSGALLARRGSGGLVS
FT                   GMQEVIRDAAAAAAGQGDAAEGGETDPEDPPSGIVWVCAALSDADRRAVRVAPDGRLDR
FT                   AGFDTGGAAIRMLDVDRVVFDRAYNGVANRTLWFVLHLLFAPASEPSFGAAFWRDWEAY
FT                   EAYNAMFADALALDAAHGAAVLIQDYHLTLVPGLLRKLRPDLRISHFTHTPWAPPDYFR
FT                   ILPDRVSRAVIGGMLGADRLGFLTARWATAFRDCARVLLGDEVEIDGVETCVLDGGLDL
FT                   APAPGPMAPPAALIGGPALGQVFDERPPPVVDPGQPGHRVRIGVHPLGVDAPALRARAA
FT                   AKDVAARAAELREEVGDRRLIVRVDRTELSKNIVRGLDAYRELLRNHPDWCGRVMHLVC
FT                   AYPSRHDLPEYREYTAAVQRIATEIEDEFATDGWLPLRLEVTDDYPRSLAALTLADVLV
FT                   VNPIRDGMNLIAKEGPTVSDRDVALILSREAGAYAELGADALVVNPYDVTETAEAMDAA
FT                   LRMPPAERRRRADRIAALAARLPPGDWFREQLAALPAPPAEVVLRG"
FT   gene            complement(181105..182025)
FT                   /locus_tag="FraEuI1c_0140"
FT   CDS_pept        complement(181105..182025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0140"
FT                   /product="trehalose-phosphatase"
FT                   /note="KEGG: fal:FRAAL6697 trehalose-phosphatase; TIGRFAM:
FT                   trehalose-phosphatase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78228"
FT                   /db_xref="GOA:E3J4Q9"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q9"
FT                   /inference="protein motif:TFAM:TIGR00685"
FT                   /protein_id="ADP78228.1"
FT                   /translation="MTTSPAPAPRIPPASAPTVGAPTEPPDSAPTPGFGLPGGAALAAL
FT                   ITAPGHALVALDYDGTLAPIMPRPMDAAPAPGAVDALRALASRVGTLAIITGRPVDALL
FT                   ELTGLPTAGAGEDGLANLTILGQYGLQRWEGATGDTVSPEPLPGVAAVRARLPEVLRDA
FT                   PPGVTVEDKGQALVIHVRRAADPDAALGALAPALRRLAEEHGLEAAPGKKVLELRPPDH
FT                   DKGRALRELVDERSARSVLMAGDDLGDLPAFDAVEALRSTGIAGLTVCSDGPEVPTALR
FT                   ERADLVVDGPAGIVALLQVLAARIG"
FT   gene            complement(182377..183009)
FT                   /locus_tag="FraEuI1c_0141"
FT   CDS_pept        complement(182377..183009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78229"
FT                   /db_xref="GOA:E3J4R0"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6696"
FT                   /protein_id="ADP78229.1"
FT                   /translation="MSGPGSTTTAARSAAAPPPRRPTGNSRLRALGAALIAVLAVGVGI
FT                   LLVNLLHNPKSGAQPPTASRASTAAPVTSATPRATASAHPTSATSSARPSASSPRPTTQ
FT                   PPAGSGAVAPVVILNDSKIEGLADAASGPVKDAGFTVDRVGGYISTYNVPVTTVFYEDD
FT                   LKAAAQNLQQRVSGIVKIEPIAGTDIKLYEPGKLILVVTRDFPTPAP"
FT   gene            complement(183006..183392)
FT                   /locus_tag="FraEuI1c_0142"
FT   CDS_pept        complement(183006..183392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78230"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6695"
FT                   /protein_id="ADP78230.1"
FT                   /translation="MDDAQQQESTAPQAAQPAEASPPAGAGGLSDRDARVLRFERRTWR
FT                   YPAAKDEAIRTEFGLSPARYYQLLNALIESPAALAAEPVLVGRLSRLRAARRQGWSPAA
FT                   SVTAGSGRAPSGADVVEPYPTDPT"
FT   gene            complement(183682..184968)
FT                   /locus_tag="FraEuI1c_0143"
FT   CDS_pept        complement(183682..184968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78231"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL3800"
FT                   /protein_id="ADP78231.1"
FT                   /translation="MPALRPSRVSAAAARSRRMVLVAAAAALATAATACGATTKPGGSG
FT                   SACDSPGFTSNTVKIGYLYPDTGPFAQALLATRSGFIARVEQQNAAGGVHGRKIITATG
FT                   DDQGDNGTNLQAARQLVDVGQVFGIVEGTVAASGGADFLRQRDVPVVGLPAESIWADHR
FT                   YPNMFAHAYVYAGADAGSVDTFGQFVKAQGGTKVAVIGTDVSAASNQLDGEIVDSLRAV
FT                   GVEISTQTFIYNAVHTDPIALGRQLMAAGVDTAVGSLSAQDFSHIMMGAKTAGANIRIY
FT                   LSASGYDHSVLAQDGRQLAGLYTWLNYLPFEANTPADQAFFKAMSDYAPELQPPDQELA
FT                   LIEYILTDMFITGLERAPACPTRADFISTMRNLTGYTADGLLPGAVDFKNWGRLSLCYT
FT                   FVRVNDAGNGYDIVKDPAGKPEWCGNAIR"
FT   sig_peptide     complement(184864..184968)
FT                   /locus_tag="FraEuI1c_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.566 at
FT                   residue 35"
FT   gene            185192..185566
FT                   /locus_tag="FraEuI1c_0144"
FT   CDS_pept        185192..185566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78232"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6694"
FT                   /protein_id="ADP78232.1"
FT                   /translation="MVARQFTRTTEDFSCLVCGTAVRGDGYTNHCPRCLWSRHVDVAPG
FT                   DRAAGCGGLMRPVAIEARAHDVVLTHVCESCGHRRRNRTAPADDEAALLRVAAEAADAA
FT                   VAGGIAQANAAGARTRRRRR"
FT   gene            complement(185618..186871)
FT                   /locus_tag="FraEuI1c_0145"
FT   CDS_pept        complement(185618..186871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0145"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: fal:FRAAL6693
FT                   glutamate dehydrogenase (GDH)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78233"
FT                   /db_xref="GOA:E3J4R4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R4"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ADP78233.1"
FT                   /translation="MSLGSSPWDTACVQLADAARHLGLDEGMHDLLRMPRRSVTVSVPL
FT                   RRDDGQLLVLTGYRVQHNLARGPAKGGIRFHPSTDLDEVKALAMWMTWKCALMGIPYGG
FT                   AKGGIAVEPKMLSDQERERMTRRYAAELVPLIGPEKDIPAPDVGTDEQTMAWIMDTYSA
FT                   HTGHTSHGVVTGKPLSVGGSAGRAGATSRGVQLAMFAALRERGLDPADVSVAIQGFGKV
FT                   GALAAQYLHDAGCRVVAVSDVKGGVYNPRGLNPTALIRHLARGADTVVGFPGTDTLSNS
FT                   ELLELDVDVLVPAALEGVITAENAGRVRARMIVEGANGPVAAEADPILAEKGVVVVPDI
FT                   LANGGGVAVSYFEWVQDLQAYFWTEDQVNERLAELMERAYAQVSRLAAERGLTLRAAAH
FT                   VIGVGRVAEAHRTRGLYP"
FT   gene            187181..188857
FT                   /locus_tag="FraEuI1c_0146"
FT   CDS_pept        187181..188857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78234"
FT                   /db_xref="GOA:E3J4R5"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6692"
FT                   /protein_id="ADP78234.1"
FT                   /translation="MAAAPVIGPDPGSGAAHQRGPAGDDGGSTADHAQATGARPAHLAE
FT                   GRSGADGRPGTGRLGRAVTRWRAPWSATRLWGFWAVTRLLLLALVWAGHPLGAQQGVLG
FT                   DVRLYDGWGTAFIHGHGLPVGDQKWQYPPGAVLVFAVPALAHALVLLPYRVGFPLLMLA
FT                   VDAGVTTALARVRGPDVGGLPAGSPGSRLPTATPAPALPGPGARVWLVGTTLLGPVTLA
FT                   RFDLVPAACAVAGLLLLVPARRGGAGISGPRYGRAGFAAAVGALVKAWPAFLLIALGRA
FT                   ALVPQVSAEAPAGPAIWRRLWSRPLVRAGAGAVGAALLVGLLLVGAGAGGDLFGFLGAQ
FT                   RARGLQLEAVPATVFVVIRMFGVGETAHYEYGSLQFGDPAARTVATACSLVEIAVVAVV
FT                   AVRWWLARPAPVPGRAPARGPAATVGDRLLALLLVLLVTSRVLSPQYLIWVLAVAAAVA
FT                   ALGATEPPDGDLGADPAQAHRRAALALLLAVAAISQLIYPWRYNDIIEGRPVTSLVLVA
FT                   RNVLLLAACWRAVLVIAWRPAGRRPRGRARTDAAAPSDPSS"
FT   gene            complement(188775..190598)
FT                   /locus_tag="FraEuI1c_0147"
FT   CDS_pept        complement(188775..190598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78235"
FT                   /db_xref="GOA:E3J4R6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6691"
FT                   /protein_id="ADP78235.1"
FT                   /translation="MWLVVAGLIAAVAAVTAEGRLGPRDPRATDPTSWWGILPPVPPTS
FT                   ITRGTLAGISALSVIGLCVCWLVLVRLALTDRLRPREALAATVAWAAPFAFGPPLFSRD
FT                   AYAYAAQGELARRGIDPATHGVAALAGDSRGAAFMAAVDPRWRDTHTPYGGGAVAVERL
FT                   AATVAQLFGAGPTVALVTLRILAVLAVAALVVCTYRLVADLPGAAGDPSSRGEASEDRS
FT                   PGRAVAVAVALVGANPVTVIHLIGGMHLDALVTAALAGALLLDRRRSAARPADTPGAVP
FT                   ATGSGAFGGAVCLAGLGAVALACFAGTVKATAFLGLVWLLVAQARDARAAAGRGAMART
FT                   IVVDLTVALAVLGLSMLGSGFGLTWLHALSTSGALTTGVAPASVLASLIAALARLGGVH
FT                   ASTGSGSVLLTGARAAALAVAGLVCARLLWLAWRRPARTAPTAAAGRGDGDTAVPAGNA
FT                   GYDGLLVLGIGGLAVALGSPVLYPWYLAPTLPMLGVLAAGWHLQHLAAGSPAAALIPRR
FT                   RCRTVVGVTVAGSIWLCGATLSPLAQTWRLLAPDGPEGVLPLVVTAVAGAALLITAATI
FT                   ATRTVSSTDRSGQPRRSAPGPEDDDRQAATR"
FT   gene            190892..192775
FT                   /locus_tag="FraEuI1c_0148"
FT   CDS_pept        190892..192775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0148"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: fal:FRAAL6690 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78236"
FT                   /db_xref="GOA:E3J4R7"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6690"
FT                   /protein_id="ADP78236.1"
FT                   /translation="MPSRPALGDEPGRSLPSSSSFVGTAPSAATGPSTIELPRTAGAPT
FT                   DEAVADPPIQGIVPGPPTGTGHAPQDPTRVGETVGPTDDRALPAGRAGRAGGGWRLVRL
FT                   VAVQVGQLVRARPWLLTAALCALSLGLGLTGPDTPAQEYRVWLFEHGGARLWDDQWYGG
FT                   HTIPGYSVLFPPLGALFGAQLLAALSCVASTVLVARLLRGPRARRGHDLPVLWFGVVTV
FT                   ADLIVGRGPFALGLAFGALAVVGVRERRWWVALIGAVCSSLASPLAGAFVLLVGVALIG
FT                   SLSWRRIWPLVGAICGILVSLIFPEEGTQPFPALTYLSLLTLIVAGLLVVPRRERAVRR
FT                   GLLLWAMAATVFFLLPTTVGGNITRPATLLAGPMAAVLLSKRPKILLIVAVPLIGWSIG
FT                   PVQGALATQGDPSAASSYYSGMLDYLDRGGPVPVGRVEVPFTQAHWEARYVAPKVPMAR
FT                   GWLRQLDSKYNSLFYDGTLTAKTYHDWLLARGVTYVALPDVPLDPSAQAEAVLLRSGLP
FT                   YLQLGWSNAHWKIWIVTDASGLVQGPAQLTELGVSSMAVNFDRPGLATVLVHYTSFWSI
FT                   TEGNACVFKAAGNWTGILASEAGPVRLGTHLSVDGLTHASELDCPTDQRVH"
FT   gene            193263..194690
FT                   /locus_tag="FraEuI1c_0149"
FT   CDS_pept        193263..194690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0149"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6686 hypothetical protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78237"
FT                   /db_xref="GOA:E3J4R8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R8"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP78237.1"
FT                   /translation="MKSSLLPIMLIVVLVVGATVFVVLSSRSGRTTYGPGAQPPPTQDG
FT                   SRARRRGRNDGSRRDIGRPIRRGGGSTFGPPDVEYSDPGDLVPGLGQRPAAAPAPDVDA
FT                   RRVDPALGQAWRDDVTTQVPTDGGWPADDRDPDATGWAPPPSGAPHPRAAETGPTPVGG
FT                   QDAAPTIEDDAWNLPAGRDSHQQPAAPASWLEAAPPPAEPPPAPAAPLAPAVAPSAAAD
FT                   ATMVTATAGPYVADEPEHFSSSPLRLAAAGRTRRGKRGGPNEDAFVVVDGLLAVADGVG
FT                   GEAAGQIASTLAVTTVAGFRPQYADDPSEGLRAAVVRANKMVRERPKAEPSWRGMACTL
FT                   DVVVLGRQEQTGRTITVAHVGDSTVWLQAGKGEPRQLTTPHAITGGPLLNAIGLADEVE
FT                   MDLFQVAVQAGDRVVLSSDGMTKVMKPEQLYGLLHQLANDPPERAADALVEAALLAGAR
FT                   DDTTVVVADLVPEPAPR"
FT   gene            195041..196039
FT                   /locus_tag="FraEuI1c_0150"
FT   CDS_pept        195041..196039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0150"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gob:Gobs_0441 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78238"
FT                   /db_xref="GOA:E3J4R9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78238.1"
FT                   /translation="MSTVSVVVCSHLVARFTLLVAALESLRAQTRAPDQVVVVVDGDDE
FT                   LLKKLHDRGGDELVLSTGGRTGLSNARNTGLRAVTTDFVAFLDDDATAEPAWLEALMAA
FT                   VSSSANVLGVGGRTLPAWESKQPAWFPDELLWTVGCSHLGLPASCQPVRNVFGGCALFR
FT                   RPLFDEVGGFDDRLGRKAKGAAGCEETEFCIRAQRLHAGGTFLYEPAAVIHHRVPLGRS
FT                   SPRYVLRRCWEEGRSKALLRVITRGVGQPERAARRKSSLGPERDFLLRVLPSGVFGGLR
FT                   AAVRGQPAAAGRALLLLVGSATTVVSFVGAALLSTRRGGATVPEPAGLAQP"
FT   gene            196104..196877
FT                   /locus_tag="FraEuI1c_0151"
FT   CDS_pept        196104..196877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0151"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   fal:FRAAL1353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78239"
FT                   /db_xref="GOA:E3J4S0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S0"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP78239.1"
FT                   /translation="MYHSVGQGASSAFRRWQVDPGLFAEQLGALVDAGYRLVGLSAALD
FT                   EPDERTVAVTFDDGFVDFLGATELLVAAGCGATLYVPTAHVARRARWMAGYREAELRIM
FT                   DWSELSEVAAAGIEVGSHGHAHAELDLMPAHLMRADILLSRRMLADRLGRPVRSFCYPF
FT                   GYHTRTVRSAVASAGFASACEVGYGLHPRAGDAFAVRRLIVTGDTRPADMRRLVTEGQD
FT                   SPVMQLRRRTRTPWRIYRAAHHIATRSHAEAEPGD"
FT   gene            complement(196904..198430)
FT                   /locus_tag="FraEuI1c_0152"
FT   CDS_pept        complement(196904..198430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0152"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: fal:FRAAL6682
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78240"
FT                   /db_xref="GOA:E3J4S1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADP78240.1"
FT                   /translation="MVVSWLADGEPAARGAASAPAGALSALRQGLRPQRPAVRFAPAGP
FT                   DSVPLDPVPDDDTAERADATTSTFRDAARRRHHVHHARLGGLRPGTRYRYTIEPAPSEA
FT                   PATGEFRTAAAPGDPGEAFTFTCFGDHGTDEPDDPYGTAASRAVVGALDRYDPLFHLVI
FT                   GDLTYASLRQDPARAWADWFRMIAPSARHRPWMPVAGNHESERGMGRFGLTPYQAYFAS
FT                   PPNGAGPDYEGLWYAFTVGRARFVMLFGEDVCYQDHGEVYLYGFSEGRQTAWLERTLRE
FT                   ARADGAIDWVIVGVHQVAMSTAAYHNGGDLGLRAAWLPLFDRYQVDLVLCGHEHHYERT
FT                   HPVRGVVPDSTELTPLPALTTEPAVLSTAPRATARPVVGSLTARPAGAELERIDATTGA
FT                   VHVTIGTGGSSTPSSEALFDPPAGRVVVEAEKRHGAGRRRTVYRLEAAPWLAARSTEHP
FT                   YAFAALRVDPGEPGGTTTIRVTVHDSLAPDEPPFDDFMLTRPRPGEAGSA"
FT   gene            complement(198616..201126)
FT                   /locus_tag="FraEuI1c_0153"
FT   CDS_pept        complement(198616..201126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0153"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: fal:FRAAL6680 ATP-dependent protease, HSP 100,
FT                   part of multi-chaperone system with DnaK, DnaJ, and GrpE;
FT                   PFAM: ATPase AAA-2 domain protein; AAA ATPase central
FT                   domain protein; UvrB/UvrC protein; Clp domain protein; Clp
FT                   ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78241"
FT                   /db_xref="GOA:E3J4S2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S2"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADP78241.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKGDPATAGAPSEGTPS
FT                   TSLVLDQFGRNLTAAAREAKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAV
FT                   VEGLAQAIVKGEVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIIL
FT                   FIDELHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHLEKDAALERRFQ
FT                   PIQVAEPSVAHTIEILKGLRDRYEAHHRVSITDAALVAAASLADRYISDRFLPDKAIDL
FT                   IDEAGSRMRIRRMTAPPDLREFDERIANVRRDKESAIDAQDFEKAASLRDKEKNLIADK
FT                   AKREKEWKAGDMDVVAEVGDEEIAEVLAIWTGIPVFKLTEEETARLLRMEDELHRRVIG
FT                   QQQAIKAVSQAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTELSKTLAEFLFGDEDALIQ
FT                   LDMSEYMEKHTVSRLVGSPPGYVGYEEGGQLTERVRRKPFSVVLFDEVEKAHPDVFNTL
FT                   LQILEDGRLTDSQGRLVDFKNTVLIMTSNLGTRDISKGPGIGFATGQGAVDYERMKAKV
FT                   QDELKQHFRPEFLNRIDDIIVFHQLSQDEIIQIVDLMLARVDAQLKNKDMALELTPAAK
FT                   QLLAVRGYDPVLGARPLRRTIQREIEDVLSEKILYGTLKPGEIVIGDVEGDPTAEDAKF
FT                   VFRGETKPSSVPDTPPIDLAKSGE"
FT   gene            201793..203259
FT                   /locus_tag="FraEuI1c_0154"
FT   CDS_pept        201793..203259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0154"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: lysyl-tRNA synthetase; TIGRFAM: lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78242"
FT                   /db_xref="GOA:E3J4S3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S3"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADP78242.1"
FT                   /translation="MTADEPTVDGAARLPRSGYQTDLTSADVQAAPDGTPARVAGRLML
FT                   WRRMGGLVFGTIQDRAGRVQISLNRNELGEETYKEWHSSVKVGDFVGVTGVVFTTRKGE
FT                   RTVGATDFAVLNKAVRALPDKWHGIADVETRYRRRYLDLLANPASRERFQTRSRVISRI
FT                   RRFLDDADFLEVETPVLTEAASGAAARPFITRHNALGEDFYLRISPETYLKRVVAGSFD
FT                   RVYEIGRNFRNEGIDPSHLQEFTMLEWYAAYWDYRDNMRFVRELILAILDDVIGSRTVT
FT                   YEGTKLDFGADWPVIDYRDAVESRTGVDLRVVRDFETLKTKCADLGLDVSKAASYAALV
FT                   DLLYKKTVRPELVQPCFLVGHPVELVPLARRSDDDPTRLDMFQVVANGWELVKAYSELV
FT                   DPVDQRERLEEQADLRAAGDDETMMLEEDFIEAMEYGMPPMSGLGLGIDRFIALITDAP
FT                   TLRDVVLFPSMRGAKGPESTEPAQAAGPES"
FT   gene            203447..204652
FT                   /locus_tag="FraEuI1c_0155"
FT   CDS_pept        203447..204652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0155"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78243"
FT                   /db_xref="GOA:E3J4S4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78243.1"
FT                   /translation="MPGDIGYYLVYLPLGTIGLVRWLCWLARRIPAALYRPVGGDLRLP
FT                   LTVVVPVYQEDPEVFTRALTSWLANDVDEVILVIDATDTACRRIAADFPVTVLVTEVPG
FT                   KRDALRRGWEAASTELVALVDSDTIWADDVAAEVCKPFADPAVGGVATRQNVYNPRGFL
FT                   QRITDLFLDCRYFDENAAQSVMGRALSCLSGRTAIYRRALLVEVSHEFMTEKFLGVQCM
FT                   SGDDKRLTTLLLERGHATVLQRSARVWSSFPDTWRLFCRQRLRWARNTWRSDLRALSRR
FT                   WVWRRPFLAFSMVEKAVSGFTLLVSPTFMTLALLRHHWFFCGCLACWWWLSRAAKALPH
FT                   LRRQPSSFFLIPGWILVSFAMSVIKIGALVTVRRQRWLTRQVAVENGVVVRTAGAAVEA
FT                   IS"
FT   gene            204649..206445
FT                   /locus_tag="FraEuI1c_0156"
FT   CDS_pept        204649..206445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_0614 membrane protein, IniB"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78244"
FT                   /db_xref="GOA:E3J4S5"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S5"
FT                   /inference="similar to AA sequence:KEGG:MMAR_0614"
FT                   /protein_id="ADP78244.1"
FT                   /translation="MSRARRPRVRGSRWFPPGPARSLAAAAVVAGLVLAPAATALAGTA
FT                   QARVPPDHRLVLGASRVDVLLDGRLVSRVVRPPGVVEISWLVGRVPADWVAGSGDGTVR
FT                   LKAELSLGRGAALEVGPRTSRLELVGGADPRASSGISVQGGTLQLLGTTVASVDPRTGR
FT                   PVPAGLPGRPWLSAGAGGRVDLRDSRVTGLGDGTTGARSAGLFLGPGATGSVLRSTFAG
FT                   NGIGLVLAQTQAVSLSGVTVTGSVSDGLLLRGDAGTTLAAVTSTDNGRDGVVILGGDGR
FT                   RLGGLRTEHNQRFGVRAARLRDLELTGLRSVDDTEGALLLVGCRSCVLDDPGVQGGRVG
FT                   LRIGAASGPVRVGGGVVRGAAFGVQLAPTAGQVTLTGLTVNGATRVGVEIGGSGAALHG
FT                   VQVSQAGVGVRVYGQAAGALLDQVTVTGGRDGIVATDGTRGLTVTGPTVTGVSGTGLRL
FT                   ASTGLTVRSGTVRDAAVGAALPGAGHLAGLRISGVARGIWVGERGRITAQGVDVLAART
FT                   GIEVDRGGTFDLSSSRVVAARALVGEIDRHGANTIALPPFPWFGLAALVAVLLAFGLEA
FT                   LHRVRAGRSGPPRAPDHVLNIT"
FT   sig_peptide     204649..204777
FT                   /locus_tag="FraEuI1c_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.599 at
FT                   residue 43"
FT   gene            206518..207981
FT                   /locus_tag="FraEuI1c_0157"
FT   CDS_pept        206518..207981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tau:Tola_1417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78245"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S6"
FT                   /inference="similar to AA sequence:KEGG:Tola_1417"
FT                   /protein_id="ADP78245.1"
FT                   /translation="MRTAVSVTSRMTPVGLPSARPLAGPRLARRAGPGAAALALGVLGL
FT                   TVVGAPGAAQATACAGQVRYAATTNTLYLTSGTATPTEIKAACPAAPLTLTNPASNTWE
FT                   LDADLVVQNGASLLLHGAAAGGDVNVLRLRSPADALKTHVSTITAQYGDLDLSSVTVTS
FT                   WDPDTAAPDTNPTLPAGAPADARGRAFIRAVSYLDGSTPRESRLDIVNSDVSNLGWYDA
FT                   ESYGVSYKGRGCDASHLSVCAALNVYGSEKNSHFHQNYMGTYLYDGYQLAFTGNEYDHN
FT                   VMYGLDGHDDSDYLTITHNHFHDNGDHGVICSQRCDHLTIEDNESDHNGIPPFAFPDDQ
FT                   DVSDNQVHGIMLHRGITDSVVADNYVHDQPNGAGIAVFDSVGNVVRNNTVTRAKYGLRF
FT                   SVGATGTRLLGNSVTSSGKYAVYTYKGNDVPTYSTASGRPTNLYFAGNTLNSGSGVALQ
FT                   INDADGTTFAGNTITGTTQTRDSTGTTFS"
FT   gene            complement(208221..209114)
FT                   /locus_tag="FraEuI1c_0158"
FT   CDS_pept        complement(208221..209114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0158"
FT                   /product="Alginate lyase 2"
FT                   /note="PFAM: Alginate lyase 2; KEGG: sna:Snas_3336 alginate
FT                   lyase 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78246"
FT                   /db_xref="GOA:E3J4S7"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S7"
FT                   /inference="protein motif:PFAM:PF08787"
FT                   /protein_id="ADP78246.1"
FT                   /translation="MRPARGVLGVVLGMATLTACLPAPRLPPSQQGAAPRPVAPAGGPL
FT                   PAALAPQAPAPSPAAGGVGAAAAGSSTAPVPAQILDLSKWKLTLPVTSAPGADSTNGRE
FT                   AAQISRPALRTFSMAPYFTPTGDNKGVHFRAPVNGATTPGSSYPRSELREMSADRVPAA
FT                   WSSTTGTNTMSIREAITHLPTRKPEMVAGQIHDANGYVAMIRLDGSRLYVEHDGQNVGD
FT                   LNTHYVLGTVFRIRMVAAGGLVSVYYNDKAPVTFPLREGGLYFKAGCYTQSNLSKGEPP
FT                   DAYGEVALYDLRVSHS"
FT   gene            209688..210668
FT                   /locus_tag="FraEuI1c_0159"
FT   CDS_pept        209688..210668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0159"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   afu:AF0596 UDP-glucose dehydrogenase (ugd-2); PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78247"
FT                   /db_xref="GOA:E3J4S8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S8"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADP78247.1"
FT                   /translation="MRIFIIGSGVVGTATGRGFIEAGHRVTFVDVSPQRVEDLTARGLD
FT                   ARARIDLATEEAAYIFLTLPTPNDGTRYDLTAFLEGTRAVGRALREADAVHTVVVRSTV
FT                   TPGTTEGLVGPVLERESGLRQDEGFLLASNPEFLRAASAVADFRWPRMTVVGARNRRVR
FT                   ERLVELFTPFGGELRVFAEPMTAEFIKCAHNIFNATKISFWNEMHAVAQRAGLDLAEIA
FT                   ETVARSAEASFNPTYGIRGGAPYGGACLPKDTKAFLGFADTLDIDMPLLRAVVEVNDRL
FT                   VGSPSAVPVPAALVPAAMTGPPRIEIPEQPTGDRVPARAAESPVR"
FT   gene            210733..211998
FT                   /locus_tag="FraEuI1c_0160"
FT   CDS_pept        210733..211998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tga:TGAM_0589 glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78248"
FT                   /db_xref="GOA:E3J4S9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027389"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S9"
FT                   /inference="similar to AA sequence:KEGG:TGAM_0589"
FT                   /protein_id="ADP78248.1"
FT                   /translation="MKHWLPWLGLVAFLRPLIEVFILAIGEWWFHAGFKENPGLFSRYV
FT                   IQITTVGREQDRVNEIIREIRDYPMTMNYQIWVVNEPGNDDVYPDADRVVTVPVEFECV
FT                   AQYKARALEYSRLVRQQLGYNQGDTKITFLDDDTSPTWEYLETAFAGDYDICQGVTAPR
FT                   IGYGVRPFSHFLLSHVDDLRFHNCMTYCSSFQGIFGKPLFVHGEGLTITGYTEETVTWN
FT                   WRIFASEDLTFGCNAAAKGLRWGFFHEYIQLTSPWTWQAYFKQRRRWMWGNIHAIVNRD
FT                   VLPRGAAIRIAIRYFLSLFTFFASGTSVALILTHTIDLPGWAHSLFWCSLVIWLVNFAL
FT                   SGWVNAGLRTAEQTTAQFWWNRVTQTAAAVVLSPVTATFTIVALIVTLYMGNPRSFEVI
FT                   AKTAATSGQRESSRPLVRGAAS"
FT   gene            212052..213518
FT                   /locus_tag="FraEuI1c_0161"
FT   CDS_pept        212052..213518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_1600
FT                   alginate-C5-mannuronan-epimerase AlgG"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78249"
FT                   /db_xref="GOA:E3J4T0"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T0"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_1600"
FT                   /protein_id="ADP78249.1"
FT                   /translation="MRVPSPRSGGADEVGGGATSAGGARRAAARAARATAAGTRGRGVY
FT                   LLVTVMTLVAAAVLSVTVGRHYRALTSTSEFFHRHAYTPSYDPISNVERGLQPNTIDTR
FT                   TSKPDPSIRAISISPTGVDLLVGGQVHHSFPQQASVNGLPQLASIVNDPDWLEYDGQGH
FT                   AVLHAALVVVGQTAFTIDAPVTSLVLESRRGVLLGAESGTLAIDGVSIRPSAPNPDPGQ
FT                   RALDQRQPFIVAASRSQLIISHSHLSTLGRDWNSSYGVSWTDGASGSITNSEVDHTFIA
FT                   TYTDAAHDVTIANNWLHDNALYGVDPHSNSTRIVVRQNLSEHNGRHGIIFSDNVTDSVV
FT                   EDNVARDNHLNGIMMDAQSTGNRIVGNSVTGNRGDGLVLASSPHNVLTNNTVTDNRIGV
FT                   MVRGADGDEGVTLRGNEIRGNQLASQGISLAGNKVSGNGTTWRPRVLAVIWSLVPVTIL
FT                   LLIGFTRTLRRRRGRAVGRGHRPSAVTIGA"
FT   gene            213511..215847
FT                   /locus_tag="FraEuI1c_0162"
FT   CDS_pept        213511..215847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0162"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rha:RHA1_ro00864
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78250"
FT                   /db_xref="GOA:E3J4T1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADP78250.1"
FT                   /translation="MPRPADLRLFAPSIPPARGADVTERGAARGADSQPAPDVLVGPVP
FT                   AAAGEPAEAERAGDQGAPEADTGAGRRAREFRPDIEGLRAVAVLLVVLGHSNLGVPGGF
FT                   VGVDVFFVISGFLITQQLLRERATRGRISFRRFYARRARRILPAAAVVIVATVLASWAW
FT                   LSPLRVRDIAWDAVYSAFSAVNLRLAHSGTDYFQSAAPPSPLQHYWSLAVEEQFYLVWP
FT                   LLLTLVTLAATAVTARRRRSAPPEAGDEGRPVPGTRPVVLVLLTVVAGSLLLSVVVTAR
FT                   SAPWAYFGGHTRAWELALGALVAVWAPAFERMGRALSSQLSWLGLAGIAVAAFAYGDST
FT                   PYPGTAALLPVGAAALVVAGGCAAPRKGAELLLGRAPLRLVGRLSYSWYLWHWPVLRIW
FT                   PEATGRPFHTGEKLAALGLSLVLAWLTYLLVENPVRTRPLLVRRPSLGLGLGGALAAAA
FT                   AGLALLVAAVDTVPGGRSSGPLRALDATGAAPTAPTAAGITTQPRFVGVGTSSLTPLIT
FT                   QSARLRALPTSLQPSLAKAGDDLGENKCRTPITSSTPIDCVAGDPNGSSTVVLFGDSHA
FT                   NQWFNALDAIAKESHWRLVPYTKGGCPPPYYPNFYLDELKRVYTECYAWRDAVFARIAA
FT                   LRPGLVVIGSEARVQAKDAGPGATTDLVRTLRATGAKVAFLEDTPFPGFQVPDCLASHP
FT                   SNVTSCMVTIQKSKIAEPQREIEDRGALAGGATLIDPLPWLCVRDQCPPIIGNAVVYAD
FT                   NSHLTGTYSTLLAPFLGPALRAVLR"
FT   gene            215844..216887
FT                   /locus_tag="FraEuI1c_0163"
FT   CDS_pept        215844..216887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBG3070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78251"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T2"
FT                   /inference="similar to AA sequence:KEGG:CNBG3070"
FT                   /protein_id="ADP78251.1"
FT                   /translation="MTGPTRPAGRGYQARTRGSRRDRMVRGVTLVVLPALAGLAACSGG
FT                   RPQGGHGGSAPTPAPTASRSGPAAADEPTAPTSPLARFFGDDLVMRSRGSFNLDKVRLV
FT                   SSGDRCVPTYLRVRYPAGSASQLSVRNEDAPTGGAQAYLLLKSGPTDILHLSYRVRFPA
FT                   GFQFNKGGKLPGLFGGDHVAGGNIPDGSNGLSTRYMWRAGGAGEVYAYLPSSQVHGTNI
FT                   GTGSWSFPPGQWVTMQQRVRLNTPGQADGSITVWMDGRQALRVDNLLFRDSGTLQIDGL
FT                   FFSTFFGGGDTTWASPTDQYADFADFQVSPNYINDTMPAGCAPPGPTITPSLWPSSETS
FT                   DGSGPDQ"
FT   gene            217202..218587
FT                   /locus_tag="FraEuI1c_0164"
FT   CDS_pept        217202..218587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78252"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_3417"
FT                   /protein_id="ADP78252.1"
FT                   /translation="MFGFEFQTANAFVKGPFVAGVGERQVAWRHTLTKATLEGDESRRP
FT                   GATADLEFVTPAVEDLQSANAAVGALTGLAQAILDTRPVSGGIRIFKKGGQLAGGVWQA
FT                   DCAILIHDETFGAQAQGTVGVPLTGIGTLLSKVWARTAGHSDSHSQVAQEESGFFEYLS
FT                   TAIPACQEAENVEAAELYGFLTACHLFLVRATRAPLSFVSGEDLTGFHPTESKGIFDFS
FT                   DRPDVRAAAARVRGLEAPPERALVKVGSDSPKDMFQLLHRTDFHSMYLAVPEKQRKIIE
FT                   GRPVAEALWPPEWSGAEAFVFPLPYRIEAEATDTRARGLEPLTKAEWINEKAPRLERAP
FT                   VTWTLVDHGPTIGDWWTSVQKGDVRRDGIPKDAASPPPGFRGRDPKYLATFPDSSIEDK
FT                   ATFYGMGSFPIDVDKKTGIPLAVYEHRDLMADKDIPPQEKLGLAQWSTVVAVFVEHYVP
FT                   TLG"
FT   gene            complement(218609..219220)
FT                   /locus_tag="FraEuI1c_0165"
FT   CDS_pept        complement(218609..219220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0165"
FT                   /product="protein of unknown function DUF218"
FT                   /note="KEGG: fal:FRAAL6288 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78253"
FT                   /db_xref="GOA:E3J4T4"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T4"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADP78253.1"
FT                   /translation="MSRSLVRLPRQFRPVVPAPIGPAVADGPVRRRFPRRAILRTAAAL
FT                   VVLFILFIGATLAIIVFPPTDRPARANAILMLGGAGDRRDRALELARAGYAPVLALSTP
FT                   NARHCPTVPNVKVICFRPDPFTTQGEAREAGRLAARYGWTRMIFVTDRSQNVRARLRID
FT                   RCYAGKKIMVSVDPPFRDWPYLIAYQWSAMFKALIWQRSC"
FT   gene            complement(219571..220494)
FT                   /locus_tag="FraEuI1c_0166"
FT   CDS_pept        complement(219571..220494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0166"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   fal:FRAAL6675 putative secreted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78254"
FT                   /db_xref="GOA:E3J4T5"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T5"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADP78254.1"
FT                   /translation="MQLRAPASARARRLVALGVVSLFVTIATLLTACQPPTVANAATGS
FT                   STRKPLTRDQPLTIVALGDSYSSGEGNAPFDTDAATCHRSASAWPRLLGQQLTGSTVKL
FT                   LACSGAKTYSLTSAFHGQSAQITALKSLLSAGVHPDVVTITIGGNDAGFGPTIASCVVW
FT                   RCFWTGHDNNSVQFVENQLPGLLQTAYQGVKAAAPNARILVVGYPDIFPSRSDNTCKWM
FT                   DSTERVQLVGLNDDLDRVAKRAAGKAGVEFVSTANTLNGHRLCTTDSWLYPVELLGAGT
FT                   TASAHPNAQGEQAIADAVYGYLFKGK"
FT   sig_peptide     complement(220369..220494)
FT                   /locus_tag="FraEuI1c_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.687 at
FT                   residue 42"
FT   gene            complement(220720..222402)
FT                   /locus_tag="FraEuI1c_0167"
FT   CDS_pept        complement(220720..222402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0167"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: fal:FRAAL2105 putative
FT                   undecaprenyl-phosphate glycosyl-1-phosphate transferase;
FT                   PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78255"
FT                   /db_xref="GOA:E3J4T6"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T6"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADP78255.1"
FT                   /translation="MTEITSKASKTPTGPLPIIPSPAEPPVEDTETTLRVSMRNFRNRL
FT                   AGKPPEPRNPHATKRSAAEQALLTSQPHDGPREPYRAELRWERDYARAVVFADMAACLA
FT                   GTGIAYLIRFGGIVHFGETPSTNRPYLITSLLLPIAWVITMALNRAYEHRFLEIGSEEF
FT                   RRVLNAAVRLVAVVALVSYATKAEVARGYLAVLFPTALVLTLMGRVVVRERLHRLRRSG
FT                   QAQHRVVVVGSGETAAHLIRTAKRDPGAGWNVVGVVLDRAPGMHSSDRPDRAGFDLAGV
FT                   PIIGTSDNLENAIRSAHATAVAIGPQLGGEQLQRVLWKLEGSDVDVLVSSAITDVTGPR
FT                   IHLRPVAGLPLLHIEEPELTGSRRLMKAALDRGLALSVILLASPLFLSLALAVRLTSRG
FT                   PAIFKQVRVGKGGTEFTMFKFRSMYTDAEDRLVELQASNEGAGLLFKMKEDPRVTPVGR
FT                   FLRKWSLDELPQLFNVLIGTMSLVGPRPPLPREVAAYERDVHRRLMVRPGLTGLWQVSG
FT                   RSDLDWDEAVRLDLRYVENWSLALDLIILWRTLFAVVKREGAY"
FT   gene            complement(222657..224720)
FT                   /locus_tag="FraEuI1c_0168"
FT   CDS_pept        complement(222657..224720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0168"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: fal:FRAAL2105 putative
FT                   undecaprenyl-phosphate glycosyl-1-phosphate transferase;
FT                   PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78256"
FT                   /db_xref="GOA:E3J4T7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T7"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADP78256.1"
FT                   /translation="MDENAVDHDKTDDTVTDGEPTVRVPRQRLSLSAAGQDDANRRDDA
FT                   ATVNVPAISTRAGARRAQPRVPAQPTGEPAADEAAGDAVTDPNALTGPILLPLPQGGLE
FT                   SVGLREPALPSDGLVDVVPADLPHVDEPLDDDLADDTADDAADDTWATTDGPGPPDAAT
FT                   SDDAGDLDDGADPLPRLRSSRPASSPRRREATALDGWSLREPYRAQVSWERKYTRLVIG
FT                   ADLAAGALAAGVAYLLRFGDVGVFDLAPTQLRPYLLVSAVFPVVWVLTMALNRTYEGRF
FT                   LGGGSEEFRRVVNAAVRLIAVVAVGSYTTKFEVARAYVLIVFPLATLLTLISRVAARWL
FT                   LHRMRRVGRCQHRVLVVGAGESAASLVRLARRDPSAGWNVVGVCLDRAPGRHSHDGLAR
FT                   AGFDLLGIPIVGTSEALPEAIRLTDATTVAISPQLDGERLRRALWALEGSNVDVLVSSA
FT                   VTDVTGPRIHLRPVAGLPLLHIEEPELTGARRLMKGLLDRGVALIALTLLAPLLLGLAL
FT                   AVRLTSRGPAIFRQTRVGRGGREFTMFKFRSMFIDAEARLAELAAQNEREDEFMFKIRN
FT                   DPRITRAGGFLRKWSLDEVPQLFNVLNGSMSLVGPRPPLPREVAKYADDVHRRLMVKPG
FT                   LTGLWQVSGRSDLPTDEAVRLDLRYVENWSLAMDLMILWKTVFAVIKREGAY"
FT   gene            complement(225426..226178)
FT                   /locus_tag="FraEuI1c_0169"
FT   CDS_pept        complement(225426..226178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0169"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   KEGG: fal:FRAAL6674 pantothenate kinase; PFAM: Bvg
FT                   accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78257"
FT                   /db_xref="GOA:E3J4T8"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T8"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADP78257.1"
FT                   /translation="MLLTIDIGNTNTVLGVFEGETLADSWRVRTQANATSDELAFLYRG
FT                   LIGEYRIDGVSVCSTVPAALREIRRMAGRLFKHVPVVVVEPGTRTGVPILIDNPKEAGA
FT                   DRIMNTLAAHHLHGGPTIVVDFGTSTNIDVVSARGEFLGGALAPGIEIALDALASRAAQ
FT                   LRKVELVPPRSVIGKGTVEALQSGMIYGVAGQVDGLVRRIRTELGTEATTVATGGLAPL
FT                   VLKESETLQVHEPHLTLIGLRLVFAKNA"
FT   gene            complement(226200..227165)
FT                   /locus_tag="FraEuI1c_0170"
FT   CDS_pept        complement(226200..227165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0170"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   KEGG: fal:FRAAL6673 nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78258"
FT                   /db_xref="GOA:E3J4T9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T9"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADP78258.1"
FT                   /translation="MKASFGFGSSPASDQATLARRPGWSATTEKALAEAGLDPSAVGDV
FT                   VARAIAEDLPAASGLGVDVTSAATVPADLVAVGRIVARARGVVAGLPVAAAVFDAMVGP
FT                   DAEVTLTAADGDRIGPGTEVLRVRGPVRGLLTAERTALNLLCHLSGVATVTRAWADAIA
FT                   GTGAAVRDTRKTMPGLRALEKYAVRAGGGVNHRMSLVDAALVKDNHVVAAGGVAAAFAA
FT                   VRAAFPDLPVEVECDTVEQVREAVAAGADLILLDNMTPDELRAAVALARPAGVLLEASG
FT                   GLTIDVAAEVAATGVDYLSVGGITHSVMALDLGLDLTLDK"
FT   gene            complement(227174..228928)
FT                   /locus_tag="FraEuI1c_0171"
FT   CDS_pept        complement(227174..228928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0171"
FT                   /product="L-aspartate oxidase"
FT                   /note="KEGG: fal:FRAAL6672 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78259"
FT                   /db_xref="GOA:E3J4U0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U0"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ADP78259.1"
FT                   /translation="MTSTHLATPAAPVGLPSLPVLPARLGAPRAGWTRHADVVVIGSGV
FT                   AGLTAAQRVRAQLPTSRVLLVTKALLDMGSTRWAQGGIAAALAAEDSPDDHLRDTLVAG
FT                   VGLCDPAAVRVLVTEGPARVRELAALGARFDLTAAGELSLTREGGHLRDRIVHAGGDAT
FT                   GLEVERALIAALLADDGIDVIEHALVLDLLVDADGQAAGVTLHVLGEGTRDGVGAVLAR
FT                   AVILATGGMGQIYASTTNPSVSTGDGVALALRAGAVIADLEFVQFHPTALRIPGVASAG
FT                   QQPLISEAMRGEGALLVDAAGERVMSGVHPLEDLAPRDVVAKQMSRVMGAQGVDHLFLD
FT                   ARHLGEETILRRFPTITARCREHGIDPVTQPIPVAPAAHYASGGVRTDTQGRTSVPGLY
FT                   ACGEAACTGVHGANRLASNSLLEGLVFAARIADDLAGGLPSPGAPVEAVVDRGSAGLAD
FT                   PAERVELERVMTEGAGVLRSAPSLLTTAKALADVGDVRLTGATVAAGPEAWEMTNLRTV
FT                   ATALVAAAATRTETRGSHWREDFADADDAWRGHLLLRMDPDGLLDVTYAPAPPDGVTAG
FT                   GAAEGKAP"
FT   gene            complement(228925..229887)
FT                   /locus_tag="FraEuI1c_0172"
FT   CDS_pept        complement(228925..229887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0172"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /note="manually curated; TIGRFAM: pantoate/beta-alanine
FT                   ligase; KEGG: fal:FRAAL6670 pantoate--beta-alanine ligase;
FT                   PFAM: Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78260"
FT                   /db_xref="GOA:E3J4U1"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U1"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADP78260.1"
FT                   /translation="MRWGYSRPDVRYRREDWNGPMPYAPTAQPVPGARLRPVVARTRPE
FT                   LARVLAEPAGTRAVVMTMGALHDGHAALIREARRRADQVVVTIYVNPLQFGPTEDLDRY
FT                   PRSFDADLEVCAREGADVVFAPAVIHDPRPLVTLHAGPLGEILEGASRPGHFDGMLTVV
FT                   ATLLHLVRPDLAFFGRKDAQQLVCIRRMVADLAFPVTVVGVPTVREPDGLALSSRNTYL
FT                   TTPQRAAALALSRALAAGVAAADGGTDATLAAARAVLAGETGVEVDYLALASPDNLGPV
FT                   GAAGGPALLLVAARVGSTRLIDNIELTVAPAPGPGAGEP"
FT   gene            complement(230085..232619)
FT                   /locus_tag="FraEuI1c_0173"
FT   CDS_pept        complement(230085..232619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78261"
FT                   /db_xref="GOA:E3J4U2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6669"
FT                   /protein_id="ADP78261.1"
FT                   /translation="MRTRQPDAASAATDPAPELTDLEPASGPGGSGRPESSVTPNAVAP
FT                   TAGSHRRRSRGGHVAARAARWSVRHRKLAVAGWLVAVVALVLVGSMIGTKNLKSQDWTV
FT                   GQDGQAQQALRDHGFVDRDSENVLIQLATRPAGGMAADPQVQAAVTDVVRRIVATHEVT
FT                   SVRTPIATPGATADPGLISVDGRSVLITFDLLGTVDDADSRVGPVVDAVTAAGAAHQGM
FT                   SIEQFGSASADKALNKTIGKDFQRAEYLSIPITLAILLLVFGAVVAALVPVGLALTAFV
FT                   GAIGAVAFSSRLMATNQTATSVMLLIGLAVGVDYALFYIRREREERAKGHSARRALEIA
FT                   AETSGHAVFVSGLTVAVSLAGLMITGMAAFTGIAVGTIIVVLIALLGSITVLPALLSML
FT                   GDRIELGKLPWHHAAAPGNRRERKAARIAASAARRSGLPADEEAEEDRAQRAAAAARRP
FT                   ARREQGRPDRVRLLDRLMRRPVAVAVVSGGLLLALAAPTLRLHTSDLGVSDLPKDLPIV
FT                   HTYDRLLVAFPGGPVPAVIAVTAPDVTAAPVSAAIQELRTRAVAAHVGYEPMVVDISAD
FT                   KKVARVILPLAGTGDNRASIDAAHQLRDNLVPATIDKVPGAHAYVGGEASASIDFNDQL
FT                   STRTPLVIGFVLLLAFGLLYLSFRSAAIAGVAVGLNLLSVGAAYGVLELVFQHHWADGL
FT                   LGFTATGSIVSWLPLMLFVILFGLSMDYQVFLLSRIREARQSGLDMRSASLAGLRSSAG
FT                   VVTSAAIIMVAVFSIFATLSQVSMKQLGIGLGTAIFVDATVIRVFLMPALLTLLGDRVW
FT                   RPRQGGHGELPAAGASGSGIPVQGTRFPSHTG"
FT   gene            232843..235824
FT                   /locus_tag="FraEuI1c_0174"
FT   CDS_pept        232843..235824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssc:100049648 basic proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78262"
FT                   /db_xref="GOA:E3J4U3"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U3"
FT                   /inference="similar to AA sequence:KEGG:100049648"
FT                   /protein_id="ADP78262.1"
FT                   /translation="MSDAGSGPKAGPETDEAKAATRGSSETPGGRGHSPSPAEPEASRG
FT                   VSTRRRTEPGRGETPAEGSARVDEGSQTIKLPPGQNPAPSPPSVYSRAAVRVAVDETTT
FT                   TPRPGGGPREPTAPPAPPSVYTSTPPRGARRPEAPGERTTRVERPRPERRDTVDPAAPP
FT                   ASGSSPAGERTTRVDRSRVERRDTVDPAAPRTPGRGAGVPAAGSAAPSAEHTARVDRSR
FT                   VTRRDTVDDPAAVTSRGAGPPKAPPPDSTELLDRRKIAGATSGDRPSAAAAGRAATDRA
FT                   STGGAPTDRAATDRAAAGRVATDRASTDRASTDRAAGGRAPAERAVTQATRPVGHRAAT
FT                   PEPNPAETTMRISRRDLPGGRQGRMALLADPSMAETTIHMSRSAMPPGSLLFQTGPVPI
FT                   PLREELTAAAPTPPAEESESQAPSLLRRVPAGLIDSSLSSMGSFLMGLFAQYFLPAATL
FT                   GTYGLFYQAFIAVSVIPTGIVFSPVEYTSAGVAARRRRVQLLPQSLQLGMAPAILAALL
FT                   VPFVLIIPSDGQSVGSRVGFAVTAALVAVASPMQDHIRRMLHQAGMSWTAAATSLVQVV
FT                   TVAVGLVVAKVAHVPPAWVPFGALAVANLVSGAFALWKGKPGNRAPMLLKLRSLFALGG
FT                   WIVVGNVLSASGPFINFALLTALANSTDVGNGEGSRVLAQPVTVLVIGLLAVLNPEIME
FT                   AAHNRAVRKLIKICLLFWGMVAVAILAWALLVGFEWPFNPLPRFQKPAYEVHGLLPWTI
FT                   ITEGAGYSVLVLITIANAAGRARAASVASLVAVVVSGVAVAATAKHFGPFALIWGAGAT
FT                   VVAMYAVNGAVVLNEFRRPARPAAAAPSAAAEPPVRPASAPPSRPMAGPARPVPGQARP
FT                   VPGSARPGPASGRPAPASGRPVPGPGGPAMPGQGRPAAPGPVPARLPPAGTRPDDAPTR
FT                   RGPLPAPPPAAPPRPPAPAPAPAPQPQPQPVAEQPAPAPRGGRGRHSRGGSGLRRPDVF
FT                   DRKR"
FT   gene            236069..237046
FT                   /locus_tag="FraEuI1c_0175"
FT   CDS_pept        236069..237046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0175"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_3994 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78263"
FT                   /db_xref="GOA:E3J4U4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78263.1"
FT                   /translation="MTESRVPEVSIGIPVYNGADYLGTAIESHLAQTFGDFELVISDNA
FT                   STDGTEELCRGYAKEDSRVRYVRQAENIGANANFNEVVRLSRAPYYRWAADDDTLSPEY
FT                   LEKTYGLLSKDDDAVLCHSFTTYIDEDGKELRPAGDGVGFVDDKGTYVDGPDPNIATRQ
FT                   LRSPYPHVRFRDVLLHTKWCFEIFGLMRREVLLSTAMQQKFYGTDRVILAEMALLGTWR
FT                   VVEEPLWQRRSHSGASNNMSVWQKAKWSNPDAKKSLLPPVSNMIRGYIDAIDRHTFPPV
FT                   EKAQCYAAVGVLAVQPDKFRKLLVPGPHNYFGIGNKQSNAAHRL"
FT   gene            237165..238433
FT                   /locus_tag="FraEuI1c_0176"
FT   CDS_pept        237165..238433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0176"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   kfl:Kfla_2762 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78264"
FT                   /db_xref="GOA:E3J4U5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP78264.1"
FT                   /translation="MKVAIGAFACGPGGGSEPGAGWEWTRAAALRHDVWVFTDPSWIEP
FT                   IRAAVRAEPELRLTPVEVPAPAWANYPGDFGRGERMRYVAWQYFLRRAVRAKHAEIGFD
FT                   ITHHITYAADWMPSGVVLPGVPFVWGPVGGTAPLPSQFREQLGDKQFAVEVARGVITAA
FT                   GRVACGEVLSRRASVMLAANEDVARRFRRAHPRVEPNIALHLDELPLATPVPDRGAQPA
FT                   AATARPVAAAAQVAGTEITGTDGAKPPRRAVFAGRLLAWKGVRLAVAALARPHAEGWTL
FT                   DIYGSGPDEDQIRAACEQLGVADRVTLHGQRPRDEVLKALATCDALLFPSMHDSAGWIV
FT                   AETLALGRPVICLDIGGPAMQVGEVSRFGMGPRGIRVRPYGDVVGALARALRDCPGPLE
FT                   PDRRFDVERLPNLLDELYVKAAR"
FT   gene            238841..240421
FT                   /locus_tag="FraEuI1c_0177"
FT   CDS_pept        238841..240421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_3185 cell surface polysaccharide
FT                   biosynthesis / chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78265"
FT                   /db_xref="GOA:E3J4U6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U6"
FT                   /inference="similar to AA sequence:KEGG:SACE_3185"
FT                   /protein_id="ADP78265.1"
FT                   /translation="MDALEVSPFAPTVFGAMARRRGLVLVCVVLLGAIGIAVGVKTSSA
FT                   ATAKASLIVADPSTGSTDSHYSANQAAVMRLPVTATAAAKLVNQQFPSANLTGSQLHHD
FT                   LSVSLDQNSDLITVSYRDSSPQIAAAAANAVLKAYRDAIVASNKATNDAALAQITGALK
FT                   TLNTEIATPGSAASQPNSTENQLKSRLIEQYVQLQSNSTVSEDGIVQSSPAAIPTGPSK
FT                   SAAIRFGLLGIVLGLLVGAALAYFTVNRRPRIENRLEPELLLERPFLAEIPDFTLDRLP
FT                   SDLPAFDGERSAAAEGFRFAADALESGQTYAVISATSGDGKSVTVANLAVTAARSGKRV
FT                   LAIDANFDGQGLSWLLGVPAERVGLAEVLHGSISAEEGIRLVEQVPGKLFILPPGLADD
FT                   GRPVVFDHEAIGDMLKEVRRRFDLVIIDAPAVLERAAGTALAKQSDAAVAIIPFGADIR
FT                   VTEEFAKRISLLNLPVRGYFFTRSPRRAGAGAGKRRAAQPAARKAGLPGGSNGQGGNRY
FT                   NKPSVGSGV"
FT   gene            240418..242109
FT                   /locus_tag="FraEuI1c_0178"
FT   CDS_pept        240418..242109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0178"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: dba:Dbac_1703
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78266"
FT                   /db_xref="GOA:E3J4U7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U7"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADP78266.1"
FT                   /translation="MTAPAAELSRPAGGLGGRAEIGPPARPGMWMGRRWRPAPRPAAMR
FT                   GSVNSAVRRLETPAAERAARRMTMFGLIVTFGMVLGGRGFAYLGIAPINLYISEITIIT
FT                   MVIYSPTRAYITGLLRQTGRAGRLHLLAVAMVVFFSYGVIETVRGLFDGGSSTTLLKSL
FT                   QLYYYPILLSFGMWMGARDPKIFSKLVWALAWGNATYGILYAIVLNKLQITVPGNPGAP
FT                   LFDLGLTNAAMAILGLIVYHRRSKWLIPLILLNVAVLFGHQIRAEWLALIVSLVIYCVL
FT                   TRQYRRLVAGLGVVLVFATIITIINVKIPGPSDRGGAVRPTDVIGRAVGSVDPELASQF
FT                   TSAERVQGANGTAQFRQEWWNGIWHSATSDPTFLLFGHGYGFNLQTLAPPGNVDTTVRS
FT                   PHNIIFYSIGYTGFVGVALMALLFYAIARQLWTVFKRTGNPVGLALMALMVTASQFEPF
FT                   LESPFGAAACYLTLGMCLAPLMRLGGGDGRRLPARLERALAGMAHDRPALDLEPAPIPA
FT                   QRRYASRGGPVTSTDLIPEPGSSGSEGPPLRRPAALSAGAPRPGRR"
FT   gene            242116..243303
FT                   /locus_tag="FraEuI1c_0179"
FT   CDS_pept        242116..243303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0179"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   stp:Strop_4490 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78267"
FT                   /db_xref="GOA:E3J4U8"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP78267.1"
FT                   /translation="MRVLVVHNDYVSANPSGERRVVNDDLENLRAAGVDVRAYIRSSDE
FT                   IQGLTGAAKAELLVRPVYSREDTAKVAQILRDDRIDVLHLHNPYPLISPQVVRVADAAG
FT                   VAVVQTVHNYRMACVNGAFFRDGEICTKCATKRVPLPAIQHGCYRESRAQSVVMAAALT
FT                   AHRPTWQLVDRFLPVTSFMVKHLRDAGIPASQITPKPNTVHDPGPATAPGRGLLFAGRL
FT                   VEEKGIQLLLAAWDHFHRHGGGWLDELTIVGEGPLRTEVERAARALPGVRYLGPVPSEQ
FT                   VGELMRASAAVAVPSLWFEGFPMTVLEAYARGRAVVGTSVGSVGTVVDGEVGWRTAGTE
FT                   PEDLAAALAEVDALTAARRGAAARTRFETSFTPEVVTKQLVAIYEDVLALRRARP"
FT   gene            complement(243354..245042)
FT                   /locus_tag="FraEuI1c_0180"
FT   CDS_pept        complement(243354..245042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78268"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U9"
FT                   /inference="similar to AA sequence:KEGG:RPE_3491"
FT                   /protein_id="ADP78268.1"
FT                   /translation="MGAPADTTTTTWGFPARRRPRALAALTAGLAAAAVLLAACGGGHG
FT                   TPAAPGTLEQGVPTAAPTGNLATYPAPDTPYVVGAGQRYTSIQKAVDAAPEGATIYIKN
FT                   GTYRESVIPKSGQTLQGESRDGTRIDGANAVTASSWHRDGRLWYFTDPWPLRGKVAALW
FT                   DGVTPDIDALDTDLLHRDDVPLLHKAQRGQVGSGDFWIDYDSHRVYIADDPAGHRFELA
FT                   VRRVGVGDTNGTATNVNLVNLTVEKTATGFNEAGIEMKTGWTIKDCLVLGHHGRGINTE
FT                   IDNTIVGTIAPTTGSYSGSGDQASDQQGRSGSMQVLLNGDLGIGGDPHLDAAPNGNNIQ
FT                   ITNTEIGWSNVERYSYWDEAGGVKLSGRSNVSLSGDWIHDSYGAGTWFDTGNKNIKVTG
FT                   SLFEDNLAAGVWYEANDGGIEITKNTFRRNGDTDLAMNRQFDTRGQYSAIFLSDSANAT
FT                   VDQNFIQVGTHGGFGIASHYGGRIHPAHYAINGNVISIGIPTAAFAFGSDGTDIVFTDN
FT                   SVLTWGQVTPTSNLFSLGAGSFTAWQASGRDTHGIIAAVAVPPAS"
FT   gene            complement(245119..246498)
FT                   /locus_tag="FraEuI1c_0181"
FT   CDS_pept        complement(245119..246498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78269"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V0"
FT                   /inference="similar to AA sequence:KEGG:Krad_1797"
FT                   /protein_id="ADP78269.1"
FT                   /translation="MSVLPRRPMSAVLPPVMLTQALPTSASTARPLGDGAAGLARSLAG
FT                   ARSVGRALVTTARQRLGAPAEVTERPGDERYEVGRLASHAEIAALRPEWERLYEAGHQN
FT                   PFNDPGWLLAWARTYVPVDDDLWVVTVRREGRLVGVLPCYLATIGRHGLAFRSIQLFGC
FT                   LITSGITELPSPLTHPGEDPRGVTRTALRYLIDRAPVDARAHWIEITLDRDVPWLEAQW
FT                   FRPTSAAEHPPTIMGKAPRAVVTLPLPTAPAPLVLKRNVKESVRRARNRLTKTGKPWSV
FT                   RAVTGKEEIAAAFETLRQLHTARSALTGKESHMNSLTGLAEPFLREAVVDLAGRGRAAI
FT                   YQLELDGEVIAAQLVLTNTRASYLSVSGLSAEAWNYSPMALIIHTVATDAMARGADRLH
FT                   LSAGPDEAKLRWSEQVDYYPQFLVVPPTPAARLAFAAYWPLSAALRYRREFHLHTIRGG
FT                   D"
FT   gene            247351..248130
FT                   /locus_tag="FraEuI1c_0182"
FT   CDS_pept        247351..248130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0182"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="KEGG: rca:Rcas_3094 glucose-1-phosphate
FT                   cytidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   cytidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78270"
FT                   /db_xref="GOA:E3J4V1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V1"
FT                   /inference="protein motif:TFAM:TIGR02623"
FT                   /protein_id="ADP78270.1"
FT                   /translation="MKIGILAGGLGTRLAEETAIKPKPMVEIGNQPIMWHIMKYYAHFH
FT                   LTDFTVALGYRGEYIKRWLVDYASLAANVSVSLRDGKVQWHEPETEREDWNVSLVETGL
FT                   ETNTGGRIKRLQPWIGTEGTFMLTWGDGVADVDLDALLAFHKSHGKLATLTAVRPPARF
FT                   GHIEMDGDRITEFSEKPQTGEGWINGAFFVLEPEIFDYIEGDSTQFEKEPLEELAKDGQ
FT                   LMAYKHSGFWQCMDTIRDRKLLQTLWDSGSAPWKVWD"
FT   gene            248135..249175
FT                   /locus_tag="FraEuI1c_0183"
FT   CDS_pept        248135..249175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0183"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78271"
FT                   /db_xref="GOA:E3J4V2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78271.1"
FT                   /translation="MRILVTGHDGYIGTRLIPLFRAAGHEVAGLDSGLFADCTLGTEPE
FT                   AVPAVRADIRDAKPEHFEGFDAVVHLAALSNDPLGDLNPQTTYDINAHGTVAVGRAAKE
FT                   AGVGRFVFSSSCSLYGAHGDAPIDESAEFLPVTPYGESKVMAEQGLAELASDDFHPVFL
FT                   RNATAYGVSPRLRGDLVVNNLTGYALTTGEVRMKSDGTPWRPLVHIEDIARAMLAVCEA
FT                   PVEKIHLEAYNVGRTAENYRIREVAEIVEEIVPNSKISFADSAGPDLRNYRVNCDRFAD
FT                   TFPSFEPVWTVRKGVEELYSTFVNEALTKADLEGARFQRIRRIQELIDAGTIDTSLKFT
FT                   APGASA"
FT   gene            249172..250401
FT                   /locus_tag="FraEuI1c_0184"
FT   CDS_pept        249172..250401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0184"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase domain
FT                   protein; Methyltransferase type 12; KEGG: sme:SM_b21061
FT                   putative NDP-hexose 3-C-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78272"
FT                   /db_xref="GOA:E3J4V3"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V3"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADP78272.1"
FT                   /translation="MSDLGCRSCGAAGLKPFLDLGATPLADALVTEENLAGPEGHFPLP
FT                   VAFCPNCSLVQITEEVPPEALFVDNYLYFSSFSPYLLQHSRDHALGLIAKRGLGADSLV
FT                   VEIASNDGYLLRNFVEAGVPVLGVDPAPDQAAAATEVGVPTWAEFFGTELARRIVAEKG
FT                   HADVIIANNVMAHVPELNDFVAGMALLVAEDGLITVENPYVRDLIEHREFDTIYHEHFC
FT                   YYSCTAVDALARRNGLFLNDVEYFADLHGGTLRWHLGPKENVSDTVKEYLADEQAKGMT
FT                   TFDYYADFGVAVEGIRTELLGLLGSLKADGKKIAAYGAAAKGSTLVNYVGIGTDLVDFV
FT                   VDRNVHKQGRYMPGVHLPIKDPAALLDEQPDYVLLLAWNFADEIMKQQDEYLRRGGKFI
FT                   VPVPSPRIVP"
FT   gene            250398..251585
FT                   /locus_tag="FraEuI1c_0185"
FT   CDS_pept        250398..251585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0185"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase type
FT                   11; KEGG: rca:Rcas_3091 C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78273"
FT                   /db_xref="GOA:E3J4V4"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V4"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADP78273.1"
FT                   /translation="MTSIDRCPACGGANLTPFYAKDRVASHSCLLMDSEEEALAFPKGD
FT                   LRISFCDDCAFVFNTDYDGHLAAYSEKYEETQAFSAFFREFARDLAKRWVDKYDLHGKS
FT                   VLEIGCGKGEFLVNMIEQGAGTGIGIDPGVHPERIAPELEGKLTWIADYYSPSYNHLKA
FT                   DAVVCRHTLEHISPVGDFMRNIREAIGDQPDTIVLFELPDVLRILEDAAYWDVYYEHCT
FT                   YFSAGSLARLFRATGFEVLEVTREYDDQYLVIEARPSTVPAPGEPLEIEDDIARLAAAL
FT                   APFEQKVNSSLDNWADEIRAVRARGGRVAIWGSGSKGVSFFAGLGEASKLVDYAVDINP
FT                   YKHGKYMAGSGHLIVGPERLVEDKPELVIVMNPIYLGEIGDELKKLGVTTELKEV"
FT   gene            251641..252135
FT                   /locus_tag="FraEuI1c_0186"
FT   CDS_pept        251641..252135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0186"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: nfa:nfa34640 putative
FT                   MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78274"
FT                   /db_xref="GOA:E3J4V5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP78274.1"
FT                   /translation="MVWREYSQQHREAVAAGAPEAKLANSLVVGGSAIVVDDQGRFLLE
FT                   RRRDNGKWGIPGGGMQIGEWFEDCVVREIHEETGLDVRVDRIVGVYSNPSHVMVYADGE
FT                   RRQEFTICCACTIVGGELRASEESLDVAFVAFEDLDALDFHESGRQRITDYLAGGPPVL
FT                   R"
FT   gene            252132..252836
FT                   /locus_tag="FraEuI1c_0187"
FT   CDS_pept        252132..252836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0187"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   fal:FRAAL6288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78275"
FT                   /db_xref="GOA:E3J4V6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V6"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADP78275.1"
FT                   /translation="MTDRAAAAVGPQPTEPDESGEPPKPAVANGATAPAVEDGVAEPEP
FT                   APAVERAGIFRRFRRLRRGWLVVVGLVLVLVVGLLAATLRLFVFPKADSLTKADAIVMF
FT                   DGIGGRKYTTFWLAGHGYAPVVAVSTQDLTFCQKSLPTISGVQVFCFVPTPATTRGEAE
FT                   ATERLATEHGWKKVIVVTGRPQETRARIRVERCYQGQVEIKGVSPGRDNWPKTIVYEWG
FT                   ALIKALVFQRSC"
FT   gene            252887..253303
FT                   /locus_tag="FraEuI1c_0188"
FT   CDS_pept        252887..253303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78276"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V7"
FT                   /inference="similar to AA sequence:KEGG:Krad_1844"
FT                   /protein_id="ADP78276.1"
FT                   /translation="MIPPQAGVIGESRPSLGRYPRMGIVDANDETIAELRHLVAVIDDT
FT                   IAQLERVRRRADEIEHRRVGGDLYRVIVEAEERPLIVESLSDVLDRLSSAAGRFRRAEA
FT                   TALAAEGWTHERIGQFFGVTRQRIGILLSRERVR"
FT   gene            253980..254927
FT                   /locus_tag="FraEuI1c_0189"
FT   CDS_pept        253980..254927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78277"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6244"
FT                   /protein_id="ADP78277.1"
FT                   /translation="MTTVFTDSRMPDERRRERLYGGDLFVTSPSPAVQALVDFARELIE
FT                   DAFAPYDPVVAQHELPVEKFVEIFGPLKPKFIHHPKTKGLIADVVSGLGSDLDETYIDV
FT                   PRLRGATSDGYLTAGVGYAFPLHRDVWWSAPLAQINWWLPIYDFESESSMAFHPHYWSS
FT                   GISNGSEEFNYYVYNATGRAQAAQHVAKDTRKQPGPREPVQVDPQIRVVCPVGSVIGFS
FT                   AAQMHSTVPNTSGRTRFSIDFRTVNVADLRAGRSAPNVDTQCEGTSLRDFRRGSDQAAM
FT                   PAEVVAQYDSGEIPEGAVLVFDPNAAKAPADSMA"
FT   gene            complement(254988..255899)
FT                   /locus_tag="FraEuI1c_0190"
FT   CDS_pept        complement(254988..255899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0190"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: fal:FRAAL6667
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase); PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78278"
FT                   /db_xref="GOA:E3J4V9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V9"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADP78278.1"
FT                   /translation="MPLTHVEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVIL
FT                   PTEIPDKGAVLTGLSLWWFDQLADLVPSHVISSNVDEYPDELQPYAEQLRGRSMLCHRL
FT                   DMALVECVARGYLTGSGLKDYVRTGAVSGHTLPEGLVDGSKLPHPIYTPSTKAPIGEHD
FT                   ENISRADAATRIGDDLAAELEKLTLQIFGRASDLAAERGILLADTKFEFGHDPAGVLRL
FT                   GDEVLTPDSSRFWPADSWAPGGAQPSYDKQFIRDYLVNTGWDKVSPAPELPDDIVFSTR
FT                   SRYVEAYERLTGISFADYLATS"
FT   gene            complement(256395..258551)
FT                   /locus_tag="FraEuI1c_0191"
FT   CDS_pept        complement(256395..258551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78279"
FT                   /db_xref="GOA:E3J4W0"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W0"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05451"
FT                   /protein_id="ADP78279.1"
FT                   /translation="MDAREFPDPPTEDPNGPRRWVKPQVSLASAADPSTTTVIRRTGSR
FT                   RHTARGRAVTGQEATTAGFGAAGVTAPDAVTDGPQTPSGESDSGWKPSGSRRGGAAVDG
FT                   ATGPAGPDDPEGLGGRRIGGARRRRPGSRRRWPLVVGGIAVLLIACGAVLAYQVLKVKS
FT                   DLASTSNDLTAVQDAATSGDIPAAKARLSRVIDSAHAARSHSAGPVWWAASYIPFAGPN
FT                   LRTSRQLVLSLADLADGPLTDMVSVSDTISPDSLIKDSTIDVPTLVKDRPTLLRAAAGV
FT                   ATVDKRMQSLPSDHLVGPVATARTQAVTKIAKLDKLLSGMADALTVGPEMLGANGPRTY
FT                   FLAFQNNAEIKATGGLLGVYGILTADHGKINLVHTGSNDELKNFKVPVVDFGPEYNANY
FT                   GTLFPGALWSNGNSSPNFPYAGQTWATMYERQTGTHIDGVIGVDPEMLADLVRATGPIT
FT                   LSSGQKVDGDSVAKLVEVDAYADFHDDTTNSDERSARKDFLKEVADTAFHTALSSDVKP
FT                   KPLVTELNTAAKGGHLQIWTPIASEMTILRKGGLTGEVYQGTAPYAGVVLNNVSGAKLE
FT                   YYLQRNVSYTLGSCTAGRRPGQIQIGLTNLAPAGLPRFVWQRIDAPPGSYPRGQEALQL
FT                   SVYLTDGAKLVNVMVNGKAVNFTRGTELGHPRIQMWVFPTPGQPLTITVNTDEPATSAK
FT                   PIVPAQPMARPQQTTIKAAACPAG"
FT   gene            258987..259856
FT                   /locus_tag="FraEuI1c_0192"
FT   CDS_pept        258987..259856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0192"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="KEGG: fjo:Fjoh_0331 glucose-1-phosphate
FT                   thymidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78280"
FT                   /db_xref="GOA:E3J4W1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W1"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ADP78280.1"
FT                   /translation="MKGIILAGGTGSRLYPITRAVSKQLMPVYDKPMIYYPLSTLMAAG
FT                   IREILVITTPADQAQFQRLLGDGSWLGCRFEYAVQAEPRGLAEAFIVGADFVGTDKVCL
FT                   ILGDNIFYGVGLGEQLKGYTDPVGGIVFAYHVSDPERYGVVEFDVDRRAVSIEEKPAKP
FT                   KSSFAVTGLYFYDNDVLEIAAQTQPSARGELEITAVNQAYLDRGRLGVHLLDRGTAWLD
FT                   TGTFNSLMQAAQFVQVIEERQGLKIGCVEEVAWREGFITDAQLAELLRPLSKSGYGTYL
FT                   EGLLNDDA"
FT   gene            complement(259974..260804)
FT                   /locus_tag="FraEuI1c_0193"
FT   CDS_pept        complement(259974..260804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0193"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: mgi:Mflv_4758 WecB/TagA/CpsF family glycosyl
FT                   transferase; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78281"
FT                   /db_xref="GOA:E3J4W2"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W2"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADP78281.1"
FT                   /translation="MLEGGTEPRTATGTRRSAPVIREASCCGVRITACSFEDAVAAVIG
FT                   IPAKGDDEAPVTDAGSAIHLCNAYTLALADRDARLKSTLNTARFNFPDGWPVARLTRQR
FT                   TRLSEANSQKISGPDLFQAVLSAGRDHDVKHYFLGSTPEVLEALERSVRKAYPGVQIAG
FT                   VESPPFRELTPDERAEQRLRIIASGADLVWVGLGTPKQDWEVERLAAEIPAVFLAVGAA
FT                   FDFLAGLKPRAPRWMGDYGVEWIFRLVSEPKRLWKRYLVGNPQFILSVLRNRGH"
FT   gene            complement(261232..262245)
FT                   /locus_tag="FraEuI1c_0194"
FT   CDS_pept        complement(261232..262245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0194"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="KEGG: sgr:SGR_1542 putative GDP-D-mannose
FT                   dehydratase; TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78282"
FT                   /db_xref="GOA:E3J4W3"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W3"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ADP78282.1"
FT                   /translation="MTKVALVTGVTGQDGSYLCELLLQKGYEVHGLVRRSSSFNTARID
FT                   HLYQDPHEDGRKLVLHHADLDDGLSLVNILRETGPSEVYNLGAQSHVRVSYDTPLYTAN
FT                   VTGVGALRILEAVRASNLDIRVYQASSSEMFGSTPPPQNEETPFHPRSPYACAKVYAYW
FT                   SAVNHRESYGMYVSNGILFNHESPRRGETFVTRKITRAVARIQAGLQKELYLGNLDATR
FT                   DWGYAPEYVNAMWMMLQAPEPDDYVVATGTTYSVREFCQVAFGHVGLNWEDYVRFDPKY
FT                   TRPAEVDALMGDASKIRTNLGWKPEVNFEELVQIMVDGDIQLLEDERSGRLVRVDR"
FT   gene            complement(262502..263467)
FT                   /locus_tag="FraEuI1c_0195"
FT   CDS_pept        complement(262502..263467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0195"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sgr:SGR_1541 putative nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78283"
FT                   /db_xref="GOA:E3J4W4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78283.1"
FT                   /translation="MSGLLDQGSVFVAGHRGLVGSAITRRLRGAGIDVITRGREELDLT
FT                   DTVAVSRFFDEVRPGAVVLAAAKVGGIMANATQPVEFLENNLHIQLNVISSAWRAGTEK
FT                   LLFLGSSCIYPKFAAQPITEDALLTGPLEPTNEAYAIAKIAGITQIQSYRREYGAHYVS
FT                   AMPTNVYGPGDNFDLETSHVLPALIHRFHLATERGDSEVTLWGSGTPRREFIHVDDLAD
FT                   ACATILEKYDDPAPINVGTGTDVTIRELAELVADVVGFTGTINFDPAKPDGTPRKLLDV
FT                   SKLEGLGWKPSISLRDGIESTFAWWKSSGQVARGRVTVDA"
FT   gene            complement(264029..265336)
FT                   /locus_tag="FraEuI1c_0196"
FT   CDS_pept        complement(264029..265336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0196"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: fal:FRAAL6665 adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78284"
FT                   /db_xref="GOA:E3J4W5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W5"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADP78284.1"
FT                   /translation="MIERYTLPEIGRVWSEAHKYELWCEVEVLVLEAHAAAGRVPADSV
FT                   EPVRRAPAPTPAAVAEIEAVTQHDVIAFLTAWADQTEPRSAAAYVHFGMTSSDLLDTAL
FT                   ACQLVEATDIVLAKADRLVAALRDLGLAHRTTLRVGRTHGIHGEPTVFGHRVADLAFGM
FT                   ARCRDRLRAARTDIAIAKISGAVGTYSNIEPDVEQYVAEKLGLTAAPVATQVVLRDGVA
FT                   SWVAALAGLATLCETVALEVRHGQRTEMRELSEPFGKGQKGSSAMPHKKNPIMSERIAG
FT                   LARIVRAQYVPILEGVPLWHERDISHSSTERIALPDASIGVDYLLNLTTRLVTGLVVDA
FT                   DRMRANLDATGGLVYTSAVLLELVETGLSREDAYAVTQAAAMETWQTGVPFRETLRKHA
FT                   ADRGLPLDEPRLDEVSRPERYVERLAPVFDRLAALV"
FT   gene            complement(265333..265845)
FT                   /locus_tag="FraEuI1c_0197"
FT   CDS_pept        complement(265333..265845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0197"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: fal:FRAAL6664
FT                   phosphoribosylaminoimidazole carboxylase = AIR carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78285"
FT                   /db_xref="GOA:E3J4W6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W6"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADP78285.1"
FT                   /translation="MSPTSTPSRPKVAVVYGSASDAATMSKAGATLGRFGVEFEEAVLS
FT                   AHRAPRTLADWVDGLRDRGVAVVIAGAGLAAALPGTVAALTTLPVIGVPISGGALDGMD
FT                   SLLAIAQMPPGVAVATVGLNNATNAAVLAVQILAVSDPDLAAKLATYKDDFEKAAADGL
FT                   ARAGASA"
FT   gene            complement(265851..267149)
FT                   /locus_tag="FraEuI1c_0198"
FT   CDS_pept        complement(265851..267149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0198"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   fal:FRAAL6663 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78286"
FT                   /db_xref="GOA:E3J4W7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W7"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADP78286.1"
FT                   /translation="MKVLVVGSGGREHALCRALTRDPRVGSIVCAPGNAGTADIAEPRS
FT                   LDVADPDAVAALAEEVRAELTIVGPEVPLVAGVADELRARGLPVFGPSGAAARLEGSKA
FT                   FAKDVMRAAGVPTAAARDHNEVEPALADLDAFGPPYVVKYDGLAAGKGVTVTDDRDAAV
FT                   AAVRGCLRGPDDRVVLEEYLDGPEVSLFAVVAEDGTVLPLLPAQDHKRIGDGDTGPNTG
FT                   GMGAYTPLPWASRGLSADIVATVIRPTVAELARRGTPFTGLLYAGLALTAHGPRVVEFN
FT                   VRFGDPETQAILALLTTPLTDVLTGRRAPVWRSGAAITVVMAAAGYPGAPRLGDPIRGL
FT                   AAAGKLAGVDVLHAGTRRDDEGTVVSAGGRVLSVTAIGSNLESARGSAYEAISRISLPG
FT                   AQYRTDIGDPARLRHAADVRRAGPAQLPDDEEK"
FT   gene            complement(267395..268552)
FT                   /locus_tag="FraEuI1c_0199"
FT   CDS_pept        complement(267395..268552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78287"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6661"
FT                   /protein_id="ADP78287.1"
FT                   /translation="MVARPFEESSAPRAEPPGPPEARREDSFAPAPDQLGPPSGAGFGP
FT                   AAEPPAASGDTVTGAVVVRRGPAQLGELAAADDRTWRRSAAGDYRATRGSHRLGDVDPA
FT                   RDADAWKVGFSPSGEALPDALTDVLLRGSHWVRSAQRVETLRRERSAAIAAHVEAQLAA
FT                   FLELCAEAELVPPVTLRVVRDVPRLARHRGEGRPRAALPTDPPGDPSLTAAPRRGRPSV
FT                   VRATRIGLPDLAEGPTTRPLGRRGAEGDQAHRTGPDRAGRRGRADGDPPSRSRRGGRDS
FT                   AGGGPAPARWHGRNQLTAWPLLYWRCESFPSAGRSLHLFVEPGGRTFEGREDPAPLDGL
FT                   GRQVRVWPVDAPSIVEGMAEVDARRCALHLVDGMARLLWRAGVGL"
FT   gene            complement(268785..270068)
FT                   /locus_tag="FraEuI1c_0200"
FT   CDS_pept        complement(268785..270068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0200"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: fal:FRAAL6660
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78288"
FT                   /db_xref="GOA:E3J4W9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W9"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADP78288.1"
FT                   /translation="MPALVLIGAQWGDEGKGKATDLLGGAVDYVVRYQGGNNAGHTVVI
FT                   GAEKYALHLIPSGILRPDCVPVIGNGVVIDPGVLLAEMAGLRARGIDTSRLLISASAHL
FT                   IMPHHRALDRVTERYLGKARIGTTGRGIGPAYGDKVARTGIRVQDLLDPGILRQKLELA
FT                   LREKNQVLAKVYNRRKIEVDAVVAEYLDYASQLGPHIADTGLVLDTALRAGKVVLLEGS
FT                   QGTLLDVDHGTYPFVTSSNPTAGGAATGAGIGPTRISRVIGIIKAYTTRVGSGPFPTEL
FT                   DDKVGDELRRIGGEFGVTTGRARRTGWYDAVIARYAVRVNGLTDLFLTKLDVLSGFDTV
FT                   PVCVAYDVGGTRMAEMPMTQTEFHHAKPIYEEFPGWHEDISEATSFDQLPPEARDYVRA
FT                   LEEMSGAPISAIGVGPGRDQTLVLRDLL"
FT   gene            complement(270209..270640)
FT                   /locus_tag="FraEuI1c_0201"
FT   CDS_pept        complement(270209..270640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0201"
FT                   /product="protein of unknown function DUF3151"
FT                   /note="PFAM: protein of unknown function DUF3151; KEGG:
FT                   fal:FRAAL6659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78289"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4X0"
FT                   /inference="protein motif:PFAM:PF11349"
FT                   /protein_id="ADP78289.1"
FT                   /translation="MTSPSGRPDLLGGPPATLLPTEPGATALAAGKAAVDVAAEFPASS
FT                   AAWAALAEGALDGGRAVEAYAYARTGYHRGLDVLRRSGWRGHGPVPWSHEPNRGFLRAL
FT                   AALGRAADAIGETEEVTRIRAFLVDCDPSAPDQLGPLAP"
FT   gene            complement(270670..271422)
FT                   /locus_tag="FraEuI1c_0202"
FT   CDS_pept        complement(270670..271422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0202"
FT                   /product="Transglycosylase-like domain protein"
FT                   /note="PFAM: Transglycosylase-like domain protein; KEGG:
FT                   fal:FRAAL6658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78290"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4X1"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ADP78290.1"
FT                   /translation="MPSEQTGQLRPAERRTGGRHRAQPQGPSTTVRVLRTTGAVTALVG
FT                   SGLAVTAMPAGAATPDDFARLRQCESGGNYSINTGNGFYGAYQFDVRTWQGLGYSGRPD
FT                   QAAPAVQDEAAYRLYNSRGWSPWPACSRKLGLSSNGPIGVSSSASGGSLQQALQPAEPA
FT                   MTLDKAKAEVQSSGFHGTISAADANKVRADAYVWQNQMHDQGFALAVDGKFGAQSQGVA
FT                   ALYSYLTKVSDGQPGVVGENLWNATVTG"
FT   gene            complement(272171..272983)
FT                   /locus_tag="FraEuI1c_0203"
FT   CDS_pept        complement(272171..272983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0203"
FT                   /product="Transglycosylase-like domain protein"
FT                   /note="KEGG: fal:FRAAL6657 N-acetylmuramoyl-L-alanine
FT                   amidase (autolysin); manually curated; PFAM:
FT                   Transglycosylase-like domain protein; Peptidoglycan-binding
FT                   domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78291"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E3J600"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ADP78291.1"
FT                   /translation="MSGGHCAPPTACRAHAGNASVRDTSTRHHRPATARIADTPDRPHR
FT                   SATPVRKEPRRALTHPTRRIRQGIAAVPVIVAAVGGAIAVATPASASSTWAQLRQCESG
FT                   GNYSANTGNGYYGAYQFSQGTWASLGYSGLPSDAPQAVQDEAALRLAQRSGFGQWPLCG
FT                   RGMGADQLAPGASASAVPQASRSANRTSLAAPAVNTTAQLPFTTALVGQYRADVAHWQE
FT                   RMTAIGYPLAVDGSYGPVSAAAARQLQAAKGLVVDGVVGPQTWAATFA"
FT   gene            complement(274806..275837)
FT                   /locus_tag="FraEuI1c_0204"
FT   CDS_pept        complement(274806..275837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0204"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: fal:FRAAL6655 fructose-bisphosphate aldolase;
FT                   TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78292"
FT                   /db_xref="GOA:E3J601"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3J601"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADP78292.1"
FT                   /translation="MPIATPDVYAEMLDRAKAGAFAYPAINVTSSQTLNAALRGFADAG
FT                   SDGIVQVSTGGAEYLSGPTVKNMVLGAEALAEFAHHVAKAYPVQIALHTDHCPADKLDT
FT                   YMRPLVAISRERVKAGRNPLFQSHMWDGSAVPLEENLKLAEELLADCKAANIVLELEIG
FT                   VVGGEEDGVVGAIDEKLYTTPEDMWRTAEVLGTGEKGRYMMAATFGNVHGVYKPGNVKL
FT                   RPTILRDGQQYVAGKLGLAGDAKPFDLVFHGGSGSDLSEIREALDYGVVKMNVDTDAQY
FT                   AFTRPVADHMLKNYDGVLKVDGEVGIKKTYDPRTWGKSAEANMAKRVVQACEDLRSAGT
FT                   AIG"
FT   gene            276234..276953
FT                   /locus_tag="FraEuI1c_0205"
FT   CDS_pept        276234..276953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0205"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   fal:FRAAL6654 putative integral membrane protein (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78293"
FT                   /db_xref="GOA:E3J602"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E3J602"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADP78293.1"
FT                   /translation="MDVDHLSGLTLYLTVFAIVFLESGVPIGFWLPGDAMLFATGLMAA
FT                   NPAHRISLPVLAAGVTVMAVAGVCLGYVTGRRLGRPWLERRHRKVLDRTETFYDRFGPV
FT                   TLIAARFVPWARTFAPILAGAVRMPPARFLVAAAVGALVWGTGIPALGYAASSVPGLKD
FT                   ATGWLAPAVVALSLAAGVPGELLRRRARRNRAATDLAVAEPTEPDGSTDPAVETPGAVR
FT                   PGSDGSTAFAGAERGPA"
FT   gene            277461..278696
FT                   /locus_tag="FraEuI1c_0206"
FT   CDS_pept        277461..278696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0206"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   fal:FRAAL6652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78294"
FT                   /db_xref="GOA:E3J603"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J603"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78294.1"
FT                   /translation="MARVVVTGAAGFVGGAIAHALRGRGDDVVALDVARGPGVHAADVS
FT                   RPGDWEKELVGADLVVHAAAVGMGGVGELPPIRAGRPAGSSRVPAAQMRQVLLGGTATV
FT                   LDAAARGRVGRVIHLSCVSALGPDLADGVDETAPVGLTGDPRADTLAAAEQAVGAATAS
FT                   GLPATILRLGDAYGPRAGRWTVWPVLLLRAGRFVLLDGGTGWLNPVHIDDVVAAAIAAA
FT                   GSEAAVGEVLHVTGPEPATVAEFVGCYSRMLDLPAPRSVPARMYGALDDATHAVGRLRG
FT                   RVESRRQASGEPEPTAAGRPEHGAADRAGVPAVGAAEHPDATGPSTGAVALGLVRGIGS
FT                   RLAAGVDPRQRMDLGPLAVADVTRSGRLAGDRITAVTGWQPRVDLADGMGRTETWLRDR
FT                   GLLGVNEPSRTR"
FT   gene            278783..279319
FT                   /locus_tag="FraEuI1c_0207"
FT   CDS_pept        278783..279319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0207"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6651 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78295"
FT                   /db_xref="GOA:E3J604"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3J604"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78295.1"
FT                   /translation="MADDGPTLTTARLQALPVTLWNAGYVAEELARKVALASRPPPGLG
FT                   VGGLFAGPDARGTAEPAALRRELRLRAGAGPSMPTWVVRDHDGDPVGLLGADTRARRAA
FT                   VAVVIDAAVRRRGYGAEMIRALASWLETHRFALVETRVRADDPAAERLARATSFQPTQV
FT                   VIVTGWRVWCRPPPR"
FT   gene            279736..280791
FT                   /locus_tag="FraEuI1c_0208"
FT   CDS_pept        279736..280791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78296"
FT                   /db_xref="UniProtKB/TrEMBL:E3J605"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6649"
FT                   /protein_id="ADP78296.1"
FT                   /translation="MSVDTPRPVSAATPPAEVTYDHLIIPPHWRRPEDSVAGAPNPLFP
FT                   SADGQPHPASGPHPMTGPLLVGTTARAFAKLDDIIRLSTEDKAVIDARRDEAERALRAI
FT                   FPPRCALPLVGVATIGSAGRDTMIRPLDEVDIFAVFSAANSAWKRFRWDSRDLLLCVRN
FT                   AIGGDRVQTIGTRGQALRVVYDTPPDVHLVPAFDHPRAGYVMPDRIGGWLPTRPERHAS
FT                   WTEDLGPRVISAVRLLKAWNRVCGSHLRSFHIEALAGTVLAGRGLNTRQALATVFRHMD
FT                   EAGLSMADPADVGGDLSTYLRPDDLAALGESVRMARAYAEKAVAAEGDGRHEEAVALWA
FT                   AIFGPEFPTFG"
FT   gene            complement(280883..281614)
FT                   /locus_tag="FraEuI1c_0209"
FT   CDS_pept        complement(280883..281614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cne:CNF00590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78297"
FT                   /db_xref="UniProtKB/TrEMBL:E3J606"
FT                   /inference="similar to AA sequence:KEGG:CNF00590"
FT                   /protein_id="ADP78297.1"
FT                   /translation="MLSIRVTSRRFQATAAAVALAFSAALAGCSAGSDSAAGTPAPSVA
FT                   SESTAKLDPMDYIYTQGPETAGFKLDQSSAGAGDPTSHDDAIFLDIDGCLGKNVGAPTA
FT                   VATGPTLTSQDGFTSVDSNAEIVTTAQRAAHLQELKDPRLDGCIKKLMGQSSGSGASQD
FT                   ETIKSLTWRTAPVPAGALARVAYTGQVTASGAKTSVYLDVVFLGAGRVENEVALFSAIR
FT                   PPDETLVSAVTAQLAAKLKSQ"
FT   sig_peptide     complement(281504..281614)
FT                   /locus_tag="FraEuI1c_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.721 at
FT                   residue 37"
FT   gene            complement(281759..283954)
FT                   /locus_tag="FraEuI1c_0210"
FT   CDS_pept        complement(281759..283954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78298"
FT                   /db_xref="GOA:E3J607"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J607"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6646"
FT                   /protein_id="ADP78298.1"
FT                   /translation="MRWSRDSAQSAQQAARRHRHRVERLAEWPIGRCGRWVAVVLWLAL
FT                   ALVATPLAGRLGNAQTNDAAAFLPPNAESTQVLAAQRQLPGGDAIPAVVVFTRPTGRLT
FT                   AADQAAMKAAGAQLAPFAAAPVTPAAPAPDGRAALMIVPVAQSANADAFADEINRMRAV
FT                   VRKLAPPGLQTSVTGPAGVIVDTYTSFRGVETPLLFVTAAVVAVILLVVYRGPFLCLVP
FT                   LVAVGAADQAATAIIYLLARHGGLTVNGQSAGILRVLVFGAGTDYALLLIARYREELTR
FT                   HAAATEAMRVALLRAGPAVLASAGTVVLSLLCLLLGELNSDRGLGPVGAVGIAVAFLTM
FT                   GTLLPALLVICGRRLFWPQIPRIAAPAVTTSLKDAGNPDVVGAWARAGLLIARRPRPIW
FT                   LVTSAVLAGLTVGIVTFHIGLTDRGAFRHPIDSIIGEERIAAHFPLGASAPTFVIGASD
FT                   SAARLGDVIDATPGVATAVVDGTGAGLTQFLVVLRDPPDSAAAAATIDRLRARVRPVPG
FT                   ADALVGGTTAVNHDIAQAAMRDRQLVIPLVLVVVLVILGLLLRAAVAPLVLILTVVLSF
FT                   LASLGVSALVFRGVFHFAGADPSLPLFGFIFLVALGVDYNIFLMTRVREEAMHTDARTG
FT                   VLRGLAVTGGVITSAGVVLAATFSVLFIFPLVQLAEIGFLVAFGVLLDTLVVRSILVPA
FT                   LALDLGRVMWWPSRLSRPPTPPADLLAPDVVVSEDVP"
FT   gene            284407..285207
FT                   /locus_tag="FraEuI1c_0211"
FT   CDS_pept        284407..285207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmu:100045974 similar to H02F09.3"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78299"
FT                   /db_xref="UniProtKB/TrEMBL:E3J608"
FT                   /inference="similar to AA sequence:KEGG:100045974"
FT                   /protein_id="ADP78299.1"
FT                   /translation="MGNGHMPSTARRTRCAIALGAAATLVVAAAGCGVLGGSKSASDSP
FT                   TPTPETSTAPATASAAPATVQAGSSVSAQAKDFVLTTSSGFSGFSATTGGTASSAGTSP
FT                   LAKLASCLGATGSAVRDGSIDRAESTHLTNKITGITLWSDAQVVPAGQLDRDTGLLRDP
FT                   NFTECVTSQTQKDAIADQQATGNQLIDPEAVTRDAPLPTGALARTSVVVLGGSSTGGQM
FT                   QLFYDTIYLGSGQVEAQLHLVGTIDPPSEDLISVAVKQLTAKLG"
FT   sig_peptide     284407..284496
FT                   /locus_tag="FraEuI1c_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.563 at
FT                   residue 30"
FT   gene            complement(285223..286182)
FT                   /locus_tag="FraEuI1c_0212"
FT   CDS_pept        complement(285223..286182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0212"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   fal:FRAAL6645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78300"
FT                   /db_xref="GOA:E3J609"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:E3J609"
FT                   /inference="protein motif:PFAM:PF04227"
FT                   /protein_id="ADP78300.1"
FT                   /translation="MCGAYRADMPEIEVSTEVRDALAAGQPVVALESTLLAHGLPAPRN
FT                   REFAAELEQLVRDHGAIPATIAVLDGVPTVGLDDAARDRITDPAATVLKLSVRDLAPAT
FT                   ALGHTGATTVASTAWLAARAGIRVFATGGLGGVHRGGDEGSDGFSYDESADLPTLATTP
FT                   ITIVCAGVKSILDVGATLERLETLGVTVLGWQTSDFPGFYLPGTGHQLDWRVEDAGEVA
FT                   AVMAAADELGTPAAVVVAHPVAQADALDRDLHDRVLADALAAASRAGLRGKAVTPFLLA
FT                   AFHRETAGASLEVNLAVVRGNAAVAAAVSTAHAGRRHA"
FT   gene            286410..287135
FT                   /locus_tag="FraEuI1c_0213"
FT   CDS_pept        286410..287135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78301"
FT                   /db_xref="UniProtKB/TrEMBL:E3J610"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A4657"
FT                   /protein_id="ADP78301.1"
FT                   /translation="MDFGGKIHSPRSGRHFFRVVVPTGFAALGLALAACGSTGSSSSGA
FT                   AAGPKLDPSAYVLTSGSAATNGYKAEPNTDTTESTAFQDPVPKCMHLSSGDLGPASTAH
FT                   ANGDMFSDDDGTAIESGARVFGSADTVTRHVDLVHRADFPNCLAQAVMGELSKSGGMDG
FT                   ATVRSATAAPPPAGVTALTRIVFNVSASGSTVQVNVDLISIFRGRVESVILVVNPLTQA
FT                   SPDTLTALSGQVVGKLANQ"
FT   sig_peptide     286410..286547
FT                   /locus_tag="FraEuI1c_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.625 at
FT                   residue 46"
FT   gene            complement(287442..287642)
FT                   /locus_tag="FraEuI1c_0214"
FT   CDS_pept        complement(287442..287642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_2114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78302"
FT                   /db_xref="GOA:E3J611"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E3J611"
FT                   /inference="similar to AA sequence:KEGG:Krad_2114"
FT                   /protein_id="ADP78302.1"
FT                   /translation="MPDDVFRRLRELAEAADRPLEEYLLAELARITATPTMDEVLDRIE
FT                   SRGSGRFGLQQAVDDLEAERR"
FT   gene            complement(287839..290109)
FT                   /locus_tag="FraEuI1c_0215"
FT   CDS_pept        complement(287839..290109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0215"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: fal:FRAAL6636
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78303"
FT                   /db_xref="GOA:E3J612"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E3J612"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADP78303.1"
FT                   /translation="MALRIAIGGAITLIALAIAGRRFFWLFRLIQTGQPAEGRLDDIPT
FT                   RIWSEVSEVGGQRKLLKWSVPGLAHAFTFWGFTVLILTIIETFGGLFDEDFHIPWFGHW
FT                   AGIGFIEDFFAVAVLAGLATFAVIRVKRAPARLERKSRFYGSHLGPAWVILGMITAVIV
FT                   TLLITRGAQWNTGNLPQGKTKWAFASYAVSRVFSPLGHTANDAIETTFLLINLAIIMGF
FT                   LVLVAYSKHLHIFLAPINVVLKREPKALGALGTTPDIETLMEQDEPIIGAGKVEDFSWK
FT                   AMLDFSTCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHLFAKAPYLLGGTDTESRDAA
FT                   WDAAVAKAHEGHDHAPGEGHDHGDHDEHEVHGVPESGFARVAEPGKAQAERPLVGTAEE
FT                   GGVIDPDVLWSCTNCGACVEQCPVDIEHVDHIVDMRRYQVMIESAFPSEAGVMLRNLEN
FT                   NGNPWGVSPRSRTEWTDGLPFEVKVIGEGEQIPEDVEYLFWVGCAGAIEDRAKKVSRAF
FT                   AELLDMAGVKFAILGSQESCTGDPARRLGNEYLFQEMAKANIELLNETGVKKIVATCPH
FT                   CFNSLSKEYSGLGGNYEVVHHTQLLGKLVEEKKLVPITPIESSVTYHDPCFLGRHNKVY
FT                   TPPREILEAIPGLRGQEMHRCKDRGFCCGAGGARMWMEEKIGTRINANRVEEALGLDPD
FT                   VVSTACPFCIVMLSDAVTEQKLAGTAKESVEVLDVSQLLARSLAAPAAPTQDAPGAEPA
FT                   PMS"
FT   gene            290632..291828
FT                   /locus_tag="FraEuI1c_0216"
FT   CDS_pept        290632..291828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0216"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: fal:FRAAL6637
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78304"
FT                   /db_xref="GOA:E3J613"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E3J613"
FT                   /inference="protein motif:PFAM:PF08378"
FT                   /protein_id="ADP78304.1"
FT                   /translation="MATITKPATTNTRTGQPGSYLYSEYRRGREHQALVRRDRLGRVLP
FT                   RSLAKSVPVGLLVCLVLTFGVGLPGGFGFGVFALIVVGWSSVIVVSAFGRDNEIETLRL
FT                   GAEAERKTARALARLRRAGWTVLHDLEVPSADAVVGHLVIGPAGVLVINSEARKGVVRY
FT                   TKKVATVDSEPLTAAIERDAFVSTQIKTELQAKVPLIKLSVYPVMVMTEADVLWKDGAV
FT                   NGVTIINIRRIFDFARDRPRRLNPVEVKEVVAAVRTLFPPFVDNRSLEQVTIGRDQWLM
FT                   LMETLHAIRDRDGDATDLMDRLATLEAQLSRGGDGFARVGIPPGPDDPTGFEELPELAD
FT                   DGGPGSPDDREGIIRSLRPSGRGVSRRRPGGRPSLASVRPEPDPPATGTDDTPGGPEL"
FT   gene            292187..294016
FT                   /locus_tag="FraEuI1c_0217"
FT   CDS_pept        292187..294016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0217"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: fal:FRAAL6639 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78305"
FT                   /db_xref="GOA:E3J614"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E3J614"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADP78305.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGEPTVIANAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKMKVDNKDFTPQQISAFILQKLKRDAE
FT                   AYLGETVTDAVITVPAYFDDAQRQATTEAGTIAGLNVMRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGDGVVEVKATHGDTHLGGDDWDQRITDHLIKTFQGQHGV
FT                   DLAKDKMALQRLREAAEKAKIELSQSTQTTINLPYITASAEGPLHLDVSLTRAEFQRMT
FT                   QDLIDRCKIPFQQAVKDAGIKVAQIDHVVLVGGSTRMPAVVDVVRDLTGGKEPNKGVNP
FT                   DEVVAVGASLQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIERNTTIPTKRSEIF
FT                   TTAEDSQPSVQIQVFQGEREMAAYNKKLGMFELTGLPPAPRGVPQIEVTFDIDANGIVH
FT                   VSAKDLGTQKEQSMTITGGSALPKDDIEKMVRDAEQYAEEDKQRREEAETRNQGESLVY
FT                   STERFLAENGDKVEATLKADVEEKLADLRAATAGTDIAAIRTATEELGKASTAMGQSMY
FT                   AEAQAAGAAGGAAGAQADDDVVDAEIVDEEGKQ"
FT   gene            294013..294699
FT                   /locus_tag="FraEuI1c_0218"
FT   CDS_pept        294013..294699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0218"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: fal:FRAAL6640 heat shock
FT                   protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78306"
FT                   /db_xref="GOA:E3J615"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E3J615"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADP78306.1"
FT                   /translation="MSSPHNAGSAEEPPVVVRDRRRIDPRSGEVRAQAAAESAAGGESA
FT                   AAEAAAGGSGATGDAELLALIESLNLAVQERTADLQRLKAEYDNYRRRVERDRQLIAEQ
FT                   ATGRLLAGLLPTLDDIGRARDHGDLEGPFKAVAESLEVALEALGLERFGAVGDEFDPVL
FT                   HEALMHSYRGDVTAPTCVQVFRSGYSMGGRVLRVAQVAVAEPVDEPEPAEPADADAPPP
FT                   ADDTDA"
FT   gene            294844..296019
FT                   /locus_tag="FraEuI1c_0219"
FT   CDS_pept        294844..296019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0219"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="KEGG: fal:FRAAL6641 heat shock protein (HSP40),
FT                   co-chaperone with DnaK; PFAM: chaperone DnaJ domain
FT                   protein; heat shock protein DnaJ domain protein; DnaJ
FT                   central domain protein; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78307"
FT                   /db_xref="GOA:E3J616"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J616"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ADP78307.1"
FT                   /translation="MSVRDMVEKDYYAALGVPKDAPAADIKKAYRKLARELHPDKNPGD
FT                   AKAEARFKEVSEAYDVLSDERRRREYDEARALFQSGRFSGGPGGFPGNGGGYGSGYAGT
FT                   GAGGGFGGSSGGINMDDLLGGFGDLFQRQSPGRGPKRGVDIEAEVTISFEKSLTGLEAT
FT                   VRIPGAATCATCNGLGSRPGTMPRTCPVCRGLGVISRSQGGFALSEPCRECLGKGQLID
FT                   HPCPDCHGSGRREREQRIRIPAGVADGQRLKVRGRGTPGERGGSPGDLEVTVHVQPHPV
FT                   FGREGPNLTIALPITFSEATLGASVRVPTLDGAPLTVKVPPGTSSGKRLRAKGRGVPKT
FT                   GGGNGDLIVTVEVAVPKPTDLSPKARTALQEFALAHPGDPREALMAQLGQQ"
FT   gene            296043..296162
FT                   /locus_tag="FraEuI1c_0220"
FT   CDS_pept        296043..296162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78308"
FT                   /db_xref="UniProtKB/TrEMBL:E3J617"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP78308.1"
FT                   /translation="MLPAGPLAAGRREPDRHGIAGESIPLTRNHCRRTRPSNR"
FT   gene            296231..296788
FT                   /locus_tag="FraEuI1c_0221"
FT   CDS_pept        296231..296788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0221"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: fal:FRAAL6642 putative heat shock protein
FT                   HspR; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78309"
FT                   /db_xref="GOA:E3J618"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E3J618"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADP78309.1"
FT                   /translation="MNNPRANRTSDPPTGGPASPLGADDPQGAPGHRAGPGAPRPSYPL
FT                   PGRGGPAHDDDAPVYVISIAAELAGMHPQTLRSYDRLGLVTPGRTAGRGRRYSARDVAL
FT                   LREVQRLSQEEGVNLEGIRQILQLGAQVLALQAEVVRLHEELAKARAEADRRVSEAHAS
FT                   HRRDLVPVDRGAIVVWRPGPRR"
FT   gene            297243..298010
FT                   /locus_tag="FraEuI1c_0222"
FT   CDS_pept        297243..298010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78310"
FT                   /db_xref="UniProtKB/TrEMBL:E3J619"
FT                   /inference="similar to AA sequence:KEGG:Sked_00700"
FT                   /protein_id="ADP78310.1"
FT                   /translation="MHGQGWGRRLRRGACVGVAATAMAVLAAGCQSGGDPTIAPAPEVT
FT                   SAVTTPVVTTPPATPPQDLKATDYVLTAGPETDGFDGSGGADEDTTDPAARARIAACVG
FT                   VPDYNPAEPFDRSSGDTFVGQQDQMTQASSQAKILSAAQVRQDASIVTNPRFADCMRAE
FT                   LVSSIGDKPIGGETYKILSVRSLSHPDGITAFFRTTMEVSNADTTQRFFMDVAYFYVGQ
FT                   VAVELDFQNFDSPMPASTEQAMAAQITDKLTDQ"
FT   sig_peptide     297243..297326
FT                   /locus_tag="FraEuI1c_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.702 at
FT                   residue 28"
FT   gene            complement(298220..298975)
FT                   /locus_tag="FraEuI1c_0223"
FT   CDS_pept        complement(298220..298975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dan:Dana_GF19065 GF19065 gene product from
FT                   transcript GF19065-RA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78311"
FT                   /db_xref="UniProtKB/TrEMBL:E3J620"
FT                   /inference="similar to AA sequence:KEGG:Dana_GF19065"
FT                   /protein_id="ADP78311.1"
FT                   /translation="MMLTRIRAGWAGAAVAAVAVFTLCSCGSTVGANSATSASTAPRTA
FT                   EASVATSSKKLDPLAFVYAQGAETKSFTVTSAASAYSDLTDPDISPFRLVATCLGTTVE
FT                   PPIAAGDGVGLSLNDGEVAVNSSTQIVSPAQRARDDETLRDPRFGSCFQQTLVDWVKGA
FT                   GEPNDAVHWGEVAPRNARVPAGASARVLFALPILDNATNQQVQVMVIDVVFLSSGQIED
FT                   QLSVTSLANPANDLVLTATAQMAGKLKQQ"
FT   sig_peptide     complement(298871..298975)
FT                   /locus_tag="FraEuI1c_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.433 at
FT                   residue 35"
FT   gene            complement(299331..299807)
FT                   /locus_tag="FraEuI1c_0224"
FT   CDS_pept        complement(299331..299807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mdo:100014802 similar to ataxin 2 related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78312"
FT                   /db_xref="GOA:E3J621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J621"
FT                   /inference="similar to AA sequence:KEGG:100014802"
FT                   /protein_id="ADP78312.1"
FT                   /translation="MQTSGVNPGSTATERAPAPERSLPRGTSRRRMAFAFALVSLALAA
FT                   LTACWPPAGGPGSHPPPHGKPGIGTAIVWGDCPGGSHHCPLLTITSTGTAPLKITAVDA
FT                   PPAPLFEGILTNGCIGTFAPGQSCEVQFGQTIGSGSAVISDNVPPGTQTVTFSV"
FT   gene            300571..303198
FT                   /locus_tag="FraEuI1c_0225"
FT   CDS_pept        300571..303198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0225"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; AAA ATPase central domain protein;
FT                   Clp domain protein; Clp ATPase-like; KEGG: fal:FRAAL6643
FT                   ATP-dependent protease, HSP 100, part of multi-chaperone
FT                   system with DnaK, DnaJ, and GrpE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78313"
FT                   /db_xref="GOA:E3J622"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E3J622"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADP78313.1"
FT                   /translation="MNPDRLTARSQEALASAISRATGDGSPLVDPLHLLTALLAQPEGI
FT                   ATALLTAAGTSVDAIRQRAENAVGRLPHATGTSVSPPQLSRQLVTVLDRAEREAGRLGD
FT                   EYTSVEHLVIALAEEGGEAGRTLTAGGATADRLRGAVETVRGGARRVTSRDPEGSYRAL
FT                   EKYSLDLTERARAGKLDPVVGRDAEVRRVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRVVAGDVPESLRGRRIVSLDLGSMVAGSKFRGEFEERLTSVLNEIREAEGQIITFIDE
FT                   LHTVVGAGAAEGSMDAGNMLKPMLARGELRMIGATTLDEYRKHIEKDPALERRFQPVMV
FT                   GEPSVEDTIGILRGLKERYEVHHGVRITDAALVAAATLSDRYVTARFLPDKAIDLVDEA
FT                   ASRLRMELDSRPVAIDALERAVRRLEIEEMALSNESDEASKARLDRLRRELADKREELN
FT                   GLTARWQREKDAIGEVQRLNEELDQARRMTEIAERDLDLARAAELRHGTIPALEKRLAE
FT                   AAAALGAKGGGAAEPMLNEEVGPDDVAEVVATWTGIPAGRLLEGETAKLLRMEDELHTR
FT                   VIGQDEAVRAVSDAVRRARAGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERA
FT                   MVRIDMSEYGEKHSVARLIGAPPGYVGFESGGQLTEAVRRRPYSVILLDEVEKAHPDVF
FT                   DVLLQVLDDGRLTDGQGRTVDFRNTILIMTSNLGSQYIADPTLSAQAAASMVQGAMREA
FT                   FKPEFINRLDGYVIFSQLDKENLTRIVDLQLDRLRQRLADRRITLAVTEAAKSWLADKG
FT                   NDPIYGARPLRRLVQTAVGDQLARELLSGQVHDGDEVAVDVGADESGLVVRPATAANLD
FT                   RKTL"
FT   gene            complement(303215..303811)
FT                   /locus_tag="FraEuI1c_0226"
FT   CDS_pept        complement(303215..303811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0226"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: fal:FRAAL6635 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78314"
FT                   /db_xref="GOA:E3J623"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E3J623"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADP78314.1"
FT                   /translation="MLLSDRDIRAEITAGRVCLDPYDPGLIQPSSVDLRLDRAFRVFQN
FT                   HRYSHIDPAAEQEDLTELVAPEGDEPFVLHPGEFVLGSTLEVITLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVATLPIKLWPGMKIGQLCLFRLSSPAEHPYG
FT                   AAIYGSRYQGQRGPTPSRAYRDFTRAAVPPVADQA"
FT   gene            304197..305009
FT                   /locus_tag="FraEuI1c_0227"
FT   CDS_pept        304197..305009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0227"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="KEGG: fal:FRAAL6634 glucose-1-phosphate
FT                   phosphodismutase; beta-phosphoglucomutase; TIGRFAM:
FT                   beta-phosphoglucomutase family hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78315"
FT                   /db_xref="GOA:E3J624"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J624"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ADP78315.1"
FT                   /translation="MLGLPDHIDAVLFDLDGVLTSTAEVHARAWKEMFDDFLDDWARRS
FT                   GDPEEPFDIDRDYEQYVDGKPRLDGVRSFLASRDIHLPEGAADDPPSGLTVNALGTRKN
FT                   ILVLDKIAKDGVQAYPGTMRYLRACVAAGKHRALVSSSANAGAVAESAGFADLLEARVD
FT                   GLTIDERGLAGKPAPDTFLAAARELGVPPERAAVFEDAEAGVAAGRAGKFGFVVGVDRV
FT                   GRGHADALRAHGADIVVGDLADLLSGDPAPGTPPTGTGRTDGTSGSAQ"
FT   gene            305006..307375
FT                   /locus_tag="FraEuI1c_0228"
FT   CDS_pept        305006..307375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0228"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: fal:FRAAL6633 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78316"
FT                   /db_xref="GOA:E3J625"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E3J625"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADP78316.1"
FT                   /translation="MNEQATYTVDPWGLREIGFDAEDPARSESLFSLSNGHIGLRGNLD
FT                   EGEPHGLPGTYLNSVHELRPLPYAEAGYGYPESGQTVINVTNGKLIRLMVDDEPLDVRY
FT                   GELRSHRRSLDFRDGVLVRQAEWESPAGQVVRVTSRRLVSFSQRAVAAICYEVESLTDS
FT                   PRVVVQSELVANETLPARIGDPRAAAVLESPLIPELNFARDTTVELVHVTRHSQMRVAA
FT                   AMDHVIDGPGSIGVLSECEPNSGRVTVTGILKPGQKLRIVKFLAYGWSQQRSLPAMRDQ
FT                   AAAALVAARATGWEGLLDEQREYLDAFWKRADVEVDGDAEVQQAVRFALFHVLQAGARS
FT                   ERRAIPAKGLTGPGYDGHAFWDTESYVLPVLTYTSPGAAADALRWRHSTLKLAQERAQL
FT                   LNLKGAAFPWRTISGEECSGYWPAGTAAFHVNADIADAVSRYVNVTEDFEFERAVGLEL
FT                   LVETARLWRSLGHHDLDGKFRIDGVTGPDEYSAIADNNVYTNLMAQKNLRAAADAARRH
FT                   PDRAKEFGVDSEETASWRDAAEDMYIPFDENLGVHPQSDGFTGHELWDFERTRPEQYPL
FT                   LLHFPYFDLYRKQVVKQADLVLAMQRRGDAFTPEQKVRNFAYYEGLCVRDSSLSAAPQG
FT                   VMAAECGHLALAHAYLREAALMDLHDIEHNTSDGLHMASLAGSWIALVEGFGGLRDHGS
FT                   VLAFNPRLSEGLSRLAFGLCVRGRHLRVEVTNSAATYTVQEGEGITLTHHGERFHVEPN
FT                   LPLTLNIPPAPRREHPRQPAGREPRFFHTPTDPEDD"
FT   gene            308160..308558
FT                   /locus_tag="FraEuI1c_0229"
FT   CDS_pept        308160..308558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78317"
FT                   /db_xref="GOA:E3J626"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E3J626"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2948"
FT                   /protein_id="ADP78317.1"
FT                   /translation="MAMMADGVRALSFTRHAVGSMRELPVQRAVFTAACEAHGWSAGGS
FT                   VCQIGRGLRAWWSVVRMVRSGAYDVVVVDTWERMSATEAGQLWVLALLQRSGVRLLVAR
FT                   DGIDTGDPVGHGLGCALLDIWGREAVAR"
FT   gene            308555..309075
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0230"
FT   gene            309499..309738
FT                   /locus_tag="FraEuI1c_0231"
FT   CDS_pept        309499..309738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lrl:LC705_02817 predicted ORF"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78318"
FT                   /db_xref="UniProtKB/TrEMBL:E3J627"
FT                   /inference="similar to AA sequence:KEGG:LC705_02817"
FT                   /protein_id="ADP78318.1"
FT                   /translation="MNDELPTVMLRLWLADAIVLFDWLSNTDLNLVPITHPAQKQALAD
FT                   LQSRMEWDIDTDLENVTDEEIAAAQAEVARDMGW"
FT   gene            complement(310167..310364)
FT                   /locus_tag="FraEuI1c_0232"
FT   CDS_pept        complement(310167..310364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78319"
FT                   /db_xref="UniProtKB/TrEMBL:E3J628"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP78319.1"
FT                   /translation="MRGAITIAKVCGSNVLRRPRLAFSHQNEATVKTSAHVATTAAEVN
FT                   QAPELLLVWLLMTVIMTQAY"
FT   gene            310832..312220
FT                   /locus_tag="FraEuI1c_0233"
FT   CDS_pept        310832..312220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78320"
FT                   /db_xref="GOA:E3J629"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E3J629"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_4401"
FT                   /protein_id="ADP78320.1"
FT                   /translation="MLEKPAILRRLIARYGALRELDGYTPQSRGVEFNRLLAEVLDCYG
FT                   ISAKSSVRGQGEIDVAFSINGTRFILEAKWEEEKTDYGKIAKLQGRVRQRLVTTVGVFA
FT                   SMSGYTDDALSIGIGGRLDVLLLDRRHLEAMISGVVPPDELFDLLIDKTSYEGGVFHDL
FT                   EDLFPSPAGDPQLKFGCPDDLQGRLVRSAREGITAEVVAHDLPMSYFGMALDSAGRLIL
FT                   NYPEGLVRVDLERGRARWMAPFTKCYLHVLPTAAGDILFGRMYGVGSLSGGRLRALAGG
FT                   FAGNAILFSDDEGHARALDNGGVRDWSPEFPGEANVSLALIGENLGDERWTATDVPGAT
FT                   VGGATWAHSGKVAAVGSSALEMIDAASGARTSFQHDLTNTFSVVSYDDNRVLVVADGRS
FT                   LAVIDVAAKTSTVLLELELNGSVSELSRASGEVFYLLSTYGEGPTKQPRAIVVRISLPS
FT                   ALTV"
FT   gene            complement(312338..313140)
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0234"
FT   gene            complement(313217..313348)
FT                   /locus_tag="FraEuI1c_0235"
FT   CDS_pept        complement(313217..313348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78321"
FT                   /db_xref="UniProtKB/TrEMBL:E3J630"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP78321.1"
FT                   /translation="MSSTQTAPPPTDTDEIEGLTLVDDLDTFEPTSLTGCGDDNPYR"
FT   gene            complement(313314..314477)
FT                   /locus_tag="FraEuI1c_0236"
FT   CDS_pept        complement(313314..314477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0236"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sfu:Sfum_4009 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78322"
FT                   /db_xref="GOA:E3J631"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3J631"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADP78322.1"
FT                   /translation="MPYRLIASPFLDHHLLVTPGSNQGVKISPDRYQALQTLDTEDGDV
FT                   PVWLTAAAKQRWGIDLAGAIAGSVLVRQPTALNYGRASHEVNLGCNYDCEHCYLGLKKF
FT                   DGLEWDDRVRLLHTIRDAGVLWLQLTGGEPMIDRHFSDVYALAFDLGMMIDVLSNGSRL
FT                   ANPGILDLLTRRPPHRITLSIYGATEASYDGLTRRRGAFKAFSAGLAAAHEAGIPMDLS
FT                   IGVTRSNAHEVDQMRALADRYGLPHSLYGNISPTIYGGAEVLASQAPEILGPRTPFTGC
FT                   NAGHTFFHVDPFGKASICKVGREPNIPLLDEGLDGLARLGTIADGLLQRQGGCTGCTLQ
FT                   GTCGTCMPLVTLFRKANAPLRNYCQHKETPHGRRQLHVVHPDRAATH"
FT   gene            314672..315931
FT                   /locus_tag="FraEuI1c_0237"
FT   CDS_pept        314672..315931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0237"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: XRE family transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78323"
FT                   /db_xref="GOA:E3J632"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J632"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78323.1"
FT                   /translation="MDAGDRPISGNLRDLRRTAGLSQEELAGRTGLSVSTVRKVEQGGS
FT                   ARVETLHVLARALGVETSALFGSQAPKPADAEEENKLNLVAFRHALTPAVGFGGSTRRV
FT                   DGLVAAGIERESLGRDLRAAVTRYHADDFEGVARGLPRMVAATNELVRQSAGDEVASLA
FT                   AQRLRSDVLQLAGWFLTQVRQYDLAYVALRDAVADGESSDDRLSVAASVISQCWLFIRQ
FT                   GRFSDAELLAGDAATQIEPRMSEASKEELAAWGWLLLRGSAAAIRNNRSDESREFLRLA
FT                   EVAAVRHDGQPRRMAAGYHQYWSTFDVSTVRMKIAEALMIDGDASGVLRVAEGVQAPRR
FT                   AGRSDNYSRHLLDVAGAHAALRNYQDAIDILSSLRSTTPDWLRHQRRAGDLVGGLVTSR
FT                   KRRVGQDLRELAGFFGSTGS"
FT   gene            316077..316598
FT                   /locus_tag="FraEuI1c_0238"
FT   CDS_pept        316077..316598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_4928 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78324"
FT                   /db_xref="UniProtKB/TrEMBL:E3J633"
FT                   /inference="similar to AA sequence:KEGG:Gobs_4928"
FT                   /protein_id="ADP78324.1"
FT                   /translation="MGAPVHVASLADGSGALFAPVLPVDLPPDEAGLLTRSERSAAAGG
FT                   ASGWEFAPARRAGLMRLAVERAGVPGVSSVVVCPAGMPVERTALALAVGEILRTRRPGG
FT                   AAVVTCAAVPAWLGVDRSAVVHPVLVRAGTQAVTSRHVEYPVVVVPGDVGRKGRVGAVP
FT                   GGGRDLLARD"
FT   gene            complement(316846..316916)
FT                   /locus_tag="FraEuI1c_R0004"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(316846..316916)
FT                   /locus_tag="FraEuI1c_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(316907..317362)
FT                   /locus_tag="FraEuI1c_0239"
FT   CDS_pept        complement(316907..317362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_47850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78325"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:E3J634"
FT                   /inference="similar to AA sequence:KEGG:RER_47850"
FT                   /protein_id="ADP78325.1"
FT                   /translation="MSSAHEHEHEHDSLRRVGEIALALPEATRVDIEAWDGEPTFRVRG
FT                   KNFVFANPQGSQLTVKLPKDEAAAVVAAEPDAKPAGYGLGRHGWVSLTVSPEATDDRWD
FT                   QIAEWIRISYTSSLPGAWPASSTQPTDGRPSTRRRHPLGCSSSITRV"
FT   gene            317628..318212
FT                   /locus_tag="FraEuI1c_0240"
FT   CDS_pept        317628..318212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_3837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78326"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3J635"
FT                   /inference="similar to AA sequence:KEGG:Namu_3837"
FT                   /protein_id="ADP78326.1"
FT                   /translation="MTTDGETDDAIVPDGKDWTWVLGRACPECGFNAATFPAFDVSGLV
FT                   LRVASAWRLLLGGQPAEDLRRRPAPGHWSPLEYGCHVRDVLRLYDERLVLMLTRDNPRY
FT                   PNWDQDATAVADRYGEQDPAQVAEDLATAAARVAARFATVAGPQWQRTGERSDGALFTV
FT                   DSFARYFVHDPVHHLYDVNGLPGGGVAPVAS"
FT   gene            complement(318409..320481)
FT                   /locus_tag="FraEuI1c_0241"
FT   CDS_pept        complement(318409..320481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0241"
FT                   /product="ABC transporter transmembrane region"
FT                   /note="KEGG: fal:FRAAL4919 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter transmembrane
FT                   region; ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78327"
FT                   /db_xref="GOA:E3J636"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E3J636"
FT                   /inference="protein motif:PFAM:PF00664"
FT                   /protein_id="ADP78327.1"
FT                   /translation="MNGPGPMGGPGPMGGPGPMGGPGPGDRGPWTGPGGPGPGWGPGGG
FT                   PGWGPGGPRPQRPPGGWQAVRLWRLMRGHSRPVALGVTLTVIGTLCAIVQPLLVKRVID
FT                   AAQHGGMSGWLLVLLLSLFVGQAVIDTAGHYLLERTGQGILLGLRTRLVNHLLRLRISV
FT                   YDERRMGDLISRANTDTVVVREAVAYSFATFLTSLIGALGAVALMIYIDARLFALVVGA
FT                   VLFAGVFVLGALRRVRTTSEQGQASVGRMTADLERSLTAIRTVRASRAEEREAERIDVH
FT                   AKEAYRLGIRMARLNSVIAPAMELAIQGSVLVVLLVGGVLVAHHVTSLGSLVAFLLYAT
FT                   YLVVPLSQLIESAGIMQRGLGALDRVDAVFDLPREQDATGSATALGDGSGGAEADGSAL
FT                   GASPVDEVGGRLVRILPPDAATWSADRAEEPAGSGATAAPAVEFRDVWFGYTPERPVLR
FT                   DVSFTVPQRGHIALVGPSGAGKSTALELLERFYDPDRGEILLQGVDMREMSRDAARSQV
FT                   NLVEQNAPVLQGSLRDNIAYAAPDSSDAEIDNAVELARLGDLVSRMPRGVWTEVGDHGV
FT                   LLSGGERQRVAIARALLARPSVLLLDEPTSQMDSVNERALTQVMHDIATERALLVIAHR
FT                   MSTVRAADRIIVMDEGRVIATGTHDELVETCPLYARLSATGLDPAVPAGAATTAT"
FT   gene            complement(320658..321176)
FT                   /locus_tag="FraEuI1c_0242"
FT   CDS_pept        complement(320658..321176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4920 putative polyketide
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78328"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:E3J637"
FT                   /inference="similar to AA sequence:KEGG:FRAAL4920"
FT                   /protein_id="ADP78328.1"
FT                   /translation="MTMPMSMRRRTPAPPLTRRLLASVAVVAARALATQPPARIHAVLT
FT                   AVSRGARPASLARTETARADVVAVSLVCRGARGCVPRSIATALLCRMSGSWPTWHAGVR
FT                   SVAPFAAHAWVEAGGQLVGEEEPPGYFRPLMTVPPPARTGPSTPDQVRVTADPSAEEPG
FT                   SRRHQAVAK"
FT   sig_peptide     complement(321075..321176)
FT                   /locus_tag="FraEuI1c_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.940 at
FT                   residue 34"
FT   gene            complement(321268..321693)
FT                   /locus_tag="FraEuI1c_0243"
FT   CDS_pept        complement(321268..321693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78329"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:E3J638"
FT                   /inference="similar to AA sequence:KEGG:SAV_5688"
FT                   /protein_id="ADP78329.1"
FT                   /translation="MLTLNRSVVSTDTDYGTALLDERSGRYWTLNPTAALALRVLLDGG
FT                   DPPQAARALLDQYDVAPATARADVDKLVDDLQAAGLITGSVSGSGIEPPAGTTPPASGG
FT                   SATGASAAGGQHRSGTRARHALRSALGRSSRPRTSDR"
FT   gene            complement(321687..323645)
FT                   /locus_tag="FraEuI1c_0244"
FT   CDS_pept        complement(321687..323645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0244"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; KEGG: fal:FRAAL4922
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78330"
FT                   /db_xref="GOA:E3J639"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3J639"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ADP78330.1"
FT                   /translation="MTHPLTTPAPLATAAPWFVVLPDTPAGAALAGTLQAADPTIAALR
FT                   RPSGRPWLIGRWAGDEIVDAVAGRSRMALLGCAPISHDRLAARLASARDLGALDQVALE
FT                   LPGSFHLVAEIEGCQRVQGTASGLRRVYHAALGGEAGIIAGDRADVVAALADLDRIDVG
FT                   AVLLCLVDPVAPHPLDDRPLWQGLTAVPPDHWLCVEQGHPSHRRWWLAPEPTLDGAEGA
FT                   AALRQALVTAVAARTAAGGTVTADLSGGLDSTALCFLAATGPAALVPYTGLGRDPADDD
FT                   ARWAALARAALGVETFEMLPRDRLPLVYEGITEVEEPLDRPFIGVIDRAKLLAGLRLAA
FT                   RHGPRLHLCGLGGDEVAESMPNYLAGLALGHPLAAWARLRPLRAQSRWPLAATLRTLRP
FT                   RSYRDWLAALARPAGGPPARGRRHLVPPERVAELDWSMPPRIGAWLTPDATELLRATIE
FT                   QAAATAEPLGPTRDRHGDLFAIRVGAAVARGFAQLAAPTGPPLAAPFYDDRVIEAALAV
FT                   RPEERSTPWEYKPLLKAAMAGLVPTACLRRETKAECSAEEEAGLRAHQTALRGLFDGSR
FT                   LAELGLVDTDRLLGLCRYSAAPDRHYLALQQTAAAESWLRAAGRRPSSGGPPHQSARPA
FT                   TVPAAGSPEPEPLERTC"
FT   gene            complement(323796..323966)
FT                   /locus_tag="FraEuI1c_0245"
FT   CDS_pept        complement(323796..323966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3398 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78331"
FT                   /db_xref="UniProtKB/TrEMBL:E3J640"
FT                   /inference="similar to AA sequence:KEGG:Strop_3398"
FT                   /protein_id="ADP78331.1"
FT                   /translation="MKARYDTPMLDAAGEFSEVTDGRWGWGRDWLWRSFPRYYGGGGGA
FT                   IIIVGGGGRRY"
FT   gene            complement(324495..325316)
FT                   /locus_tag="FraEuI1c_0246"
FT   CDS_pept        complement(324495..325316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0246"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain-containing protein; KEGG:
FT                   fal:FRAAL4923 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78332"
FT                   /db_xref="GOA:E3J641"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3J641"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADP78332.1"
FT                   /translation="MDVDVEPGTGVVRFAALGPLELLAADGAPVFIGQRKKRRLLALLL
FT                   LHAGGWVSTEQIAVALWEDDPPRSALGNIKTYVSELRRALPPASGDRTDGHDADPGSPF
FT                   GRILSRDGEYLLRLAPNEFDIELFDAGACAGEEALAAGRPAEATVLLDRALALWRGQPY
FT                   DDLPADIAVAETSRLDELRWAVWENLVDARLRLGQHNRVLPALRALTIQHPTRERLWAQ
FT                   LLAALGQDGRRAEALNAYQTVYRMLTERLGIEPGEDLRLEHQRILNGDQHR"
FT   gene            325619..326518
FT                   /locus_tag="FraEuI1c_0247"
FT   CDS_pept        325619..326518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0247"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   fal:FRAAL6624 putative glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78333"
FT                   /db_xref="GOA:E3J642"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E3J642"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADP78333.1"
FT                   /translation="MCQMFALTSGSQPVEATFWLLDSPDSERALSARVPDGAGLATFGE
FT                   DRAPRIVKQPISSRAGADFAYQPRTVVSSTFIAHVRHASTGRTSLANTHPFQHAGRVFA
FT                   HNGVIEELDRLDDQLGEYRGLVQGDTDSERYFALINREIDAQGGDVGAGIVAAARWIAA
FT                   NLPLYSINMVMATADELWALRYPDTNRLYVLSREPGGQNSRHLDHASPFSEIRARSLDL
FT                   ADRPAVAVESERMDEDPAWRLMASGELLHVAADLTVTSRVVISIPPARQLSLDDLSPEA
FT                   AFSQVVNVAPAETTPTSA"
FT   gene            326816..326902
FT                   /locus_tag="FraEuI1c_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            326816..326902
FT                   /locus_tag="FraEuI1c_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(326827..328473)
FT                   /locus_tag="FraEuI1c_0248"
FT   CDS_pept        complement(326827..328473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0248"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: gbr:Gbro_1190
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78334"
FT                   /db_xref="GOA:E3J643"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:E3J643"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP78334.1"
FT                   /translation="MNVKTEKRCGCRDPETKKKYPRGGCPRIEDRGHGTWAWRIWVPSE
FT                   LVPLVGKKEISGSGCRTKRDAEKAADEAVGNIRAGQQHVGRLTVGQYLDEWLEGKRRLR
FT                   PSARRTYESHLRVHLKPWLGKVPLVGLRADHIDKAFRQIEAAGASKPQPTGPATIERIR
FT                   DTLRNALNDAVDRRLIPFNPVRGVELPEYSQPEIEPWEAHEVGTFLDEASTDRLAAMWE
FT                   LIGLHGVRRGEACGASWPGLDTERSVLTIGQQITESGGQHGVWAPKTRSGRRKVDLDST
FT                   TLGSLLAHRIAQDSERDDIGPAWDNGTLPNEHGEPVHLEGLIFTRPDGQYLRPGYVSAR
FT                   MQVIARRAGLLGAVRAAAQAEARTLAVGVRQRDIDPRGTWTLYVDRVPVGEVTVTGVTR
FT                   LRGNGALLDLAVPLAGDVPARAELGRGLLSRRRLHDLRHSSASIQLSEGIDLALVSKRL
FT                   GHSSPAITGALYAHLLRPAGQRAAETVAKAVPRSARSGHPLGTDAVLGSGDASPRQSGE
FT                   ANLLVESGGRGIRTHDEVAPIAVFKTAAIGH"
FT   gene            complement(328470..329240)
FT                   /locus_tag="FraEuI1c_0249"
FT   CDS_pept        complement(328470..329240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0249"
FT                   /product="Xre family DNA-binding protein"
FT                   /note="KEGG: rer:RER_33300 Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78335"
FT                   /db_xref="GOA:E3J644"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:E3J644"
FT                   /inference="similar to AA sequence:KEGG:RER_33300"
FT                   /protein_id="ADP78335.1"
FT                   /translation="MTQDAAPRPLREVVGEAARKIRETAKRRQDDVARGARLMGLPWSR
FT                   AKVGALENGAKAVSVEELVTLALVLTQVCGRTIRVPDLLDADDLVILTPHLQVPAREVA
FT                   KSLAGQNSLGALDPAIALTPAGHKAVLAEVESLAREKRANAELFLLVTRIQRLGLKGDL
FT                   DAWAAEIGEAEQKTARRLDEPAVVLVALSHELWGRTLSEERDRVADEREPDASPDRRRA
FT                   LRGQVTRALVNELAAELARRDHIAAPVGTDGTDR"
FT   gene            329378..329569
FT                   /locus_tag="FraEuI1c_0250"
FT   CDS_pept        329378..329569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0250"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: gob:Gobs_1452 transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78336"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E3J645"
FT                   /inference="similar to AA sequence:KEGG:Gobs_1452"
FT                   /protein_id="ADP78336.1"
FT                   /translation="MTEELMTSRQVSEFLNVPAATLRTWRLRGSGPQSFRLCGTVRYRR
FT                   SVVEAWLAEQEQAGQVGR"
FT   gene            329566..329946
FT                   /locus_tag="FraEuI1c_0251"
FT   CDS_pept        329566..329946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_5423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78337"
FT                   /db_xref="UniProtKB/TrEMBL:E3J646"
FT                   /inference="similar to AA sequence:KEGG:Snas_5423"
FT                   /protein_id="ADP78337.1"
FT                   /translation="MNLASDPLAAATPGGRAEGGRVTAADLDSRRLANLTTPPAPHLTR
FT                   AEARRIRRAALAELRGRWPIDRLRALPATTDLATAGSILGMAEDKARELARAGDFPAPL
FT                   IRHGDRYVVPTRPLLALLGIDR"
FT   gene            330034..330912
FT                   /locus_tag="FraEuI1c_0252"
FT   CDS_pept        330034..330912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbr:CBG18769 Hypothetical protein CBG18769"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J647"
FT                   /inference="similar to AA sequence:KEGG:CBG18769"
FT                   /protein_id="ADP78338.1"
FT                   /translation="MGYEIRRWLRVELGPKVVGLPRLVALEIADDANEITRLSYADLAD
FT                   LAAWTAAKDTKAVKDALLRLAAQGWEFRRAIGKGADGRPLYAVPGRKLTFWVPEGPKSV
FT                   GPLKGQGPNLVGPKGPNPVTEGPNPVTEGPNPVTEGPNPVGPISSAISSAIPSKSSAAD
FT                   RQSAKGLDPHLTDRPVGVAAAELVESHPADPGRWTEHERHELRRQAAALLGSGIPELHV
FT                   AEGLRRLAGRPDGGVGLLRNLTHDAVRGKPARRPRRERTFDPNATVSYHHQPGEEARCE
FT                   VLDIEDWRQGG"
FT   gene            330909..331583
FT                   /locus_tag="FraEuI1c_0253"
FT   CDS_pept        330909..331583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0253"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   stp:Strop_4005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78339"
FT                   /db_xref="GOA:E3J648"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J648"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADP78339.1"
FT                   /translation="MTTLDRTIRLGGAVARCGQLRIPTGVAPAADPIPTGETPEDVTAR
FT                   LAAQAAGRLARYRRQRPAAYAAASLGDLGPNERAAIWRWLESDSLTLVITGPVGTGKTH
FT                   AAFAAANWAAGQGTIPAAWTVPDLMVDLAPEGDPSAAHVTRTAPLLLLDDLGVEKTSEW
FT                   RVEQITALIDNRLGNGLRQIVTANADYDALARRYGERAMSRLTARAGLVRLTGADRRRV
FT                   TW"
FT   gene            331580..331879
FT                   /locus_tag="FraEuI1c_0254"
FT   CDS_pept        331580..331879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0254"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: ank:AnaeK_0248 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78340"
FT                   /db_xref="UniProtKB/TrEMBL:E3J649"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0248"
FT                   /protein_id="ADP78340.1"
FT                   /translation="MTAPLPVPPELAGEPPQPGPATGLPDGIDALLDEIAAARVTRVRR
FT                   RRQQVADFQTGHLERRRHGLAARHAAKLARLAADTAGTPDAVPSAADLEEDNPQ"
FT   gene            331876..332097
FT                   /locus_tag="FraEuI1c_0255"
FT   CDS_pept        331876..332097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_1952 ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J650"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1952"
FT                   /protein_id="ADP78341.1"
FT                   /translation="MTPTATSSPDGPPRCRICCRALRSHHSAALGMGPTCARRVDPDAM
FT                   APLVHAAHNAAEAVQLGLVDLGEAARHG"
FT   gene            332090..332392
FT                   /locus_tag="FraEuI1c_0256"
FT   CDS_pept        332090..332392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:745557 hypothetical protein LOC745557"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78342"
FT                   /db_xref="UniProtKB/TrEMBL:E3J651"
FT                   /inference="similar to AA sequence:KEGG:745557"
FT                   /protein_id="ADP78342.1"
FT                   /translation="MADQQPEPGQSPRRRPRFPGDGPPPEGASPAEAREWAEQWLRSYR
FT                   ADRRARRVRAGTVAPTTHAEIRMRLDADEQREHRRTARDKRRQNPPSDGGESAPE"
FT   gene            332389..332820
FT                   /locus_tag="FraEuI1c_0257"
FT   CDS_pept        332389..332820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0257"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: sro:Sros_1853 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78343"
FT                   /db_xref="GOA:E3J652"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J652"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78343.1"
FT                   /translation="MTACRPVTPRARGRVGGTGAGEAGPDGMPHRGRTDVFEAAFLRDG
FT                   FGAALRSARQRRGWSRRTLAGRSGVSWSAVRALETGVRRPRAVTVRYLAAALALADPAP
FT                   LAAELLGLAGESLRPDTAGAVRQRRRASPRAVALRACGR"
FT   gene            332817..333524
FT                   /locus_tag="FraEuI1c_0258"
FT   CDS_pept        332817..333524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0258"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: sro:Sros_1850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78344"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E3J653"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADP78344.1"
FT                   /translation="MTATRGVNVARLLGPLGFDAAESEHRVARYEWALEAIGRRLGPTM
FT                   RPEALAALERHLRRLPGRGVVLLVEEAAVADLAALCALRELLGQEPPAGWAPAALLLEA
FT                   LIRRAEALARGVFVPAAVAGDVGRLLRVGLDVAARRDGGDPTASSALVALLTDLAAAAR
FT                   EPLPCTDIGTGHQRAEHRGLSVAEAAARMGCTPSYVRRLARRGAIPARRSGGVWIVTET
FT                   PGDDDEHGGDAAS"
FT   gene            333490..334176
FT                   /locus_tag="FraEuI1c_0259"
FT   CDS_pept        333490..334176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_166062 basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78345"
FT                   /db_xref="UniProtKB/TrEMBL:E3J654"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_166062"
FT                   /protein_id="ADP78345.1"
FT                   /translation="MTTNTAETLPADGMAPDLSDLSSAQLADYLDTSERSAADAGELLA
FT                   GLAELPAAEREEAGVVARARAAIGRRRAEAARREQERRNQASRDRLARVTASIVDRPAD
FT                   SPKVLEAIEQVAAAVATLRAVAAERKQFAKRTSAALLSVGIQPGPRGSAGLWHTRPGFG
FT                   DAVGAGRRMVEPLDPDLLFALAVRRAYGGSLPSGAWQVPQPSSALVAAPDAERLAELLA
FT                   RELGEE"
FT   gene            334232..334645
FT                   /locus_tag="FraEuI1c_0260"
FT   CDS_pept        334232..334645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78346"
FT                   /db_xref="UniProtKB/TrEMBL:E3J655"
FT                   /inference="similar to AA sequence:KEGG:Ndas_0405"
FT                   /protein_id="ADP78346.1"
FT                   /translation="MTGRRATRPVAQRDADWLAAASPDEVSRAHRAGELVELFGGPARF
FT                   EPVEGQQWTAADLDGATADQIGQALARGDLADLLVGREPEPSAPAAPPAAEPALSVIDR
FT                   LYESDPLSANALWSYEERRRGGNGASDDGDAAA"
FT   gene            334649..337330
FT                   /locus_tag="FraEuI1c_0261"
FT   CDS_pept        334649..337330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78347"
FT                   /db_xref="GOA:E3J656"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E3J656"
FT                   /inference="similar to AA sequence:KEGG:Srot_0075"
FT                   /protein_id="ADP78347.1"
FT                   /translation="MASGGTNVGRLFATLDLDTNAFTSGLARAGTMFASFGRGIATGSS
FT                   YAAAGAAALQGIGGAVAVIGQIAPAAALAVPALIGIGAAMFTVKGAFSGVLSAVKAYGQ
FT                   QTGSAANTSRQAEQAAHGLITAQWGLASATNAYNTAVKEAKQNLADLQKLVDRAPTDME
FT                   QASLDLREAQENLAKVQSNGFSSNDQIEEARLAVTRAQYAFEDQTDAVKKNQDALATAQ
FT                   AQGVDGNQSVIDAVHQLTQAQWALADAQRQAQNPAGPNAYAQAMAKLPPLAQAFARQII
FT                   ALRPQLDQLKVSASSMFVGMGSALRDLDTNFPVVNAGVRQLGESIGTVAARTGALFKGA
FT                   QTQAELGTLMSANATSTLNFGSALGVVGRQFLTIGAVAAPILANISGLAGGVADKFAGW
FT                   VQGAAASGQLQAAIQGALGALGQLAQVVTNVGAGLASLFSGIGSSGAGTLNTLVAISQA
FT                   FREIASNTALQSIIQGLGSAFSGVLGSALTQVMGVITGLLPSIQAIMPALQQVLPIFLL
FT                   FAGGPLGPLLKIVGVMGLLGPLADTIGQVLGQAMTAVAPLLGALGTAFTQLLPPLRLVI
FT                   GSLIQSLMPVISQLVPPLTKVATAIGGALVTVLGTLMTALQPVIPVIGSALVMVVSALA
FT                   DVIVQSLPALNSLIQSIVSLLPPLLPLIPAILGLVVAVLPLIPAVLQIAAAILQALMPV
FT                   IVPLISLLVQLISWFVELNTRAVGLVVGLVTDIAGWLVKLIGHFGDLPGLIGKALSGLE
FT                   KLITAPFKAAFNAVSDLWNRSLGSIHFTVPNWVPGVGGKGFSFPTLPKLAKGGTFASSG
FT                   LAIVGDDGPEILSGKPGATITPLSRASGGGGGIVINMSITHNGMISDKQVLDDFAAKIV
FT                   GPLKTQINRYAASNGGSAGLAA"
FT   gene            337429..337947
FT                   /locus_tag="FraEuI1c_0262"
FT   CDS_pept        337429..337947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_28240 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78348"
FT                   /db_xref="UniProtKB/TrEMBL:E3J657"
FT                   /inference="similar to AA sequence:KEGG:Bfae_28240"
FT                   /protein_id="ADP78348.1"
FT                   /translation="MATEGFPGGVDSVKSWLADLFGEEPGRSLWTVLDGPLRLALAQGW
FT                   ILGTSGSRADDLAEELAAADSSHRRFPAMLAALADHWRRVYADLRDGAGVVNLNLLAGA
FT                   DMEAVVLTGQEYGDQVVRQVVGHVFITRLDGDGWHIAALSRKLPIPGWPPTEQEISGLE
FT                   VTSRPLGHA"
FT   gene            complement(337989..338207)
FT                   /locus_tag="FraEuI1c_0263"
FT   CDS_pept        complement(337989..338207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0263"
FT                   /product="ribosomal protein S2"
FT                   /note="KEGG: cyn:Cyan7425_4236 ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78349"
FT                   /db_xref="GOA:E3J658"
FT                   /db_xref="UniProtKB/TrEMBL:E3J658"
FT                   /inference="similar to AA sequence:KEGG:Cyan7425_4236"
FT                   /protein_id="ADP78349.1"
FT                   /translation="MRITIIGTAQECDLAVDALNLLMDTREVSAPEPAEDGQVRVEALI
FT                   LEPISPGYYVEYPPGELDSEETAELSG"
FT   gene            complement(338223..339185)
FT                   /locus_tag="FraEuI1c_0264"
FT   CDS_pept        complement(338223..339185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78350"
FT                   /db_xref="UniProtKB/TrEMBL:E3J659"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1350"
FT                   /protein_id="ADP78350.1"
FT                   /translation="MAPSSTPRPARRAVVVAGALTAAGVALPTASGGSDLRDQLGDAIG
FT                   QTRAAWELLPPITVVDACQHWAHLAEGRPGDDWAALRGQVALLHARALADIGETHPALD
FT                   RAEAARKYARQIGDPQTHAWATLVAAEVHDAAQPGSVVPMRMAAIAAERAGKSWVGVHA
FT                   AVVRACLIGRAGEPGMARVVDAATDADQLVGTLADPTPGEFTAPQAFAFIAVALTRVGM
FT                   FVPARRRLADVADAFSPRSQPGMASAIAIWQAGTELAAGDVLTAGAHAARAVDIAQDRP
FT                   TAWLADSILAQNTRAGGQGGYGKVTARVAGWPSTLTGPV"
FT   sig_peptide     complement(339084..339185)
FT                   /locus_tag="FraEuI1c_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.635) with cleavage site probability 0.195 at
FT                   residue 34"
FT   gene            339372..339605
FT                   /locus_tag="FraEuI1c_0265"
FT   CDS_pept        339372..339605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78351"
FT                   /db_xref="UniProtKB/TrEMBL:E3J660"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2235"
FT                   /protein_id="ADP78351.1"
FT                   /translation="MASDSSPGPQWARAEDLVSFGDVRATLGLSRQRANVIVSRRDFPA
FT                   PWLTTSDGQTRLWRRAEVEVWLDEHRPGWRLP"
FT   gene            complement(339615..340769)
FT                   /locus_tag="FraEuI1c_0266"
FT   CDS_pept        complement(339615..340769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0266"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL2939 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78352"
FT                   /db_xref="GOA:E3J661"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J661"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ADP78352.1"
FT                   /translation="MIAVAASDDEWPALARDLADKVTHPGSRWHPVIASIPRHAFVPAW
FT                   WARSDGGWQLRRGPLAEVYVNQTLVTRVGPHHANHGYPPGGPPVGRSTSSSTLPGLLLT
FT                   MYRDAQLAEGLDIADVGTGSGYGAALLATRYGASHVTTMDVDPYLVEAAAVALDAGGLA
FT                   PAAQVVDATGPLPGTYDRIVSTVSVRSIPPSWLAALRPGGRLVTSITGTWLVLTAWRTA
FT                   DGEIWGKVARHWAGFMPTRSGGDYPPEWADFADLATRDGDEVGAGRYPVLDIDDAWELS
FT                   TMLALAAGVDVEHQYLPPGPDGAHTALMAHPDGSWARATAIGTEAPLVHQGGPRRLWDL
FT                   LDGVRDDWLRMGMAPWLGAHALVRPDGAVVLAMGSWRATIPATP"
FT   gene            complement(340766..341626)
FT                   /locus_tag="FraEuI1c_0267"
FT   CDS_pept        complement(340766..341626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0267"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   fal:FRAAL2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78353"
FT                   /db_xref="GOA:E3J662"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3J662"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADP78353.1"
FT                   /translation="MTLVDDRPSTLRTVQLELTGRCPLACQHCLTSSSPTTAHGSMTPA
FT                   DWLDVVDQVAAAGTPTVQLIGGEPTASPAFGRVLERALGLGRQVEVFSNLHFPAQLWPV
FT                   LDRPGVTLATSYYDTDPTVHDRVTGRAGSHARTRARIVEALARHVPIRVEIIEVIDGQN
FT                   LDATRAELLGLGLPADRIHVDRTRLVGRAAGGEAFDPGELCGRCGHGKAAVLPDGTLAP
FT                   CVMARALAAGDVRTAPLAELLTREVWRAAVAAVPPRASSGCSPDDSACGPDSEACGPDY
FT                   PEVGA"
FT   gene            342047..343300
FT                   /locus_tag="FraEuI1c_0268"
FT   CDS_pept        342047..343300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78354"
FT                   /db_xref="UniProtKB/TrEMBL:E3J663"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2921"
FT                   /protein_id="ADP78354.1"
FT                   /translation="MQLADAASYTSRYLTDVLSGRSVPSVKVVATLERVLAAGGELVAL
FT                   REQAAREQVARRHGLSIPEQTFPAAPRAGSSGAVDVWSPDGAVWTKGPGEEADVDQDRR
FT                   EFLSLAAIVALAGQVSDDIATADPTPRTLDRMEADADELSAQIYDLPTPVLLGRAASQW
FT                   HAAHVLLDRPVSAPVRARLLMVAGAVSCRAAFLGRRTGDLTIQRHFGVLAGQYADESGD
FT                   PLLIGQVAGLRSRTAFSAKQYAKAAALAAAGLNTAHPTQRARLAAYQAEALAAAGRAGE
FT                   ARTALDTMYAESRRTTFRWTTGDQLIFGAVTLSTLGEHRPAADLADAYITGGEFDGEGV
FT                   GWAHVTIGQALFAADRPDPAAAAHHGRLALAATPDADLSVITRVADLHTHLRQAAAGDS
FT                   EVAELGQALAGARASLTA"
FT   gene            complement(343459..345570)
FT                   /locus_tag="FraEuI1c_0269"
FT   CDS_pept        complement(343459..345570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0269"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: sna:Snas_0972
FT                   cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78355"
FT                   /db_xref="GOA:E3J664"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J664"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADP78355.1"
FT                   /translation="MTEPDAGTVTPPGGLLVAGPWAAADAPDEEHTPVAVDQAPAVELD
FT                   GRPWEVPPDRRPVVAPWVRDVRQLRRVAWWAAGEALHPVAFHAARLPLYTGRLAAGSPR
FT                   GAARSAATVARWALDAGGAERLGDVDRKDTPAYLALSAQRDARLRRRLPLVGVSLLAGG
FT                   IGDAVLYTKEPTVFGLTTAAGVLALGAVGRRRDRPLLDSPTTVSGRAPKLTSDIVERAL
FT                   AHCGLPADIAKKITANGLEWVAPIAIDGPGWRAEFDLPYGVTVAEVAEHRDKLASGLRR
FT                   PLGAVWPEPESDAHPGRMVLWVGKDTLAKSKAPAWPLLNRGQADIFAPLPFGFDQRLRP
FT                   VSVPLIFDSILIGAMPRYGKTMALRVLLLGAALDPSVLLYIYELKGTGDLSSPGEQVAH
FT                   RYASGAGNATLAACMDGLREVHAELERRADIIRGLPKSVCPENKVTPELSRRPGSGLAP
FT                   ILFSIDECQELFSSKEHKDEATELAVAIMKRGPALGIILALATQRPSRDSLPLDISANI
FT                   GIRLCLRVAGHVENNMILGTGMSARGVQAYTFTRRDKGIAYLAGVEDDPIVVRGAYLDA
FT                   PAAERVADRARAIRAAAGLLTGHAAGEVVERDEDTPFAFLADAVQVAEDRTHLAVLAGR
FT                   LADGWPERYTTAAGEPWTAQQIGAQLRTAGVEVEPQMWATGTKGTATNAVGVTRDAIRQ
FT                   AIAARSGQA"
FT   gene            complement(345567..346001)
FT                   /locus_tag="FraEuI1c_0270"
FT   CDS_pept        complement(345567..346001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_2063 transcriptional regulator, PucR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78356"
FT                   /db_xref="UniProtKB/TrEMBL:E3J665"
FT                   /inference="similar to AA sequence:KEGG:Amir_2063"
FT                   /protein_id="ADP78356.1"
FT                   /translation="MSAHPKHLLVLPMPCTAGELRAALAGLVDDAPLVDVALAGEDGKA
FT                   VTVEGLTDVVLVVGHADGAPARTVATPGGEPSPPVATPAAAVPAARGTGRRELARLVAA
FT                   VPANDARSARQLAEDLAPSAGLKPASARRYLTDLRAGGTS"
FT   gene            complement(345998..346180)
FT                   /locus_tag="FraEuI1c_0271"
FT   CDS_pept        complement(345998..346180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_5368 TspO and MBR like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78357"
FT                   /db_xref="UniProtKB/TrEMBL:E3J666"
FT                   /inference="similar to AA sequence:KEGG:Mpop_5368"
FT                   /protein_id="ADP78357.1"
FT                   /translation="MIRVLMVLAVLAVLVPVPGVALALVVLAAAGAVARFAVWSYRADP
FT                   PVWRSPGPNWSGRFV"
FT   sig_peptide     complement(346109..346180)
FT                   /locus_tag="FraEuI1c_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.535 at
FT                   residue 24"
FT   gene            complement(346177..346491)
FT                   /locus_tag="FraEuI1c_0272"
FT   CDS_pept        complement(346177..346491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_2451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78358"
FT                   /db_xref="GOA:E3J667"
FT                   /db_xref="UniProtKB/TrEMBL:E3J667"
FT                   /inference="similar to AA sequence:KEGG:Mnod_2451"
FT                   /protein_id="ADP78358.1"
FT                   /translation="MRASTKEAPVIPAALLTPSRAELDAARVRIGDVGAAFSAGYAALG
FT                   LAATGLAGVIRRALAAGDIEAVAVAVRRLEALDQAAAERRAAVIHADQARPALRVVGGR
FT                   "
FT   gene            complement(346488..347309)
FT                   /locus_tag="FraEuI1c_0273"
FT   CDS_pept        complement(346488..347309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78359"
FT                   /db_xref="UniProtKB/TrEMBL:E3J668"
FT                   /inference="similar to AA sequence:KEGG:Caci_2884"
FT                   /protein_id="ADP78359.1"
FT                   /translation="MTGRAYPLPRPDDDPRFTFGLMLDVAAVLARRGYPTLTSGADLVE
FT                   LQQALFGFLYAAAPDDGQQHVEGPAVPAAPVVVERCECGALVADHRGAGWREAGACGSL
FT                   VAFAPATLAGVDSVVCLGTDSEPCGHLGADHSDWGKPGGCRGCGCTRSYDHGKPGDDDA
FT                   AGTVAAAVIGGARWTWRYEGAGIWQRVGSDGALTSRQLRALGAVVTDLPGASADDDDLA
FT                   HRRAGAEAMLRAAERRAGTEADSDGRWTAQAGQLADEIASIDQALQPDGDQ"
FT   gene            complement(347306..347626)
FT                   /locus_tag="FraEuI1c_0274"
FT   CDS_pept        complement(347306..347626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8916 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78360"
FT                   /db_xref="UniProtKB/TrEMBL:E3J669"
FT                   /inference="similar to AA sequence:KEGG:sce8916"
FT                   /protein_id="ADP78360.1"
FT                   /translation="MNALCTRPSSAAEAYAKANAALFALLDDPDVERAAGAADAVEQLH
FT                   ELFAQAAPPAPREPYEPYLTWLASLGDVPSLRYRAGAGDVLTVFASLMAELRAARPEAG
FT                   DR"
FT   gene            complement(347623..348084)
FT                   /locus_tag="FraEuI1c_0275"
FT   CDS_pept        complement(347623..348084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA3833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78361"
FT                   /db_xref="GOA:E3J670"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E3J670"
FT                   /inference="similar to AA sequence:KEGG:MA3833"
FT                   /protein_id="ADP78361.1"
FT                   /translation="MTILDTRPAAAPADPFAALDSFGADTDEMAARFAAVVADFTPAPA
FT                   ATCLGCGRRITAAASVARGYGEGCWRRARRRAALLAGSFSDRQVEQAVEAVEDGAIVPA
FT                   ETPRAWLVVSSKGDEVYQTDGAACDCPAGQSGRICWHLASVALVERAAA"
FT   gene            348222..348431
FT                   /locus_tag="FraEuI1c_0276"
FT   CDS_pept        348222..348431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0276"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   fal:FRAAL5350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78362"
FT                   /db_xref="GOA:E3J671"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="UniProtKB/TrEMBL:E3J671"
FT                   /inference="protein motif:PFAM:PF04545"
FT                   /protein_id="ADP78362.1"
FT                   /translation="MGDVPQLWTTKDIGAHLGISRERARQLSHGDDFPAPVGQVGHIRM
FT                   WSAPDVEAWATEHRPDKADAGDAQ"
FT   gene            complement(348698..349375)
FT                   /locus_tag="FraEuI1c_0277"
FT   CDS_pept        complement(348698..349375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0277"
FT                   /product="Clp domain protein"
FT                   /note="PFAM: Clp domain protein; KEGG: mbo:Mb2686
FT                   ATP-dependent protease ATP-binding subunit ClpX'"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78363"
FT                   /db_xref="GOA:E3J672"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:E3J672"
FT                   /inference="protein motif:PFAM:PF02861"
FT                   /protein_id="ADP78363.1"
FT                   /translation="MEIAEQIIAAVKPLKGDELHQLSAAAWQVARIQIEADVAMRMFVE
FT                   QALEAGASWVEVGGLLGIGHRAARERFGPESTASVAEPFSHYTKDASDSVTAASREART
FT                   LGSPYLGTEHLLLGLLGQPGSRATRVLEWLDVSHASIRDAVNEETVHREAPSAAHLAFT
FT                   GRAQAVLQTHAPREMSRAQAELIDTDILLLALLADEGGIARRVLESSGVTADRVRSWRA
FT                   QAT"
FT   gene            complement(349662..350840)
FT                   /locus_tag="FraEuI1c_0278"
FT   CDS_pept        complement(349662..350840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0278"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: sma:SAV_7028 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain-containing protein; elongation
FT                   factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78364"
FT                   /db_xref="GOA:E3J791"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E3J791"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADP78364.1"
FT                   /translation="MAKQAYVRTKPHLNIGTMGHVDHGKTTLTAAITKVLADGGSGTFI
FT                   PFDRIDRAPEEIARGITINIAHVEYETANRHYAHVDMPGHADYVKNMITGAAQLDGAIL
FT                   VVSAQDGIMPQTTEHVLLARHVGVRHVVVALNKADAADPELTDLVELEIRELLSAHGYP
FT                   GEEIPVVRVSGLRALAGDPTWTASIATLLDAVDSYVPVPDRYTGAPFLLPVENVLTITG
FT                   RGTVVTGAIERGTVRVGDRVEVRGLGTALTTVVTGLETFGKPMDSGQAGDNVALLLRGV
FT                   QRGQIRRGNVVAAPGSVTVHQRFAAQVHLLTAAEGGRRTAIASGYRPQFYLRTTDVAGE
FT                   VDLGEAGLALPGETAELTVELSKPVPLETGLGFAIREGGRTVGAGTVVTVLD"
FT   gene            351255..351659
FT                   /locus_tag="FraEuI1c_0279"
FT   CDS_pept        351255..351659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78365"
FT                   /db_xref="UniProtKB/TrEMBL:E3J792"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6616"
FT                   /protein_id="ADP78365.1"
FT                   /translation="MTVPRLDEATSAAVGKLGEALEWVERARGALYEFHQLSGHADRTL
FT                   AEAIEDLAAAGHPRSAAQLRRELHGRNVLDGRWTFQIVEEYDELYYQPFVASDERIRTR
FT                   FTGGRRHVHEARMKAAERDRAGRDRWGLGA"
FT   gene            complement(351689..352456)
FT                   /locus_tag="FraEuI1c_0280"
FT   CDS_pept        complement(351689..352456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78366"
FT                   /db_xref="GOA:E3J793"
FT                   /db_xref="UniProtKB/TrEMBL:E3J793"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6618"
FT                   /protein_id="ADP78366.1"
FT                   /translation="MAGLTLLRVERIKLFSTRSPWWCLATATVATIALAMLVAGTVTKD
FT                   DLPTFTPAATQFAGRFGSVIMMVMAILAVTTEYRFSTIRVTFLAFPRRTDALLAKTVVV
FT                   AGLAGLTGEVAAIGSWVVSVVLRPDAPLALRYARDFRVVIGSGVVWAIGAVIAIAAGLL
FT                   IRHSAGAISAVMIWNLLLENLLPVIPRIGPHLQDWLPFTAASNFLYDGQPLGTDSALDQ
FT                   PSRLGPWGSLAYFAAFAALLLAIGIIVAKRRDA"
FT   sig_peptide     complement(352322..352456)
FT                   /locus_tag="FraEuI1c_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.431 at
FT                   residue 45"
FT   gene            complement(352444..353565)
FT                   /locus_tag="FraEuI1c_0281"
FT   CDS_pept        complement(352444..353565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0281"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fal:FRAAL6619 putative ABC transporter
FT                   ATP-binding subunit; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78367"
FT                   /db_xref="GOA:E3J794"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J794"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78367.1"
FT                   /translation="MIDARGLTKRYGRTLAVNDLSFTVRSGRVTGFLGPNGAGKSTTMR
FT                   MILGLDRPTAGEVRIGRKRYADLTNPMRHVGALLDAKWVHPNRSARAHLRWLAAANRLP
FT                   DRRVDEVLEIVGLTDVAHRRAGGFSLGMAQRLGIAGALLGDPGVMLFDEPVNGLDPEGI
FT                   LWIRRLMHRLADEGRTVFVSSHLLSEMAVTASELVVIGRGRLIAQTTTAAFTDQASGAT
FT                   VRVRGPEPHRLRAVLTAGGLAVDEVPASDAGPAAFTVHDATTEAVGELAGAAGLVLHEL
FT                   AAQRGSLEEAFLQLTSRDVEYRAGDGYSEPAGFPEPAGYPEPAGYPEPAGYPEPAGYPE
FT                   PAGYPEPAGYPEPAGYAEPAGGLVWEAETSWPA"
FT   gene            354160..354438
FT                   /locus_tag="FraEuI1c_0282"
FT   CDS_pept        354160..354438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78368"
FT                   /db_xref="UniProtKB/TrEMBL:E3J795"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6610"
FT                   /protein_id="ADP78368.1"
FT                   /translation="MSVGRPARRAAGVQQTLPVPLRGLGQPGRGRHVPVTASCGGCDQR
FT                   WTDEAATHCRGCHGHWPDLAGFDEHLPACPAYVSFVPPSRSRARKAS"
FT   gene            complement(354478..356460)
FT                   /locus_tag="FraEuI1c_0283"
FT   CDS_pept        complement(354478..356460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0283"
FT                   /product="putative integral membrane sensor protein"
FT                   /note="KEGG: tcu:Tcur_3716 putative integral membrane
FT                   sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78369"
FT                   /db_xref="GOA:E3J796"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:E3J796"
FT                   /inference="similar to AA sequence:KEGG:Tcur_3716"
FT                   /protein_id="ADP78369.1"
FT                   /translation="MTVAAAVPVPHLTSLASGLAAKEQLSSSCGPSIAVSYLLAAAAAL
FT                   AALTCAARIRLTTDGRRSRGVRGAGWTAAAAVAVGAAVWSTQLAGTVSCEYSGTALFDL
FT                   RLIVMGALVVPLATGAGLAIVATSPASSRRLVVGGIVSGAGWSAASFMTIAALRTTGTL
FT                   GYDLVLAALSVVMNVATATVLCWVAFRPGERYLRDVVAAMLLGAAIRGGYYTALVATRT
FT                   IPDAKDGWSPGLDPFALGLVTAAGSTIVLMFIAVAAVGGLLQPRVAGFGTTTRPWAPRR
FT                   GGTAIRRPTPGFGPDDAHAARPGDGPAPPEPKPAAAPVQVAGVQAPIPVKNAGDGPAPV
FT                   RPGAEAALPVPAGTRAVAVSPAGRAPTQEPPASLAHAELTFEELAYVGRSFTGSVDDAV
FT                   ELLELADDEPADARPAPGQAAIDDVPAVDPEDIAPFDDALAPVAVAAARPAVPPPGGRE
FT                   PAPAGPPPRAAAPDSGELVSVLVPAPLRAPRSESPGSGEQTGEPASDPEVGSGPTRRPT
FT                   VLTPSSPVWTAALPAGVPAGPPAGPPGRRLPPLPSVPPPAPGTVATGAAHAVPWSADPL
FT                   GISVTTAQGAGHDGTHASADEPWTPGQLGGVGPQPRWAVPLWFPPPAWWFLTPALGRHT
FT                   VARHRADDPSAPTRPLRLAPARPEH"
FT   gene            356772..357503
FT                   /locus_tag="FraEuI1c_0284"
FT   CDS_pept        356772..357503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78370"
FT                   /db_xref="UniProtKB/TrEMBL:E3J797"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6608"
FT                   /protein_id="ADP78370.1"
FT                   /translation="MTLCGLLRLDGADVRRSTLTAMLASSSLGLPAARGVHLDGPFGVV
FT                   TAAGRAGGPIPPIVVDDGGLMAVVLAGRGHLRLAGWPACPAGQAGDAGEPSGSARDEDT
FT                   AALSVAAAYRASGERCLRELPPDRLVLVWDPGARRLLVTRTGRFAADLLTWSDGRHLAF
FT                   GTEPAQLLAAFRAPAQVVGPRLDGSGRPRRLVRRLAVGEGISISVTAARRGPRPSRPAA
FT                   LRLVPRPAAPDSADRHRIDRD"
FT   gene            complement(357570..357998)
FT                   /locus_tag="FraEuI1c_0285"
FT   CDS_pept        complement(357570..357998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_7075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78371"
FT                   /db_xref="GOA:E3J798"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:E3J798"
FT                   /inference="similar to AA sequence:KEGG:Kfla_7075"
FT                   /protein_id="ADP78371.1"
FT                   /translation="MTAPSQDPAAVATASPVPGPPSAPATPSRAGAGPDALAKAYRPYR
FT                   VLAYVVGVILVVLVLVAVPLKYAADVPQLVQIIGPVHGVLYIVYLLATFNLATKAKFSL
FT                   RRAILVMLAGTIPFVSFVAERSVTRELKPRLTGTVTER"
FT   gene            complement(358105..358647)
FT                   /locus_tag="FraEuI1c_0286"
FT   CDS_pept        complement(358105..358647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78372"
FT                   /db_xref="GOA:E3J799"
FT                   /db_xref="UniProtKB/TrEMBL:E3J799"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6606"
FT                   /protein_id="ADP78372.1"
FT                   /translation="MTYHRIPPGRVGGSVRDVRRVLKLFSPAWLLRHLLALGLIAFFIY
FT                   MGRWQWTKGESSHGTLQNLFYGIEWWIFTAFVLYLWGKMIGEEIRPSQPNPAPAAEPGP
FT                   EAAVTAADPAATDLRPVTGLAGATTAVARADAPLVFAAVAVPASLTATPADDEDPEDED
FT                   LAAYNAYLANLRTRDSA"
FT   gene            complement(359210..360547)
FT                   /locus_tag="FraEuI1c_0287"
FT   CDS_pept        complement(359210..360547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78373"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6605"
FT                   /protein_id="ADP78373.1"
FT                   /translation="MSLCGKRVPSSTAVDGPEDLAVAGPAVAHQDADLTVARLTSADLA
FT                   HTGSAFGALDDFGTGEPGGTAPVAGRPFGADEPSGPEPLAERFEQVLGEYSVDSASLRA
FT                   RVLTATTAAQRDLAAGKRAADTARRRSRTRPRSTRPAAGPVSARSAGAHRAGAARPRLV
FT                   TAGALAAVVSVIGVSAGIASVVQSQSKPSRVLVTPAPRALVTQPAAPLPAPATQAPDAP
FT                   SATPSAGQSQSTADPTAANGSQSVASTSQQRGAASGRGGQVPSGQDNRPRAVRGWSVAP
FT                   FRSGSELVLPDRNTTDWVVFGDGHGGVVARAAIPFQLLDVSRIAGVGSAQRGYPTSVSW
FT                   TWGTPRPQGSHSTTRLRIPGGRSATIATYRGPHDGKLAFYVGGAASLRVTVSAAGLQSS
FT                   TFTVALPSSTAVVTLDLGGLPYWTPATISISGAGGSSFSLAAAVLD"
FT   gene            complement(360544..361389)
FT                   /locus_tag="FraEuI1c_0288"
FT   CDS_pept        complement(360544..361389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0288"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: fal:FRAAL6604 RNA polymerase ECF-subfamily
FT                   sigma factor; TIGRFAM: RNA polymerase sigma-70 factor,
FT                   sigma-E family; RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78374"
FT                   /db_xref="GOA:E3J7A1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A1"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADP78374.1"
FT                   /translation="MYVDDVNLNELGGPRHGSASAKASRSAARARSAAPSRMTAPPRPA
FT                   SRAFPPSDPTARRIGTATGIPTQAEEFPEPPTADWRPANAGGRPAQAEFEKFFEAHHRE
FT                   LARFAFLLSGDRDAAEDITAEALTSAWVHWDRVQAADNPLAYVRRSVANLAAGRIRRTV
FT                   RERNVLAKLGRQLPIQATNGPDVPAVLDLESALLRLPLRKRQCVILRHGLDLSEAETAD
FT                   TLGISIGTVKSQTSKAVSELERLLAAGGTGAGATASAGAGATARKRPRIRRVALRGGEA
FT                   "
FT   gene            complement(361677..361874)
FT                   /locus_tag="FraEuI1c_0289"
FT   CDS_pept        complement(361677..361874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78375"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6602"
FT                   /protein_id="ADP78375.1"
FT                   /translation="MEALPVGVAARPQDPPPLNPDAPIPDDPGPLLPDGPGDLPPAPHE
FT                   PSPFTEPAPTDPSTPEPEPV"
FT   gene            362033..363019
FT                   /locus_tag="FraEuI1c_0290"
FT   CDS_pept        362033..363019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0290"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="KEGG: fal:FRAAL6600 putative quinone oxidoreductase;
FT                   TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3 family; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78376"
FT                   /db_xref="GOA:E3J7A3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A3"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADP78376.1"
FT                   /translation="MYAVTVDEPGGPEVLEWREVDDPPGPGPDEVVIDVVATAVNRADL
FT                   LQRQGLYAPPPGASDIIGLECSGRIAAVGPGVDGWRVGDEVCALLSGGGYATKVVVPAG
FT                   QVLPVPPGVDLVTAGGLPEVTSTVYSTVFQRAQLLDGETFLVHGGASGIGTFAIQAVRA
FT                   LRPKALIATTAGSPEKLERCRELGADVTICYRDEDFVARVKEATGGRGADVILDNMGAK
FT                   YLARNVDVLAPDGRLVVIGMQGGIKAELNLATLLTKRGAVHAMSLRHRPGEQKAAIVAG
FT                   VRAEVWPAFASGAIRPVIDRVLPLREAAEAHRVVESLGHVGKVLLAV"
FT   gene            363075..363647
FT                   /locus_tag="FraEuI1c_0291"
FT   CDS_pept        363075..363647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0291"
FT                   /product="Protein of unknown function DUF2587"
FT                   /note="PFAM: Protein of unknown function DUF2587; KEGG:
FT                   fal:FRAAL6599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78377"
FT                   /db_xref="GOA:E3J7A4"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A4"
FT                   /inference="protein motif:PFAM:PF10759"
FT                   /protein_id="ADP78377.1"
FT                   /translation="MRLDGDMTDQPEPRVVVVGPDGRLRSPLDGAGAGSDHAGDGGSDS
FT                   PDPRTMISSMVSQPDKVMRIGTMIKQLLEEVRAAPLDEASRLRLREIHRSSIRELSDGL
FT                   APELKDELDRLSLPFDDSQTPSDAEIRIAQAQLVGWLEGLFHGLQTALFAQQMAARAQL
FT                   EEMRRRALPSGQPGQSGQDGFGTGTYL"
FT   gene            complement(363661..365064)
FT                   /locus_tag="FraEuI1c_0292"
FT   CDS_pept        complement(363661..365064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78378"
FT                   /db_xref="GOA:E3J7A5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6598"
FT                   /protein_id="ADP78378.1"
FT                   /translation="MTEASHEIVERALAASRADGCIVIATESSTVNLRWANNTLTTNGA
FT                   ARDRSVTVVSIVGRSFGVRSVSTIEAGTTGVDKLTELVRSAEAAAKDADDAEDYADLLA
FT                   PGQPGAATSPEPFDALAERTSTSVFTRFAADLGEALRAARAEGRGLYGFAEHDLTTTWL
FT                   GTSTGLRLRHSQPTGSVEWNAKNGQPGGSVWHGQATHDFSDVDVAATDAELRRRLGWCA
FT                   RTIDLPAGRYETLLPPSAVSDLILDAYWSAAGRDAAEGRTVFSKAGGGTRLGEAFGPAG
FT                   MTLYSDPADPELSCAPFAVSGHSSATASVFDNGLALGRTNWLDDGKLAALVHTRSSAQA
FT                   AGARPTPFVDNLTMDAGGTATLDDMVASTKRGLLLTCLWYIREVDPEVLLLTGLTRDGV
FT                   YLVENGEVTGAVNNFRFNESPVSLLGRITELGAASRTLGREWADWFKLSRMPAVRVPDF
FT                   NMSSVSPAS"
FT   gene            complement(365096..366661)
FT                   /locus_tag="FraEuI1c_0293"
FT   CDS_pept        complement(365096..366661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0293"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   fal:FRAAL6597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78379"
FT                   /db_xref="GOA:E3J7A6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A6"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADP78379.1"
FT                   /translation="MPTAASPTASRTPPQEVDPEFLALPRAALTDAALQTARDLGVSHA
FT                   DIRIERLRDGSLSFRDGSLETSHDGSTVGFAVRVVHEGTWGFAAGVDLTTDEAVRVTRE
FT                   AVEIARVARPLNTEPIELADEPVHADATWVSAYAVNPFAIDTREKVDRVGGLCRTLLSA
FT                   ADVDHVDGHLNEVLENKYYADLSGTSTTQQRVRLLCQIEATRVDPGGGFETMRTIAPPA
FT                   GRGWEWLVSGPAAGCWDWDAEIETIPGLLAEKAKASSVEPGRYDLVIDPSNLWLTIHES
FT                   VGHATELDRALGYEAAYAGTSFATLDKLGNLRYGSPLMNVTGDRTAPHGLATIGYDDEG
FT                   VAASRWDIVHAGTLVGFQLDRRMAAANAERLGVSRSNGCAFADSPGHVPIQRMANVSLQ
FT                   PAAGGPSTEDLISGVNRGIYIVGDKSWSIDMQRYNFQFTGQRFYEIRKGRIVGQLRDVA
FT                   YQATTTDFWGALDGLGGEQTYLLGGAMNCGKGQPGQVAAVSHGAPSTLFRGINILNTRH
FT                   EAGR"
FT   gene            complement(366954..367793)
FT                   /locus_tag="FraEuI1c_0294"
FT   CDS_pept        complement(366954..367793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78380"
FT                   /db_xref="GOA:E3J7A7"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6596"
FT                   /protein_id="ADP78380.1"
FT                   /translation="MTEPSLSSLGSGVSAQELIIVGICLTALAACLGKSRLAVFLGIPT
FT                   LLVTGLASVIGWLTGIGDTGPADSTTRPTAPPARALPAGSGTDPTAGAGARGHSYWPVW
FT                   ILGTTTLLIAVVAGLLLFTAVTRARREDFVLDGAAHGHGDHNDDLDDDPHPVWADDRDV
FT                   TEPDTGPPRTKPWPSLDAGSPRGDTFSTRMNQLAHDFMKHVVAHHDRPAVVDLQAPVTQ
FT                   RFVTAFTYATDLFLDRSPRDPVLMSAAISEAERRWTLVKQDHGHLGDDTGNPRIDEW"
FT   gene            368309..368695
FT                   /locus_tag="FraEuI1c_0295"
FT   CDS_pept        368309..368695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cwo:Cwoe_3608 chromosome segregation
FT                   ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78381"
FT                   /db_xref="GOA:E3J7A8"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A8"
FT                   /inference="similar to AA sequence:KEGG:Cwoe_3608"
FT                   /protein_id="ADP78381.1"
FT                   /translation="MVLVLAIAACGSGACHAVFVDGRDVWVVGDRLPQRASGRDGDPAR
FT                   TTVRVDLTVFEPATARLRAAFHAAGTDPAEIDELAESVRAGSAYVVGSAATTPPESIGV
FT                   ASHEAAVIARRLPSKVVGQLALAA"
FT   sig_peptide     368309..368362
FT                   /locus_tag="FraEuI1c_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.533 at
FT                   residue 18"
FT   gene            369095..369292
FT                   /locus_tag="FraEuI1c_0296"
FT   CDS_pept        369095..369292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78382"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6594"
FT                   /protein_id="ADP78382.1"
FT                   /translation="MQPTPLVTVCGSGGCPTVFTTEDDAVIVQGYLPEPRLSEGVPTGE
FT                   ARVVIPRELLNEAARRLLAS"
FT   gene            369362..370282
FT                   /locus_tag="FraEuI1c_0297"
FT   CDS_pept        369362..370282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0297"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: fal:FRAAL6593 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78383"
FT                   /db_xref="GOA:E3J7B0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78383.1"
FT                   /translation="METDDRSGRHHDPSETVGAALARLRRESGLTGVEVAKRSGVSQGQ
FT                   ISKIENSRVTPSQADVVRFAGALDLPGALVADLVERSRQAQALARERRRGANRSVAANQ
FT                   EDYLEEEGRARHLRAFEPILVPGLLQTSEYARRVINRFYAVIYGDDRQGWPDTAAAVRL
FT                   RLERQERLYDPDRDFKFIISESALRARFGAKDYWPLLMAAQIQRIESACELPNVEIRIV
FT                   PTDTSLPFPAIEPFEIMDDAVVITESTAGSSRRDRDGVEIYARVFDRFWSSSTPDVLPI
FT                   LSRYKTEFLEESTKVAKSEDAGTGQ"
FT   gene            complement(370418..370993)
FT                   /locus_tag="FraEuI1c_0298"
FT   CDS_pept        complement(370418..370993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0433 exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78384"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B1"
FT                   /inference="similar to AA sequence:KEGG:Adeh_0433"
FT                   /protein_id="ADP78384.1"
FT                   /translation="MSMLTVYATLTGTNRDQLYTRLSWLTRQYLRYTAAKPGQPARLDA
FT                   FSDEARSMAGALGDAVRILVDRDQENSRTALVGAVRRAEDSWQKVQIDLHRSGTTWADL
FT                   RVRPGYRRDLPVQRVTGGETPQRLTLVHDSRTVEATRRAEARLAQSRAAAGRVPDAPAT
FT                   GRGGSDSRIAEKVSVGSAGHRRELTPQR"
FT   gene            complement(371530..371733)
FT                   /locus_tag="FraEuI1c_0299"
FT   CDS_pept        complement(371530..371733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78385"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B2"
FT                   /inference="similar to AA sequence:KEGG:Ndas_1292"
FT                   /protein_id="ADP78385.1"
FT                   /translation="MRLIPLTDHDCGTNSCPQVYASDHGTIVVQGTLVTDDTVQPAPGE
FT                   VLVEIPAEIFRAAAAAVSDRPA"
FT   gene            372190..372402
FT                   /locus_tag="FraEuI1c_0300"
FT   CDS_pept        372190..372402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78386"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6594"
FT                   /protein_id="ADP78386.1"
FT                   /translation="MELVPLAQSSCGTSTCPGVFEASDGSVVVQGYVVPTQRYADGVPD
FT                   GEARVQIPRDLLIRAARSLPDWDGQ"
FT   gene            372486..373400
FT                   /locus_tag="FraEuI1c_0301"
FT   CDS_pept        372486..373400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0301"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: fal:FRAAL6593 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78387"
FT                   /db_xref="GOA:E3J7B4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78387.1"
FT                   /translation="MADDIVDVVPSLGVPALGAEPGSSTLAGELGRALAGLRKRKGMTG
FT                   EELGRAIGASQAKISKIERGALRPSPLDVEKIVLALDGSKDALHELVGQATELQALSSR
FT                   PRLPRRGPVNQQDYADLESRATLVRDFEPITVPGLMQISEYTRRVINAFHAVDIGDHES
FT                   KWAETAAKVTQRLQRQERLYDTNKTFEFILLENLLNNMYVTPGYMLAQVDRIEQIAKLP
FT                   NVTVRIVPMTAQLGLPPSHGFMIFDDDVVVTESLDATVYQDRRSVEFYTHFFESYRELA
FT                   NADLFEVLERYKARYADMAMPKP"
FT   gene            complement(373622..374410)
FT                   /locus_tag="FraEuI1c_0302"
FT   CDS_pept        complement(373622..374410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0302"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: fal:FRAAL6592 hypothetical protein; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78388"
FT                   /db_xref="GOA:E3J7B5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B5"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADP78388.1"
FT                   /translation="MSPPAIVATDLDGTLIRSDGTVSERTRRALRRVREHGATVVFVTG
FT                   RPIRVMADVVAKTSVAGIAVCANGALVYDLDAQTTVNHRELDQRAALRLAQAIREMVPD
FT                   VAFAVESGLRFGREPGFRTMWPDPLELVADLADLLVTLPPIKLLVRRSGESLADVYEKV
FT                   VDLAGAEAVVTRSTETLIEIAGAGVSKAVALAEVATARGVTAADVVAFGDMLNDLPMLA
FT                   WAGHAVAVANAHPQVLAAADEITASNDQDGVALVLERLFD"
FT   gene            374639..374902
FT                   /locus_tag="FraEuI1c_0303"
FT   CDS_pept        374639..374902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0303"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="KEGG: fal:FRAAL6591 phosphoribosyl-ATP
FT                   pyrophosphatase; TIGRFAM: phosphoribosyl-ATP diphosphatase;
FT                   PFAM: Phosphoribosyl-ATP pyrophosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78389"
FT                   /db_xref="GOA:E3J7B6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B6"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADP78389.1"
FT                   /translation="MKTFDELFVELSAKWQDKTPGSGSVAALEAGVHHIGKKLVEEAAE
FT                   SWMAAEYETGERAAEELSQLIYWIQLMMISRGLTPDDVYLHL"
FT   gene            375021..375866
FT                   /locus_tag="FraEuI1c_0304"
FT   CDS_pept        375021..375866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0304"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   fal:FRAAL6590 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; Histidine
FT                   biosynthesis protein HisG domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78390"
FT                   /db_xref="GOA:E3J7B7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B7"
FT                   /inference="protein motif:TFAM:TIGR03455"
FT                   /protein_id="ADP78390.1"
FT                   /translation="MLRIAVPNKGALSAASSQLLGDAGYHVKRDGAELVVADVENDIEF
FT                   FFLRPRDIAVYVGAGRLDVGITGRDLLLDSGVPARELVALGFGHSTFRYAAPKGAIADV
FT                   AELDGLRIATSFPGLVRADFAARGLTAQVVTLDGAVETAVRLGVADAVADVVETGRTLR
FT                   AAGLELVGEPVMRSEAIMITKQGAELGSAQERLLRRVQGVLVARRYVIMDYDAPTDVLE
FT                   KACEITPGFESPTISPLAREGWVAVRAMVLKDDVNRTMDDLWDLGARGILVSAIQACRL
FT                   "
FT   gene            complement(376068..376772)
FT                   /locus_tag="FraEuI1c_0305"
FT   CDS_pept        complement(376068..376772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0305"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="TIGRFAM: GTP cyclohydrolase I; KEGG: fal:FRAAL6589
FT                   GTP cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78391"
FT                   /db_xref="GOA:E3J7B8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B8"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ADP78391.1"
FT                   /translation="MTSETDLLSADLDHLDDEGGSAAETGSGSGAAVAEFRPGNGRIRP
FT                   FDHDRVAAAVRELLIGIGEDPDREGLRKTPDRVARAYAEAVEGLGRDPADVLTTVFDEG
FT                   HDEMVLVRDIDFSSLCEHHLVVFSGKAHVAYIPNENGQITGLSKLARLVDLYARRPQVQ
FT                   ERLTSQVADALVDVLQPRGVMVVVEAEHLCMSMRGVRKPGACTVTSAVRGQFLSPATRN
FT                   EGMSLILSSHRR"
FT   gene            complement(376769..378925)
FT                   /locus_tag="FraEuI1c_0306"
FT   CDS_pept        complement(376769..378925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0306"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: fal:FRAAL6588 cell division
FT                   protein FtsH (ATP-dependent zinc-metallo protease); PFAM:
FT                   peptidase M41; AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78392"
FT                   /db_xref="GOA:E3J7B9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B9"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADP78392.1"
FT                   /translation="MTPRRIFRGWVVLALLVLLVIFLTTNVLSGPKEYSKENLHDIQAK
FT                   IAAGQVKSATIEDSKQIVQITTKDDKKYESSYVTNQAVSLAAELNDKNVPYEVKVERSN
FT                   VLVSLLLNLLPLVLVVALFLFLMNQMQGGGNRVMNFGKSKAKLVNKDTPKTTFADVAGA
FT                   DEALEELQEIKEFLENPGKFQAIGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFYSI
FT                   SGSDFVEMFVGVGASRVRDLFEQAKANAPAIIFVDEIDAVGRHRGAGLGGGHDEREQTL
FT                   NQLLVEMDGFDVKGGVILIAATNRPDILDPALLRPGRFDRQIVVDRPDLLGREAILKVH
FT                   AKGKPIGPDVDLLVIARRTPGFTGADLANVLNEAALLAARADQKMISSDLLEESIDRVL
FT                   AGPERKTRAMSDKEKKRIAYHEGGHALVAHALPNSDPVHKITILPRGRALGYTMQLPLE
FT                   DKYLSTRSEMLDKLAVLLGGRTAEEVVFHEPTTGASDDIEKATQIARAMVTQYGMSDKL
FT                   GALKFGAESGEVFLGREVGHQRDYSEAVAGEIDNEVRKLIEAAHDEAWEVLNTYRDELD
FT                   NLVLRLMDTETLSKDDVLETFATVQKRPVRGFYTGVGRRVPSDRPPVQTPAELGLVASD
FT                   VADLVKGNGNGNGHPTGNGSPGLNNPAAAPGQGADTGHGPVSGPVNGPTGPAGPPAAPP
FT                   PDAPRISNPWAPPVWPNDDERKRS"
FT   gene            complement(379337..381148)
FT                   /locus_tag="FraEuI1c_0307"
FT   CDS_pept        complement(379337..381148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0307"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   tRNA(Ile)-lysidine synthetase; KEGG: fal:FRAAL6587
FT                   hypoxanthine phosphoribosyltransferase (partial match);
FT                   PFAM: PP-loop domain protein; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78393"
FT                   /db_xref="GOA:E3J7C0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C0"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADP78393.1"
FT                   /translation="MTGSASPASGQRIHPSGSPAPAVAAIRLAVRHAVADLPPGALVLV
FT                   ACSGGPDSLALAAATAFVAPRRALRAGLLTVDHGWDGASDQRAESVVAQGRALRLDPVE
FT                   LLVAHSARSEGAARDARRAALAAAAERLGAAALLLGHTLDDQAETVLLRLARGAGARSL
FT                   GAMSPRDGLLRRPLLGLRKEQTRAACRAEGLDVWEDPTNADAAFARARVRHALLPALEE
FT                   QLGPGIAESLSRSADLLRADAEALDALTDDAYAQATAGSPAGAGSVELAVEALGSLPSA
FT                   LRTRVLRRAALALGASASALRAEHVWAMEELVTRWRGQQPVPLPSGVTARRRGDRISVA
FT                   GPGETRSGRRGTADGGDAASGPTGPRPSPRRPDAARPDAEEGMPVSQAEVSAPDSADQS
FT                   TTGSPDQSKPGSAPADTPPWHDGDIGEVLVSEEEIATRIAALAAQVDADYAGRELLLVG
FT                   VLKGAVMVMADLSRALRTPVTMEFMAVSSYGSASSSSGVVRILKDLDRSIEGRDVLVVE
FT                   DIIDSGLTLSWLLKNLRSRNPGSLEVLALFRKPEAITVDVDVRYVGFDIPSAFVVGYGL
FT                   DYAEHYRTLPFVGTLTPEAIARGPRPS"
FT   gene            complement(381158..382357)
FT                   /locus_tag="FraEuI1c_0308"
FT   CDS_pept        complement(381158..382357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6586 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Protein of unknown
FT                   function DUF2342"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78394"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C1"
FT                   /inference="protein motif:TFAM:TIGR03624"
FT                   /protein_id="ADP78394.1"
FT                   /translation="MVPVVDAQPQDSEPEDKRPDDGQHADQQPVDWDLAVATARKLVRP
FT                   GPQLTRAEADEVVSSLRRLAVDAERHVEDYTHLRPAAAVTPIAVVDRPEWARSNVAGLR
FT                   MITTPLLDRLADNAKGSLSTAVGRRVTGVQLGSALAYLAGKVLGQYEVFLPPEEYGPTA
FT                   TPARSDWADGAGPVGRLSLVAPNIAHAERQLGVVPRDFRLWVCLHEQTHRSQFTAVPWL
FT                   RAHLESEIGAFIEATDLDPDVLADRLRSAVGALRGAVRDRGPDAPSVVEALQTPAQRSV
FT                   LDRLQALMTLLEGHADQVMDAVGPQVVPTVADIRARFDTRRSGGSPLDRFVRRLLGLDM
FT                   KLRQYRQGGAFVRAVVAEAGVDGFNLVWQSPATLPSQAEIADPGAWMARVLGSRPSISA
FT                   "
FT   gene            complement(382457..383941)
FT                   /locus_tag="FraEuI1c_0309"
FT   CDS_pept        complement(382457..383941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0309"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="KEGG: fal:FRAAL6585 putative penicillin-binding
FT                   protein 6 [precursor] (D-alanyl-D-alanine carboxypeptidase
FT                   fraction C (DacC); TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78395"
FT                   /db_xref="GOA:E3J7C2"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C2"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADP78395.1"
FT                   /translation="MTAGARVGGLTALAGALLAGSLTISPGPGGDKAPGPTVPPVSAAP
FT                   LAGLAANRPLPDPAALSGRLAGPFANPLLGSPAGLVVDGLTGKVLFDQRASVPTAPAST
FT                   LKTAVAAAALRTFSAGTRLTTRVVYLPPPAGPSTPGPGVRQGGTLWLVGAGDPTLTAAT
FT                   GPAGYPASISAKLSELAAQVHAAGITSVSRLIGDGTLYQGPATAPGWKDVYVSEGDVTP
FT                   VSALEVDAGRPTPGAVGPRTGTPDAAAAGAFAAALHTAGVAVGGLGTGPADPAAKTVAT
FT                   AASPPIPVLVERMLTDSDNDIAESLGRLVARAHGLPPTFAGATAAVGKVLTQLGIDTAG
FT                   MSLADVSGLSVTDAIMPRTLVAILRTATLPGHPELRPLITGLPIAGFSGTLGDRYGGTD
FT                   TAPAAGDVRAKTGSLSTVTSLAGQLVDADGRLLLFGFFAPVNESTAAKASLDRVAAALA
FT                   GCGCSAAGPPASTSAGTAPVQPDKGGEPQAATQRGH"
FT   gene            384439..384987
FT                   /locus_tag="FraEuI1c_0310"
FT   CDS_pept        384439..384987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0310"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: fal:FRAAL6584 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78396"
FT                   /db_xref="GOA:E3J7C3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C3"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADP78396.1"
FT                   /translation="MDLEFDVTIEIPKGQRNKYEMDHHTGRIRLDRMLFTSTHYPSDYG
FT                   FIEGTLGRDGDPLDALVLLEEPTFPGCLVRCRTIGMFQMTDEKGPDDKVLCVPVADIRQ
FT                   EHLRDIRHLPEFDRLEIQHFFEVYKDLEPGKSVEGASWVGRADAEREILASIKRLETDG
FT                   AEHAPVVDEVETEAETETA"
FT   gene            385076..385408
FT                   /locus_tag="FraEuI1c_0311"
FT   CDS_pept        385076..385408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78397"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2584"
FT                   /protein_id="ADP78397.1"
FT                   /translation="MAVVAWRGLRGAGRLARPPSEATYDPVVSSRLDRSWLVLASHQTA
FT                   EADRCVDIFRRPEGTFGFEEFRKDPEDMGRWTPVSYFSGWQYPTEDETLDAACATVPWL
FT                   GPLVGR"
FT   gene            complement(385498..385569)
FT                   /locus_tag="FraEuI1c_R0006"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(385498..385569)
FT                   /locus_tag="FraEuI1c_R0006"
FT                   /product="tRNA-Thr"
FT   gene            386211..386936
FT                   /locus_tag="FraEuI1c_0312"
FT   CDS_pept        386211..386936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0312"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: fal:FRAAL6583 two-component system response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78398"
FT                   /db_xref="GOA:E3J7C5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78398.1"
FT                   /translation="MTGEAVATTTRGASLLVAEDDEASRVALARSLERFGYRVLEAADG
FT                   ETALRLFQTTEIDLVVLDVAMPRMDGFAVLSRLRQTSEVPVIMLTGRAEEVDRVVGLEL
FT                   GADDYVVKPYSLRELVARVRARLRRRPVEAPPQRSGDGNEPLIYGDVSIDLRAREVAVA
FT                   GERIDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKVEGR
FT                   PPQRRLVTTLRGMGYRFDP"
FT   gene            complement(387018..388106)
FT                   /locus_tag="FraEuI1c_0313"
FT   CDS_pept        complement(387018..388106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0313"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: fal:FRAAL6582
FT                   signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78399"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C6"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADP78399.1"
FT                   /translation="MPMMCAVAFSPRGKLYYADPGSLTPKVGDRVLVPTDDGAEVATCM
FT                   WAPQWVSEDIGHLPVLVGLAADHDVEREAASRRRRAQARVAARRLVRDHGLPMKIVGVD
FT                   HVSSADTFTIYFTAEGRVDFRALVRDLNRTLDTRVHLRQLSARDSAKLQGGIGSCGRDL
FT                   CCSTFLTDFEPVSIRMAKDQNLALNPLKISGACGRLMCCLRYEHPLYEEFTAAVPAVGA
FT                   KARTPDGPGRVIAHDVPRQQVVVALDAGGRKACDRSDVCSSRRAHDAAYPATASSGCDS
FT                   AVLAGAGPGQIEADAGRDAAQVGAGSTAAGVATEAVSRGPGPGGAGNAERPDAETAAGQ
FT                   TDSGEGGHHRIRRRRSRPAGPA"
FT   gene            388669..388854
FT                   /locus_tag="FraEuI1c_0314"
FT   CDS_pept        388669..388854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78400"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL4321"
FT                   /protein_id="ADP78400.1"
FT                   /translation="MKATYQAPTLQDAGSFRDLTGYGFVGVGGFGGWGGGGWGGWGGGW
FT                   GGWGGGGGWGGWGGGW"
FT   gene            389088..390359
FT                   /locus_tag="FraEuI1c_0315"
FT   CDS_pept        389088..390359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0315"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: fal:FRAAL4320
FT                   putative hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78401"
FT                   /db_xref="GOA:E3J7C8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C8"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADP78401.1"
FT                   /translation="MRIVCVGGGPAGLYFAICAKRRNPDHEITVLERDPAGATHGWGVA
FT                   YWEPLIDNMFHNDPVCALAVQDAAALWQEHRLAVGTRTAYLPGHGYGIQRSVLLDVFAR
FT                   RATELGVRLHYRQGIVDEAELRALCAENDLVVAADGGRSQVRRLAGTDVFGTRLEEGLN
FT                   PYIWLGTDQRFTDFRFAFQRTPHGWIWFHAYPSASDVGTCVFECAPTTWTGLGLDRLDD
FT                   AAGRELLETIFADQLAGHRLLGGGEGDRGTSRPAHWQRFTHVSNRSWRHDNIVLIGDAA
FT                   HTTHFTFGSGTALAMMDAVMLARFLRRHDGDLPAALTAFDTAGRKALGRVQAHARRGSD
FT                   WFERIDDLFDNELASPQDSIDGPDPVTVAAALSSRHGGGIQPLRRRVLRSNQVPAVRRV
FT                   RREASTGGRWLRERRRARELTRAG"
FT   gene            complement(390356..391612)
FT                   /locus_tag="FraEuI1c_0316"
FT   CDS_pept        complement(390356..391612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0316"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: fal:FRAAL6581 DNA polymerase III subunit
FT                   delta'; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78402"
FT                   /db_xref="GOA:E3J7C9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C9"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADP78402.1"
FT                   /translation="MTVWDALVGQDAVVETLEAAAAAATLVGGPQGALAAARAGMTHSW
FT                   LFTGPAGAGRTDAARAFAAALSCVRADGTSARPGCGECVGCHTVLTDTAADLRTVRAEG
FT                   LSLGVQDVRALVRDAASAPTSGRYRILLIEEADRLTDSAANALLKALEEPAQRSVFLLC
FT                   APSVDDVMPTIRSRCRVVALRLPTVDDLVGALRRDGVDEATAQVAARAAQGHLGRARLL
FT                   ATDDETRGRRAQVLALPSRLGRVAECLAAAGDLVAAANADAQTANSERDEAEAGALRTA
FT                   LGMGATSSGGTGRTKRVTKAAPKAKTMMVRGAAGALKDLEKSQKSRGRRTVLDSLDRAL
FT                   LDLAGLYRDVLARQLGATVDPVNPDATREIASLAARATPERTLQRLEAVLATRDALAAN
FT                   PGLVAQLTVESLALTLREP"
FT   gene            complement(391609..394071)
FT                   /locus_tag="FraEuI1c_0317"
FT   CDS_pept        complement(391609..394071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0317"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE;
FT                   thymidylate kinase; KEGG: fal:FRAAL6580 thymidylate kinase
FT                   (dTMP kinase) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78403"
FT                   /db_xref="GOA:E3J7D0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D0"
FT                   /inference="protein motif:PFAM:PF05977"
FT                   /protein_id="ADP78403.1"
FT                   /translation="MSTADEAEGSVRRAQLGFQDARDDQPGTGSPGPQAAAPSRAAHGP
FT                   DGPSGATAPNGRAELPADGPEGADTALVVRRARRAGWAHRSVGQHPVTSVPEPPERRAP
FT                   ASSDEGDVRAVLRIPEFRRLWIQLGLSSLGDWMGLLATTAMVAELAHSFSGQAYGIGSL
FT                   LIIRLMPALIFGPIAGAVADKLDRRRTMVVTDLMRFALFASIPIVGTLAWLFIASFLVE
FT                   CVTLLWAPAKEASVPHLVPKERLAAANTLSLITTYGSAPVAAAIFALLATLARSLAPSY
FT                   PWFRDSPVDLALYFNAVTFLLSAIVIWGLRSIGKAQRPDQGPEPGFFASITEGWKFVGQ
FT                   DRLVRGLVVGILGGFAGAGCVIALGRLYVHILGGGDSAYGVLFGAVFVGLAAGMAAGPR
FT                   LLGDYSRTRLFGVCVTGAGITLVFVAIIPNLVLACILVVLVGMFAGVAWVTGNTLLQAE
FT                   VADELRGRTFALVQSLVRVDLLLVLAVAPALVGLIGTHQIHLWGEVNVRADGVTVVLLA
FT                   GGALAIVVGLFAYRQMDDHSGVPVLPELWNALRGRRGVRRPRHAGLFVAIEGADFRSRA
FT                   DQLESLRRWLLEAGREVLVTAESPADTSELEAALRTVQPDPAAGLHPRTTALLTAAIHA
FT                   EHVARVIEPALARGAVVLTDSYVDAEIARQSAEACAALDELTILSHWATRSLVPDVTIL
FT                   LDVEPRNPSAPGTPANGTSTNGARANGHGGLFDQRVRAALLQLADDEPHRYLVLDGTAP
FT                   ASELRGRIRQAVQRRLTEPATAATATAATDHDPVYDDALYDAAYPGRANGAGRPAGSVD
FT                   GAGPEGSA"
FT   gene            complement(394071..397049)
FT                   /locus_tag="FraEuI1c_0318"
FT   CDS_pept        complement(394071..397049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0318"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: fal:FRAAL6579
FT                   DNA topoisomerase I omega subunit; PFAM: DNA topoisomerase
FT                   type IA central domain protein; TOPRIM domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78404"
FT                   /db_xref="GOA:E3J7D1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D1"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADP78404.1"
FT                   /translation="MPPRAKTTARTPSRSSTPLAEPLDLDAEIVDLAEQVDDAEPSSGT
FT                   TRGGGRRRAPAGTGNRLVIVESPAKAKTIAGYLGPGWQVESSIGHIRDLPRSAADVPAA
FT                   HKGKPWARLGVDVDNGFAPLYIVTPDKRPQVSKLKELVKDASELYLATDEDREGEAIAW
FT                   HLLQTLKPTVPVKRMVFHEITPQAIRRAVDSPREIDENLVNAQETRRILDRLYGYEVSP
FT                   VLWKKVMPRLSAGRVQSVATRILVERERARMRFRSADYWNIEGRFVATVGHDGKAPDTT
FT                   PLPANLVALDGRRLATGRDFDATGNLTSAEVVRLDEAAARGLAERLAATAFAVRSVETK
FT                   PYKRSPYPPFMTSTLQQEAGRKLRFSSQRTMQIAQKLYENGYITYMRTDSTNLSETALA
FT                   AAREQARQLYGSEYVPDKPRVYTKKVKNAQEAHEAIRPSGDTFRTPGEVRRELDADGFR
FT                   LYELIWQRTVASQMADARGTSATVRLGGKSSTNEDAEFAATGKVITFPGFLRAYVEGAD
FT                   DPDAELEDRETRLPDVRQGDPLATRDLTPRGHSTSPPPRFTEASLVKTLEELGIGRPST
FT                   YASIIGTIQDRGYVWKKGSALIPSFVAFAVVGLLEDHFGRLVDYRFTATMEDDLDAIAS
FT                   GSSGSTDWLTRFYFGDDAAAPVASSAANGKSATPDPGLKHLVSERLGEIDAREVNSIPL
FT                   GAAEDGVPVVVRVGRYGPYVQHGEGRASVPEDLPPDELTIPKALELLDAPSGDRVLGTD
FT                   PDNGATITAKAGRYGPYVTTDTEPPRTASLLSTMSLETLTLDDARKLLTLPRVLGAGED
FT                   GEEITAQNGRYGPYVKHGTQSRSLANEEQLFTVTLQEALDLLAQPKTRGRRSAAEIPPL
FT                   RELGADPATGKPMVLKEGRFGPYVTDGETNASLRKGDEIDTLTIERAAELLADRRARGP
FT                   ATPRRANARAGSKAPAKAGSTAKAKSSARASSAAKATAKTTTKTGTRATKRSASGADGA
FT                   GEG"
FT   gene            complement(397634..400018)
FT                   /locus_tag="FraEuI1c_0319"
FT   CDS_pept        complement(397634..400018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0319"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   KEGG: fal:FRAAL6577 membrane-bound proton-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78405"
FT                   /db_xref="GOA:E3J7D2"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D2"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADP78405.1"
FT                   /translation="MPPIQAAESPAGTGIDLTGGQLGLVAGVALIAALALLVAGYLVRE
FT                   VLAASQGGPKMIEVGKAVQEGAAAYLSRQFKTLAAFVVVIPFVLLALPADDLGARIGRS
FT                   AFFVVGAVFSALVGFVGMSLATRANTRTAAAANERGEKAALRLAFRTGGVVGMFTVGLG
FT                   LLGAAVVVLIFKHTAPQVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEKGIP
FT                   EDDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGIKAFGSHGLVFPLLIP
FT                   AIGVITAVIGIFAVAPRSGDRDGMAAINRGFFISAVISAIGVVVVALVYLPGSFKGFHD
FT                   LAGGVPKGDPRVIAISACLIGIVLAAAIQLLTGYFTETKRKPVRSVVDASTTGPATNIL
FT                   AGIGVGLESAVYSAVLISAAVFGAYLLGSGSITVALFAVAMAGTGLLTTVGVIISMDTF
FT                   GPVSDNAQGIAEMSGEVTEEGATILTSLDAVGNTTKAITKGIAIATAVFAATALFGSFT
FT                   DTITEALAKAGVNPSTTRGTIGGLNVAYPDALVGLILGAAVVFLFSGLAINAVGRAAGR
FT                   VVWEVRKQFQDHPGIMEGTEKPDYGAVVDICTRDSLRELVTPGTLAVMAPIAVGFGLGY
FT                   PPLGCYLAGAIAGGVLMAVFLANSGGAWDNAKKLVEDGMHGGKGSDVHAATVIGDTVGD
FT                   PFKDTAGPAINPLIKVMNLVSLLIAPTVVKFSVGQDKNTWLRVLIAIVALAVIATVITI
FT                   SKRRGSALDAVPGDSGTAVSSNVVVATAAGQPATAPDQVNV"
FT   gene            complement(400734..401327)
FT                   /locus_tag="FraEuI1c_0320"
FT   CDS_pept        complement(400734..401327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6575 putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78406"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6575"
FT                   /protein_id="ADP78406.1"
FT                   /translation="MSTVDTSTVDPPALGTSTVELRIAALPGHVRTARMIATAVARRSL
FT                   VPTDALDEIRFAVGEACLRAVNVNRLRAPEDLVVVRMTSADGVFTVSVADSGEPGDDAA
FT                   PGPDGGPLGLPALFGVAGYGTETAGGGPGAEYLPGDADSAGAGSALPPGIGLALIEGLV
FT                   DDVEVRRRPDGVGTVVTMTWDTTSLVDGGLASAL"
FT   gene            complement(401650..401991)
FT                   /locus_tag="FraEuI1c_0321"
FT   CDS_pept        complement(401650..401991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0321"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: fal:FRAAL6574 anti-sigma-B factor antagonist
FT                   (anti-anti-sigma-B factor); TIGRFAM: anti-anti-sigma
FT                   factor; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78407"
FT                   /db_xref="GOA:E3J7D4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D4"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADP78407.1"
FT                   /translation="MDLSLTTRQEGDHTVVVVGGEIDVYTAPKLREQLIDLVSAGSYHL
FT                   VVDMEGVEFLDSTGLGVLVGGLKRVRAHDGSLRLVCTQERILKIFRITGLTKVFPIHAS
FT                   VEEALAATD"
FT   gene            402517..405093
FT                   /locus_tag="FraEuI1c_0322"
FT   CDS_pept        402517..405093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0322"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: fal:FRAAL6573 putative ATP-dependent RNA
FT                   helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; Protein of unknown function
FT                   DUF1998; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78408"
FT                   /db_xref="GOA:E3J7D5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D5"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADP78408.1"
FT                   /translation="MPPCPDRGRTILTRVIPTVGTDRGSEILSRLRADRRRDRCVTHVE
FT                   RVPARLGSPVDWPDWVDPLLLGRLRAAGVTAPWSHQAAAATTAHAGRSVVLATGTASGK
FT                   SLGYLLPVLSALLADPGARALYLAPTKALAHDQLRAIRALTLTAVRAASYDGDTPAAER
FT                   EWVRAHANFVLTNPDMLHRGILPGHRRFGPFLRGLRFVVVDECHGYRGVFGAHVAQVLR
FT                   RLRRVCARYGADPVFVLASATVADPGVAAGRLTGVDVDVVDEDGSPRGATDFVLYEPPL
FT                   FLTAPRDQPGTAAAGISRQRTPQGGGGPGDGAGLETRGGLGAAGGPSAEQGPNAGQGPS
FT                   AGAGPGSVAGPGGSQGVGAGENGAPVRRSATAEAADLMADLVVDGVRTLVFVRSRRAAE
FT                   VVANSARRALGLVAPELGEQIAAYRAGYLAEERRELEARLRSGDLLGVAATSALELGVD
FT                   ISGLDATVIAGYPGTLASLWQQAGRAGRAGQGALAVLVARDDPLDTYLVHHPEAVFGRP
FT                   VEATVFDPDNPYVLGPQLECAAAELPVTEADLALFGPSARAVLDDLVRRGRLRRRPNGW
FT                   YWTQRSRPDVDIRGVGGTPVRIVEADTGRLLGTVDAATSHSTVHAGAVYLHQGVSFVVD
FT                   ELDLDESVAFVVRAAPDWTTTARDHTDIRIVESSRSRPVDDDLTVFFGTVEVTSQVVGY
FT                   QRRLITTGEVLGDVPLDLPPRHLRTRGVWYTVSDRLLEQAAIEPADVPGAVHAAEHAAI
FT                   GLLPLFATCDRWDIGGVSTALHPDTGQTTIFVYDGHPGGAGFAERGYGRFEPWLTATRD
FT                   AVVACECPAGCPSCVQSPKCGNGNDPLDKAAAVRLLDSVLERIRSA"
FT   gene            405342..406163
FT                   /locus_tag="FraEuI1c_0323"
FT   CDS_pept        405342..406163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78409"
FT                   /db_xref="GOA:E3J7D6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6572"
FT                   /protein_id="ADP78409.1"
FT                   /translation="MFTLGVVLLVIAGGLTADIVLESNDVTQVALFGHEFAFDNWRLFA
FT                   FGLLTGVLTVIALQLMWGGLVRGGRRRRTLRVQRRELAAAGLATGSTVPQATTPAPQAT
FT                   VPQATVPRATVPSATVPQAAAPQPATAPRPRVPQAAVPQPTGPTPQATAPVRSRFGRRS
FT                   TDGTLIGSGRETPAGAATVASAEGARTGPAPVVTADDSATATMPFRRFRRPVGKPADSD
FT                   GAAADRGDAVPAQSTSRTGAGAVYPSDRPKDRVVARARGARDTVGQDTARD"
FT   gene            complement(406228..406686)
FT                   /locus_tag="FraEuI1c_0324"
FT   CDS_pept        complement(406228..406686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0324"
FT                   /product="Helicase/secretion neighbourhood TadE-like
FT                   protein"
FT                   /note="TIGRFAM: Helicase/secretion neighbourhood TadE-like
FT                   protein; KEGG: fal:FRAAL6570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78410"
FT                   /db_xref="GOA:E3J7D7"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D7"
FT                   /inference="protein motif:TFAM:TIGR03816"
FT                   /protein_id="ADP78410.1"
FT                   /translation="MSAGTRPERRRRARSAPPGQWSAPQANRNGDRGSATVLLLGWLLV
FT                   VATVGGILLAVGAVTLARRQAATGADLAALAGAMDRTGDPAAVCAQARTFAARNGTDLI
FT                   ACRVGGGTVEVVAAARLPPALGGFGPLAATARAGPWIGAAQRPTTGPG"
FT   gene            complement(406683..407276)
FT                   /locus_tag="FraEuI1c_0325"
FT   CDS_pept        complement(406683..407276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78411"
FT                   /db_xref="GOA:E3J7D8"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6569"
FT                   /protein_id="ADP78411.1"
FT                   /translation="MYRSRSTFATPAARGLGSSVVTPPDPRRPPAARPGEQAAHERGQS
FT                   DPAAPARHRGNRRPDRGQATAELALGLPTLGAIIIVALWLLAAVGAQARVDEAARIGAR
FT                   AAARGEADGQVAAWVRDAAPAGATVKISRQDDRVAVTVHYRLAAAGPLVTPVALTATAT
FT                   APSEQAITDAASADVATPAEVDATPLPPDGENRR"
FT   gene            complement(407279..407572)
FT                   /locus_tag="FraEuI1c_0326"
FT   CDS_pept        complement(407279..407572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78412"
FT                   /db_xref="GOA:E3J7D9"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6568"
FT                   /protein_id="ADP78412.1"
FT                   /translation="MSLLPTVVSLAAMVAGCAVLAHGLARRPAEDRHATPGRPGQLRRE
FT                   DRPGDAGMSTAEYAVGTVAAVAFAGVLYAVVSSSATHDLIMSVVRRALTLPF"
FT   sig_peptide     complement(407507..407572)
FT                   /locus_tag="FraEuI1c_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.955 at
FT                   residue 22"
FT   gene            complement(407840..409345)
FT                   /locus_tag="FraEuI1c_0327"
FT   CDS_pept        complement(407840..409345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0327"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   fal:FRAAL6567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78413"
FT                   /db_xref="GOA:E3J7E0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E0"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADP78413.1"
FT                   /translation="MIAVALGIVVLVSAVRSARRAARRWRSADDRAVAEDLLVAFAAEL
FT                   DAGAEPAVALRSAVTASRAAGTGPVETATGPSASRDGELDAVAAGLAAGTDPAGLLAGC
FT                   RTPMLRQLGIALQVCRAGGARLAPVARALAGQAQADARRAGELAAALAGPRSSGRLVAG
FT                   LPLVGLGFAALLGAGPVHVLLGTSAGSACLAGGVLLDLLGLRWLRWTGDRVARRAEPPT
FT                   RWADQASHRRSLSSGGASAASFRPGRRAAPGRRPRRSGTDQSRRPPSSAGRRPGRPIAL
FT                   VIAAGGLCAGAAALVSHGQRGFGVLLATGAVAALVGAGMRTDPDRARRERLLADLPLAL
FT                   DLVAACLVAGATVPAALEATGDGVGGPLGAELRATARGLRLGAPAGHTTTRLIAAGQGP
FT                   PGPFPGPLRRVTGHRGTGRGQPLAAAAQALGRVESSGARLADALTSIASRARAQSHDEA
FT                   IGAARRAGVAAVAPLGLCFLPAFLLLGVVPTILGSFHGLVPAP"
FT   gene            complement(409342..410589)
FT                   /locus_tag="FraEuI1c_0328"
FT   CDS_pept        complement(409342..410589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0328"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   fal:FRAAL6566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78414"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E1"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADP78414.1"
FT                   /translation="MPPAPTTRTARIPAAALAAGPPLVDAVRDRLTDTAHPPTPADVAR
FT                   ALAQVAGPLPAADQEAARRAVTAELLGTGPLEALLADPDVTDVLVNGPARVWVDRGAGL
FT                   ERTEVRFADEEAVRRLATRLAAAAGRRLDAAAPFADARLPDGSRLHAVLAPVAADGTCL
FT                   SLRRPRRVPLTLTECVDGQDVALPGVLRALVAGRLAVVVTGGTGTGKTTLLAALLGCAH
FT                   PAERVVIVEDTSELVLARENLVRLQGRPANIEGAGAITQRDLVRQALRMRPDRLVVGEV
FT                   RGPEVLDLLVAFNTGHDGGLTTIHANAAGALPARVEALGALAGLSRAAVHSQLAAAVQV
FT                   TVHLRRDSGGRRAVAAIGVLRTESDGLVRVRPALVTAPAGNGWPGALLAADGLSALRDL
FT                   LRDRGVTLPPPFGAAS"
FT   gene            complement(410971..411843)
FT                   /locus_tag="FraEuI1c_0329"
FT   CDS_pept        complement(410971..411843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78415"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6564"
FT                   /protein_id="ADP78415.1"
FT                   /translation="MSTAPSTQAGPALDPFARVAALPGVAEAVTTARSAVDTLLRHRVL
FT                   RRQSAEVTAEASLRSARASAALEGHDLGLETLRARLTAGESAAQGGDELAVTLGAVRLY
FT                   AELGSLAGAWERAPRQALARMHTLLGRGIVPDGELGRPRADASAADPLGLGTPPGPAEV
FT                   SARLDGLVGLLVEKTTAPAIVVSAIVHGELLALRPFGSLDGMIGRAAARLVLIGRGLDP
FT                   KAVTATDVGHLEAGVDGDGVADYRTAAAGYVHGGADGLRAWLLHCARATELGARESLAV
FT                   CEAISRAAS"
FT   gene            412045..412650
FT                   /locus_tag="FraEuI1c_0330"
FT   CDS_pept        412045..412650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78416"
FT                   /db_xref="GOA:E3J7E3"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6563"
FT                   /protein_id="ADP78416.1"
FT                   /translation="MAVFGHGDRRLGRDASLGELVALATKDVSLLVRQEIELAKAEVGR
FT                   QVASAAVGIGLLGVAAGLVLGALLALMIFFGELFAWLGLERFWAFLLTAGLLFVLAGVL
FT                   ALLAALRLRKLQPPRRTVASVREDVALLRHATGGAGDARGGSPAKSGPPTGQTTPVGAE
FT                   TRSARPVVAPIPQSRDAAPPAGRRPAEFDRPGAVEPRA"
FT   gene            412775..413698
FT                   /locus_tag="FraEuI1c_0331"
FT   CDS_pept        412775..413698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0331"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: fal:FRAAL6562
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78417"
FT                   /db_xref="GOA:E3J7E4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78417.1"
FT                   /translation="MDEAAPDPASVLIDGPWRHRDVSANGTRLHVAELGQGPLVLLLHG
FT                   FPQFWWAWRHQLVALAAAGYRVVAPDLRGYGASDKPPRGYDAFTLADDVAGLIRALGER
FT                   DAVLVGHDWGGLASWTAAAVWPRQVRRIAVLGMPHPLRIRHEYAVDPRGQGLAGAHLFG
FT                   FQLPWRPERQLVADDAARVGGYLRAWGGPGFPSDDEDRRYRAAMRIPGVAHSSLEYHRW
FT                   VFRSLFRPDGARFAQALRRAVNCPVLHLHGGADPFLLPDTAQGSGRFVSGPYAWQLLPG
FT                   VGHFLPEEAPDQVSDVLLRWLDAPTP"
FT   gene            complement(413699..414880)
FT                   /locus_tag="FraEuI1c_0332"
FT   CDS_pept        complement(413699..414880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0332"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: fal:FRAAL6561 serine proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78418"
FT                   /db_xref="GOA:E3J7E5"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E5"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ADP78418.1"
FT                   /translation="MNLLDVILLLVALLFAASGYRQGFLVGALSFVGFLGGGMIGAQIA
FT                   YPFAQLIGQRQHGALIALAVVIVLACLGQVAGTAAGVALRSRLTWRPGETVDSLAGAVL
FT                   AGLSVLLVAWLLATAVERSPYPTAAREVRGSAVLTTVDAGMPSAVRDAFSSLRRLADGS
FT                   GFPAVFSGIGGGSIVATDPPDPTVVQNPAVLDAAASVLKVRGIAPSCSRQIEGSGFVFA
FT                   PQHVMTNAHVVAGVREPAVEVGGRQLPARVVLFDPARDIAVLYVPDLNRAPLRLQSSPD
FT                   GGADDSAVIAGYPEDGPYQMVAARIRDRQEAKAPDIYSRGSVLRDIFAIRGTVLPGNSG
FT                   GPLLSASGTVYGVIFAAATDDNDTGYALTADEVNASAQAAATATTPVSTSGCR"
FT   gene            complement(414922..415302)
FT                   /locus_tag="FraEuI1c_0333"
FT   CDS_pept        complement(414922..415302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0333"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   fal:FRAAL6560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78419"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E6"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADP78419.1"
FT                   /translation="MAIAAALALGVTAAGCAAKEPVAPKVVAIETPTMSGDVQVFQVTG
FT                   LADLRFDVSTLEARPGKIRVDFTVARGSASHDFVIPKIPAARTDIIGAGSTQSVTFAVT
FT                   EPGDYPVICTLHPSMSATLHVG"
FT   sig_peptide     complement(415246..415302)
FT                   /locus_tag="FraEuI1c_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.865 at
FT                   residue 19"
FT   gene            complement(415392..416267)
FT                   /locus_tag="FraEuI1c_0334"
FT   CDS_pept        complement(415392..416267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0334"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fal:FRAAL6559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78420"
FT                   /db_xref="GOA:E3J7E7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP78420.1"
FT                   /translation="MTGPDGGPDPTEQPDPAEQPADGPPGWLTAVVATVADGGLSFHPE
FT                   DWPGPPSHARPAAVLILFGAGERGTEVLLLERSADLRKHAGQPAFPGGGSDPSDGSPAE
FT                   TALREAREEVGLDPAGVDILGVGPPLYVPHSNYLVTPVLAWWRVPSRVFAVDAGETSAV
FT                   ARVPIAELVDPANRVRLSHPRTALPSPAFRVAGLTATVWGFTAGILDALLRLAGLERPW
FT                   GEGPPVEDATVNASIALSAAQLPEAGPGEIDPADLPVRDLGVPAPASAPDGGPVGTGTG
FT                   ADSTEEGSAA"
FT   gene            complement(416264..417079)
FT                   /locus_tag="FraEuI1c_0335"
FT   CDS_pept        complement(416264..417079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0335"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="SMART: HhH-GPD family protein; iron-sulfur cluster
FT                   loop; Helix-hairpin-helix DNA-binding class 1; TIGRFAM:
FT                   endonuclease III; KEGG: fal:FRAAL6558 endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase); PFAM: HhH-GPD
FT                   family protein; helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78421"
FT                   /db_xref="GOA:E3J7E8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E8"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADP78421.1"
FT                   /translation="MPATVDPSPETPGPPTRQAQTRQAQTRQAQTRQAQAQPSETPLAR
FT                   TRRARRIVRILGEVHPDARIALNFTTPLELIVATVLSAQCTDKKVNEVTPTVFARYPSA
FT                   AAYAGADRAELETILRPTGFFRAKANSVIGLGAALVDRFGGEVPRTLEELVTLPGVGRK
FT                   TANVVLGHAFDTPGITVDTHVGRLSRRFGLTTQDDPVKVEADLAALIERKDWTIASDRM
FT                   IFHGRRICHARRPACGACAVAKLCPSYGTGPTSEIEAAKLVRGDVEAAR"
FT   gene            complement(417215..417451)
FT                   /locus_tag="FraEuI1c_0336"
FT   CDS_pept        complement(417215..417451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78422"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6557"
FT                   /protein_id="ADP78422.1"
FT                   /translation="MFLFAAIAFPVVLLGLLLAMERVERPLNAADTRKGLEGFLDNARP
FT                   DEVNTFVNQGLAAALERYRRRIRRTPPGKHRAA"
FT   sig_peptide     complement(417392..417451)
FT                   /locus_tag="FraEuI1c_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.787 at
FT                   residue 20"
FT   gene            417670..418359
FT                   /locus_tag="FraEuI1c_0337"
FT   CDS_pept        417670..418359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0337"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: fal:FRAAL6556 Crp/Fnr family transcriptional
FT                   regulator; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: cyclic nucleotide-binding; regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78423"
FT                   /db_xref="GOA:E3J7F0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F0"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADP78423.1"
FT                   /translation="MDDLLARVPLFVGLSDLDRQALSSHLERRDVTRGDVLFREGEPGD
FT                   RVFVVLSGKVKIGRQSADGRENLLYVMGPGDIFGELSLFDPGPRTATATAVTDASLVSL
FT                   EHSALRPWLRARPDAGSLLLRVLAARLRRTNDAMADMVFTDVPGRVAKALLDLAGRFGE
FT                   PAQPGNEAAGVRVEHGLTQEELAQLVGASRETVNKALADFATRGWLRLDSRAVVLLDRD
FT                   RLARRAR"
FT   gene            complement(418409..422176)
FT                   /locus_tag="FraEuI1c_0338"
FT   CDS_pept        complement(418409..422176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0338"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="KEGG: fal:FRAAL6555 putative adenylate cyclase;
FT                   PFAM: adenylyl cyclase class-3/4/guanylyl cyclase; SMART:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78424"
FT                   /db_xref="GOA:E3J7F1"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F1"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ADP78424.1"
FT                   /translation="MVIVPTHGGTLRCPRCGTPAVPAARYCFHCGLRFTQLASGPESAE
FT                   RRVVTVLFGDLSDFTSWAEDRDPERVGEVTDLVLAALSKEVDDVGGRVDNLAGDGIMAV
FT                   FGAPTAHEDDPERAVRAAAAMQETVRRLVTDSEDDSSPLGLRVGINTGEVLAGVQASMT
FT                   YTVVGDTVNTAARLSGAAAVGAVYAGRETMHATRSVATWRELPDLTLKGKREPVPAYEL
FT                   VSLRPSNVARPGLGDDATFVGRDRELTELYSWFVETVESGAPTIAVVTGEAGIGKTRVA
FT                   GELAARARDEGGAQVLWGRTVRHGDGRSLAPLADVIRGACGVVDGDSLDRVADRVRRTV
FT                   GRLAHPITGARLPAGLADRLLGMLGVPTDRRATSPAEAPPGDPAGRQNDQGETSTGERS
FT                   FDLAVDTVALMLSALAVEHPLIVVIDDLEWASSPLTAALRRLAARIVGPIMLTLLDREG
FT                   PRLTDLPGAHWMALAPLPEEAASRLLNDFLGGAALGAQTRAALLNRVHGNPFFLAELLN
FT                   LLIDRDQLRRQATAEPTGQDGPRWVLEGQLSETAMPAGVQSVLAARIDDLEQTDKAVLR
FT                   AAAVLGSRFPAAALPSVEELPGPEVASALDRLTERQLVRSPRAGEQLWRFVHPMARDVA
FT                   YAGLPKVERARRHSTAARWGVTAMTGSSREVSNFVATHALRAFDLASSMALPPTDPAWS
FT                   AREPGFRALLRLARAALARDDHRTAADQLADARRLGRGVIDDDDENVARVLHAEALVSL
FT                   RRLEEAERTLRPALRVTQPARRASAYAVLGELRQKQGRTELATRALRTALDAARAAGDD
FT                   RAAAAALRRLGTLEYGAARIRVAEELYREALELARRVDDPRGVGWALQHLAWSATTRGD
FT                   YPQAERHLRQATEVFERLEDAGGIGWCSGTEALVLLLSGQLARARALARGLVDAGESMG
FT                   ERWGMAVCLTIGAIAAAELGDISAARTDATRAAALFESGGDSWGRILAKVAQGLAARGA
FT                   GEPDAGAEFLAAACADANEAGQTLVGALASLMLGLTLLDAGRVDEAEKAAEASMAELGS
FT                   LDLRPHAQLGAKVLSAQIARARGRLGEAIALLREALSASEPATLLFPRRQAYAHLAGTL
FT                   LDAGQPEEALAVARRAVAVDAEDVRAQVLAWRALGTCLASSGDLEGGRDAYLRALRAAT
FT                   ATEAVSEAAQTRRLLAALPEPGMEPSDARGYHAPALSARPTGNGLAEHTVLAEHTVPAD
FT                   ATGLVADDQDGSRTGGDEPAIPDGATVTSA"
FT   gene            complement(422576..423424)
FT                   /locus_tag="FraEuI1c_0339"
FT   CDS_pept        complement(422576..423424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0339"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   fal:FRAAL6554 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78425"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F2"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADP78425.1"
FT                   /translation="MTAGSQPSPRPAGPPPPASAPRQVNPLAAVVLAPNPGPMTLEGTN
FT                   SWVLRAPGHDGCVVIDPGPDYPEHLAAIAAAGPVTTILLTHGHPDHSEGAAALHELTGA
FT                   PVRALDPTHRLGSEGLVEGDVVAAAGIELRVLATPGHSADSLSFLLFGDVPDGDEAVAV
FT                   LTGDTILGRGTTVVAHPDGRLADYLASLHRLADLPTGLGVLPGHGPELADARAAATYYL
FT                   AHRAERLDQVRAALTAAGVGPAQASPRAVVERVYADVDRVLWPAAELSVRAQLEYLRDN
FT                   A"
FT   gene            complement(423421..424377)
FT                   /locus_tag="FraEuI1c_0340"
FT   CDS_pept        complement(423421..424377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0340"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fal:FRAAL6553
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78426"
FT                   /db_xref="GOA:E3J7F3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F3"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP78426.1"
FT                   /translation="MPLSSPRGVLAANAGPVAPLRDASTVVLLRDAPGGIEAYVVKRVR
FT                   TMAFAGGVFAFPGGRVDPADSAVDVRWSGPPVGALMGTLEPDPELARALVSAAVRETFE
FT                   ECGVLLAGPAEGAERPLDLTGPGWIADRWAMERRELGLGELLARHELALRAQLLAPWAR
FT                   WITPEVEPRRYDTRFFMAALPPGQTPGELSGEADRMEWIRPAEALERHTAGLMAMLPPT
FT                   ASMLADLLDYATVADVLAAAPGRAIAPIMPKIVIADGAVHFLLPHDPEYATAAPPADPA
FT                   SATAIIAATAAGPGHSAWTHGPNDAALTTPSTTPEQV"
FT   gene            complement(424477..424956)
FT                   /locus_tag="FraEuI1c_0341"
FT   CDS_pept        complement(424477..424956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0341"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: fal:FRAAL6552
FT                   putative translation initiation inhibitor; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78427"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F4"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADP78427.1"
FT                   /translation="MSDTTGAPSERLRELGLELPPVPVPAGAYVPAVRDGETVWTAGQL
FT                   PLVGGTLPETGLVGAEVTPERAAVLARICALNALAAAAEAAGGLDRIRRVVKLVGFVAS
FT                   APGFTAQPAVVNGASELVGQIFGDAGRHARSAVGVAALPLGAPVEVELVALTHGD"
FT   gene            complement(424994..425161)
FT                   /locus_tag="FraEuI1c_0342"
FT   CDS_pept        complement(424994..425161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78428"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F5"
FT                   /inference="similar to AA sequence:KEGG:Sros_0464"
FT                   /protein_id="ADP78428.1"
FT                   /translation="MQKWEYVTVPVLIHSTKMILDNWGEDGWELVQVIQGPNPESLVAY
FT                   FKRPKGEPTA"
FT   gene            425377..426408
FT                   /locus_tag="FraEuI1c_0343"
FT   CDS_pept        425377..426408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0343"
FT                   /product="putative ion-transporting ATPase"
FT                   /note="KEGG: fal:FRAAL6550 putative ion-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78429"
FT                   /db_xref="GOA:E3J7F6"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6550"
FT                   /protein_id="ADP78429.1"
FT                   /translation="MARQASEAGRVAEARQGPWLRRLHVVTGKGGTGKTTVASALALAL
FT                   ATGGQRVLLTEVEGRQQIAQVFDTPPLAYRERRVASAPGGGEVYALAVDAEEALLEYLE
FT                   MFYNLRGAGKVLGKIGAIDFATTIAPGVRDVLLTGKIKEAVNRPDGTRPSGLAYDAVVL
FT                   DAPPTGRVTRFLNVAHEVAGLAKMGPIRSQADGVLKVLHSGQTAVHLVTLLEEMPVQET
FT                   VDAVEELRAANLPVGAVVVNMIRPPMLGQADLTAARAGTLDLEELAAGIKETGVEPTAE
FT                   LVGELAREAAQHAERVALEAAQRIAVEALDRPVYELPLAADGMDMGMLYRFAEMLRAQR
FT                   MVA"
FT   gene            426405..427742
FT                   /locus_tag="FraEuI1c_0344"
FT   CDS_pept        426405..427742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0344"
FT                   /product="putative anion-transporting ATPase"
FT                   /note="KEGG: fal:FRAAL6549 putative anion-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78430"
FT                   /db_xref="GOA:E3J7F7"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6549"
FT                   /protein_id="ADP78430.1"
FT                   /translation="MSPAANGDGGPPARPKRSAPPTGRAKTPAAKKPATKGTGTAKERS
FT                   GKDEPAPVVRIHARVRPQPAGVPRLDIDELLATERIIVCCGSGGVGKTTTAAALALRAA
FT                   EQGRAVVVLTIDPARRLAQSMGLTELDNTPREVLGVDRSAGGRLDAMMLDMKRTFDEIV
FT                   LAHATPDRAEQLLANPFYQSLSSSFSGTQEYMAMEKLGQLDAADDWDLIVVDTPPTRSA
FT                   LDFLDAPSRLGAFLDGRLLRLMLAPAKAGGRAYAKVLGVGFGVFTRVLTKVIGTQLLTD
FT                   LSQFVTALETMFGGFRQRAEKTYRLLGAPGTSFVVVAAPEVAALREASYFVDRLDADGM
FT                   PLAGLVINRMHQSDGRVLTTERSLAAAENLTEHGEHPLAAAVLRVHADRLRLAERESRL
FT                   RERFTSVHPDTPLVEVEALAEDVHDLAGLREIGDALAGDVRLTRAI"
FT   gene            complement(427908..428264)
FT                   /locus_tag="FraEuI1c_0345"
FT   CDS_pept        complement(427908..428264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0345"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: fal:FRAAL6548
FT                   WhiB family cell cycle control transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78431"
FT                   /db_xref="GOA:E3J7F8"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F8"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADP78431.1"
FT                   /translation="MTRSPTPAVSTARRGGTTRLVSGIADGDWTALAACRDVDPDELFV
FT                   QGAAQNRVKTRCFGCLVRTQCLADALDNHVEFGVWGGMTERERRALLRRRPDVRSWRKL
FT                   LADAQADHRTTSTG"
FT   gene            428883..431363
FT                   /locus_tag="FraEuI1c_0346"
FT   CDS_pept        428883..431363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0346"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; PASTA domain
FT                   containing protein; KEGG: fal:FRAAL6546 putative
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78432"
FT                   /db_xref="GOA:E3J7F9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F9"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ADP78432.1"
FT                   /translation="MGTRVKPRAKTGGSSQRPVRADRRVTIRRLSGALFASAAAGLVIA
FT                   LLAAPFVGLVGISAKSGADEFLALPENLTVGPLVEPSTILDARGNVIATLVGDQYREVV
FT                   PLSQVPQVMRNAIIDIEDARFYQHSGVDYKGMIRAYVANRNNGSVTQGASTITQQYVKN
FT                   VLLQAATTPEERKAATAQTVDRKLREARYALYLDQHLPKDKILEGYLNIAYFGDGAYGI
FT                   QAAAKRYFNVDVSQLTLPQAAMLAGLVKNPTAYDPIQHPQSAQDRRGLVLDAMQTHGHI
FT                   SAADLVAAKAAPLGLNLRPHSADSCADSTTPFFCDQIRQMLLADRTFAPSSEAASKLLF
FT                   DGGLTIHTTLDPVAQAAADSSARTIVPPGNRVAAGVAMVQPGTGAVLALTENRDYGSTD
FT                   DGQPPATTTDFVHTKEVYPTKETSFSPGSTFKMFALASALEQGLPLSTTFMSPACYHSD
FT                   QFPNPKPNDCYANADPSEAGPYSLTTATWNSVNTYYVQLEQKIGVLKIAEMARRLGVSS
FT                   CRVQPQTANLQTNSPCHKFEGVGSVDGSFVIGSNEISTLDLATAYATIAAHGERCDPVF
FT                   ITSITQQIGGADRLVNYTKPGSCEQVLNPTVADTVTSVLEGVISHGTATANGQIGRPAA
FT                   GKTGTAEDFTTASFVGFVPQLATAVTLADPRGPQSHPLRNVLGYAHVYGGDLPTKIWSS
FT                   TMRQTLDGLKLPVEALPPPDNTQPVLPNVVVPNVVGALAPAAVAFLQSQGFSAQVRGNP
FT                   NSVVLLQYPSAGSQVPAGQTIALVTPGGSIAGLAALDPGGTQTQGQDPSQNPTPPAGTG
FT                   TGRRGGRPPTANSG"
FT   gene            complement(431414..431869)
FT                   /locus_tag="FraEuI1c_0347"
FT   CDS_pept        complement(431414..431869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78433"
FT                   /db_xref="GOA:E3J7G0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6545"
FT                   /protein_id="ADP78433.1"
FT                   /translation="MNTLKERLRADLTTAMKARDELRTSTLRLAISAVKEAEVAGKSAH
FT                   ELTDDEVEKVLTREVRKRREAADAYAGAGRAEQAARERSEGEVLADYLPKQLGDDELAA
FT                   IVDKVLADGDFAGPKAIGPAMKAVQAIVAGRADGGKVAGLVKARLTA"
FT   gene            432020..432958
FT                   /locus_tag="FraEuI1c_0348"
FT   CDS_pept        432020..432958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0348"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: fal:FRAAL6544
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78434"
FT                   /db_xref="GOA:E3J7G1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADP78434.1"
FT                   /translation="MRGETRTVWPAARRVAGGLALLGAATVGYGVYERDAYTLTRREVP
FT                   ILAPGAAPLRLLHLSDLHVTPGQTRKFDWLGELGRLVPDLVAMTGDVLSHQDSSAPLRR
FT                   ALAPLYAFPGVFIPGNNDYYVPKPRSPHHYFKRHPGGPHKGPALDWDGFAKDLVADSGW
FT                   RDMTHVHDVLTIGGRRLDVRGVDDARSRRDRVALVAGPPEPGADVVLGLSHTPEPRVLD
FT                   AFTADGVQLTLSGHTHGGQIRLPFVGALVTNCGLDPSRARGLSRWSAAGPDGAQRMSWL
FT                   HVSAGLGTSPYAPIRLGCRPEATLLTLVPAR"
FT   gene            433046..433122
FT                   /locus_tag="FraEuI1c_R0007"
FT                   /note="tRNA-Pro1"
FT   tRNA            433046..433122
FT                   /locus_tag="FraEuI1c_R0007"
FT                   /product="tRNA-Pro"
FT   gene            433222..433833
FT                   /locus_tag="FraEuI1c_0349"
FT   CDS_pept        433222..433833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0349"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   oan:Oant_0128 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78435"
FT                   /db_xref="GOA:E3J7G2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G2"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADP78435.1"
FT                   /translation="MSLAFLVTSLAIVATPGTGVVLTVAAGLRSGRRVAVVTALGCTLG
FT                   IVPHLAAAVTGTAALLRAGGLAFEGLKIAGVCYLLYMAWSTWRDQGILAVDESGPPVST
FT                   ARTIGNAVLANLLNPKLTLFFFAFLPQFVNQGGAGATTRMVALGGMFMAMTLVVFIGYG
FT                   LFASYLRRHLIDRPNAVRRLQRFFSLSYLGLGAKLATTHR"
FT   sig_peptide     433222..433299
FT                   /locus_tag="FraEuI1c_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.700) with cleavage site probability 0.310 at
FT                   residue 26"
FT   gene            complement(433971..434840)
FT                   /locus_tag="FraEuI1c_0350"
FT   CDS_pept        complement(433971..434840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5406 glycine-rich cell wall
FT                   structural protein precursor (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78436"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5406"
FT                   /protein_id="ADP78436.1"
FT                   /translation="MRSRRLTRQRNARLTAVSVAAAATCAALLTGCALTGPGPGGSGPV
FT                   ATSSPTPTPSTSTPATTPTPTVKPTSTGSTASTSPTPTADSRKAVYLGGNYSNGVFSVG
FT                   VIPYGGSTNPALTGTFLIHEGSTLIGQVNVAYDPTDGYYGGHFNLTLAPGRHTFTYDYS
FT                   GDASYQPAHDTGKIDVTNVTITASVPGGTVVWGQPITVDIQVSPIPGVTGIPTGKVTND
FT                   SSFAFDTAEATLDATGHATLTVPPSPYLTSGTTRQDNYPIYINYAGDDTFTPWRVMVLF
FT                   TFLPAPTS"
FT   sig_peptide     complement(434733..434840)
FT                   /locus_tag="FraEuI1c_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.851 at
FT                   residue 36"
FT   gene            complement(435088..435825)
FT                   /locus_tag="FraEuI1c_0351"
FT   CDS_pept        complement(435088..435825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0351"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: fal:FRAAL2982 putative sensory transduction
FT                   protein; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78437"
FT                   /db_xref="GOA:E3J7G4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78437.1"
FT                   /translation="MTITVLLVDDQPLLRMGFRMVIESQPDLRVVGEAGDGAAAAALAA
FT                   ELSPDVVVMDVRMPGVDGIEATRRIAAAGGVSRVLILTTFDLDQYVLAGLRAGASGFLL
FT                   KDVPPADLLTAIRTVAAGDAVVAPNVTRRLLDAFAHHLPDPDASADGGPDRPAGRVANR
FT                   RTAGTDRLDRLTDRERDVLGEVAAGLSNAEIAARLVLSEATVKTHVGRILAKLELRDRV
FT                   QAVVFAYETGLIRPSANPPRHDG"
FT   gene            complement(435822..437459)
FT                   /locus_tag="FraEuI1c_0352"
FT   CDS_pept        complement(435822..437459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0352"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: fal:FRAAL2981 putative two-component sensor;
FT                   PFAM: histidine kinase dimerisation and phosphoacceptor
FT                   region; ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78438"
FT                   /db_xref="GOA:E3J8J5"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J5"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADP78438.1"
FT                   /translation="MGPPDWPFPANRPTELEGVTMGPMESFGHWRRGRAGLTALAVRQD
FT                   PPDVPGVVFGRMRHSRIGTALRAHPVLVDSTLALAVCVLALVPLALPPHGPEGAILLLT
FT                   LAATAPLCLRRSYPLGTFVVCALVSLAQILLWVPSFGTFTSLLIEFYTVAKWCSRRATS
FT                   AAAASVTAWILWFCVRLPQVRAVDRVGVALVFLPAAVAAGVLGVNANTRRAYVASITDR
FT                   ANRAERERDQQARLAAAGERSRIAREMHDIVAHNLSVMIALADGAGYTLRDLLGDAADP
FT                   QDQRVRRATKAVESVSATGREALAQMRSLLGVLRDDGGLTQPADGGLGPDGALSGNWPA
FT                   GDPGLDVVEQWGDAAGPGLDGGPRPDEPARAPQPRIADLNRLIEQVRHAGPTVGFLVTG
FT                   QRRELPTDAELTVFRIVQESLTNVLKHTGPRANAVVRLGFDPSGVDIEITDTGSAPDDG
FT                   SDRSVAEGPRSPGRGISGMRERAALHGGTLVAGPGAGGWRVAARIVAPAGPPPVAATGQ
FT                   APEVPPARAVATPPGTEASRYSEGAPRP"
FT   gene            complement(437502..438326)
FT                   /locus_tag="FraEuI1c_0353"
FT   CDS_pept        complement(437502..438326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0353"
FT                   /product="putative ABC transporter transmembrane protein"
FT                   /note="KEGG: fal:FRAAL2980 putative ABC transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78439"
FT                   /db_xref="GOA:E3J8J6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2980"
FT                   /protein_id="ADP78439.1"
FT                   /translation="MNTTTIADARLGVGTGDVTQLRVVHSEWVKLRSLRSTGWTLGSAV
FT                   LLLIGLGLPLCLQASHHWSPAEVQSRDQDPVFQSLGGLLLAQIPIGVLGVLTMTGEYAT
FT                   GMIRATLGLVPKRLPVLWAKVAVFGAASFVLMLVAALVSFLVGQVPLSHHGVGVTLGSP
FT                   GAARAVLGAAGYLALVGLLGLALGALLRHTAGAVSALLGVLLGLPILFGLLPESWQPAA
FT                   RFLPTLLGEGMASTSPPSVTHQLSPGLCFVVMSLYTVVGLVAGAFVLARRDV"
FT   gene            complement(438323..439312)
FT                   /locus_tag="FraEuI1c_0354"
FT   CDS_pept        complement(438323..439312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0354"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fal:FRAAL2979 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78440"
FT                   /db_xref="GOA:E3J8J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78440.1"
FT                   /translation="MIEVQGLTKRYGRKVAVEDLSFTVQPGVVTGFLGPNGAGKSTTMR
FT                   MILGLDRPTSGIALVDGRPYRELRAPARHVGALLEARSIHSGRNARNHLLALAATHGVS
FT                   TRRVDEVIDLVGLREVAGKRAGGFSLGMGQRLGIASALLADPSTLILDEPVNGLDPEGI
FT                   RWIRDLLRGLAAEGRAILISSHLMSEMALTATHLVVIGRGRLIQETTVEQFVRAASSSR
FT                   VHVRSPQAAEFAELLAQAGATVSFSPATAGNPATRAVSSIPPQLTISDSIEVAGLPVER
FT                   IGDLARAHGITLYELSPRLASLEDAFMDITRDAVEFATATPSTRGGNR"
FT   gene            439670..440542
FT                   /locus_tag="FraEuI1c_0355"
FT   CDS_pept        439670..440542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0355"
FT                   /product="modification methylase, HemK family"
FT                   /note="KEGG: sro:Sros_5450 HemK family modification
FT                   methylase; TIGRFAM: modification methylase, HemK family;
FT                   PFAM: methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78441"
FT                   /db_xref="GOA:E3J8J8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J8"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ADP78441.1"
FT                   /translation="MSLSPSSPLSSAPHSSSVPAPRARDNLIARLRAAGCVFAEDEAAL
FT                   LLAAATDQAELDRLTDRRVAGIPLEHVLGWAEFHGQRILVDDGVFVPRRRTEFLVDLAA
FT                   GRWLADRAAEAVPRAAVVVDLCCGSGALGAVVAGLLRSSGVELHAADIDPAAVRCARRN
FT                   LAPLGGQLYEGDLYAALPVGLRNRVDLLLVNAPYVPTAAIGLMPPEAREHESPVALDGG
FT                   SDGLAVLRRVLAGAGDWLAVGGRLLVETSEAQATELIAAVSAAGLAGEAVHSEEHDVTV
FT                   VLATRPAHR"
FT   gene            440605..441477
FT                   /locus_tag="FraEuI1c_0356"
FT   CDS_pept        440605..441477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0356"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fal:FRAAL1558 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78442"
FT                   /db_xref="GOA:E3J8J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78442.1"
FT                   /translation="MPLVGCIGQRGVVGGGVTEAGIRLTGVTRSYGDVLAVEGVDLAVP
FT                   RGRRLAVVGPSGCGKSTILGLMSGLDEPDQGVVDVLGATDQAARLARCAWMPQRDLLLP
FT                   WRSALANAAVSLENRGISRREARAVVRPLFARFGLAGFEEHRPRQLSGGMRQRVAFLRT
FT                   FVAGKEVLLLDEPFGALDAITRAEAQDWLRAALEAEPRTVVLVTHDVEEALLLGHEIVV
FT                   LTGRPGKVAASYAVDLPAAATRRELLATPEFIQLRDKVLAALEQRPSAPVAAVKSADGS
FT                   PNPVRRAEG"
FT   gene            441481..442320
FT                   /locus_tag="FraEuI1c_0357"
FT   CDS_pept        441481..442320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0357"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL1557 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78443"
FT                   /db_xref="GOA:E3J8K0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78443.1"
FT                   /translation="MSSTAQAHAAARTGNRTAGRQGRLVRVFRRYGPAAVVLVAILAAW
FT                   ELATVVFGVEDYILPAPSAVVRALVDRWNGTLASATWVTLTEVLLGFAIAVAAGLVTAS
FT                   CLHFSRIARAALYPWLIGSQTVPVVVIAPVLAIIFGYTLTPKLILVALLCFFPIVVATL
FT                   DGLAAVEPDLVRLMRTLYGSRWAIFRRVELPAALPSMFTGLRLSAAYAATAAVFGEYSG
FT                   SSDGLGHVMRQAVPQLQSALVFAAIALLSAMSVALFVLVTVLERLLVGWAHEGKKVR"
FT   gene            442317..443351
FT                   /locus_tag="FraEuI1c_0358"
FT   CDS_pept        442317..443351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0358"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: fal:FRAAL1556 putative ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78444"
FT                   /db_xref="GOA:E3J8K1"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1556"
FT                   /protein_id="ADP78444.1"
FT                   /translation="MRAHRSRLLTGLGAASALMAGVLVLTACGGGTKSSDAGGSAQTRR
FT                   TTVLLDWDPNPDHVALYSARAAGYFKAAGLDVTLQSPSDPSDPTKLVSTGKVDLGISYE
FT                   PETIIAGSQGLDVVSVGALVPTALTSVIATDKSRVHSIPDLAGARVATAGLATQDAFLK
FT                   TILAQNHVDAGSVKKVDVGQDLIAAMVTGNVDATLGGFRNVEAVQLEAQGLKPTVIPVT
FT                   AAGVPNYAELVVIAKASRLKSDPAYRQLVRDFLAALAKGNAAVLADPATAAATIAKVAQ
FT                   GYDPAVLPKMVDATVPLLRNAAGFGHEDPAAWQSFADWMSAQQLIDKPVKAADVVTNSY
FT                   LPAS"
FT   sig_peptide     442317..442400
FT                   /locus_tag="FraEuI1c_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.440 at
FT                   residue 28"
FT   gene            complement(443373..443660)
FT                   /locus_tag="FraEuI1c_0359"
FT   CDS_pept        complement(443373..443660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eta:ETA_29080 hypothetical protein YqjC"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78445"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K2"
FT                   /inference="similar to AA sequence:KEGG:ETA_29080"
FT                   /protein_id="ADP78445.1"
FT                   /translation="MRIRLVGASLLAVVAIAATATGCSQKAREVGRDAPVSSHDDKPAR
FT                   LINMPDGFSNVSAKCDGPNMVYVVYHSDSAYGSVAIAPNDPRCRTAGSTG"
FT   sig_peptide     complement(443592..443660)
FT                   /locus_tag="FraEuI1c_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.613 at
FT                   residue 23"
FT   gene            complement(443823..444473)
FT                   /locus_tag="FraEuI1c_0360"
FT   CDS_pept        complement(443823..444473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0360"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rer:RER_47160
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78446"
FT                   /db_xref="GOA:E3J8K3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78446.1"
FT                   /translation="MAKEETLPQPVSTMTAAQLARRRRLTDAVIEMIDQVPPDQLQMRD
FT                   VAERSGVALGTAYRYFSSKDHLLAAAWADWQRRLTDRVRGEVSRDHGRSGSAAVPPVGA
FT                   CTRVVGFLHREIRAFQRHPNFARLVTHVEVASDPFASEEIAGLADDNRTVMAALMSGVP
FT                   PEVARPATIAINATLASGLASWTAGRLTFPDLVRQLEDVTRLVLRDYDDTAAG"
FT   gene            complement(444638..446857)
FT                   /locus_tag="FraEuI1c_0361"
FT   CDS_pept        complement(444638..446857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0361"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: rer:RER_04020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78447"
FT                   /db_xref="GOA:E3J8K4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K4"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADP78447.1"
FT                   /translation="MSIGLTEEHSALAASVRGFVTRHAPSTATRAELDQYAAGKPVPYW
FT                   DGLVELGLTSLHLPEEFAGAGAGYVELAVALEETARGLVPGHLLPTVLTSALLAHHGGD
FT                   DLRKRHLPGLAAGTLGASALAAAGLRATPAGDGGYTVSGVSVPVLGAAGAELLLLGARL
FT                   DDGELWFVTDPDAPGLRVEPATAVDLTRGVARIRLDGVRVDAEQVVALDTESARTLAVV
FT                   LFAAEAVGVARWLLTTGVEYVKVREQFGQVVGSFQAIKHRCARMLVRVETMSAAAWDAA
FT                   RAVEQGDEQLALAAAEAAVLCLAGATELGLDTVTLLGGIGYTWEHDTHLYWRRAMALES
FT                   LLGPVSAFEHRLGELVGGAPRETAGQSTAAGGPTRDFTLELPDEDPAFRARIASVLGEV
FT                   ASLPAADRQRRLADEGLVLPHYPRPYGIAATPLEQLVIQQEYERSGVTQPKTIIGEWAM
FT                   PTILAHGTDEQKATLVPATLRGEITWCQLFSEPGAGSDLAALSTRAEKVEGGWRLNGQK
FT                   VWNSMAERANYGICLARTNPDVPKHRGISYFLVDMKTPGIDVRPLREANGNYLFNEVFF
FT                   TDVLVPEDRIVGEPDKGWALARTTLGNERVAMGGMRELRMDLPALAASGELVTDPGDVR
FT                   RDIGALYALAFALSAMSLRSTLRTLSGLRPGAEASVAKVAASFLNTDVGTRVLRWFGPS
FT                   AASADGPAAAAVHQYLSIPPHLIGGGTIEIQLNVISERVLGLPRG"
FT   gene            complement(446966..447829)
FT                   /locus_tag="FraEuI1c_0362"
FT   CDS_pept        complement(446966..447829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0362"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmi:MMAR_0140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78448"
FT                   /db_xref="GOA:E3J8K5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K5"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADP78448.1"
FT                   /translation="MAFPTGVPIIDTMIGFPQPGTSQYDFIRRQLKDAESKEFAFPAEY
FT                   MFKNVPHDLPTDDPVSVTLHEMDRFGVEKGLIGCAGESARVALKKFPDRFVASGNINDP
FT                   NDVMGTVRAIVRDHEEYGIRAVGAFPSGTFPQVAINDEKMYPAYAKCVELGIAVFCCAG
FT                   VPGPRLKFEPQRVELIDQVMFDFPDLVFVTRHGCEPWTDLAVKLLLKWPNLYYSTSAFT
FT                   PKYYPKAIVDFANTRGADKILYAGYFPMGLTLERIMTDMPTVPFRDHVWPKFLHENARK
FT                   VLKLDA"
FT   gene            complement(448159..449565)
FT                   /locus_tag="FraEuI1c_0363"
FT   CDS_pept        complement(448159..449565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0363"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG: fal:FRAAL6537
FT                   prolyl-tRNA synthetase; PFAM: Anticodon-binding domain
FT                   protein; tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78449"
FT                   /db_xref="GOA:E3J8K6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K6"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ADP78449.1"
FT                   /translation="MAVLTLRSDDFPRWYQDVIAKAELADNGPVRGSMVIRPYGYSLWE
FT                   RMQADVDARIKAAGAVNAYFPLFIPESYLRREAEHVEGFSPELAVVTHGGGKELEEPVV
FT                   VRPTSETVIGEYMAKWTQSYRDLPLLLNQWANVVRWELRPRLFLRTSEFLWQEGHTAHA
FT                   DGPDAAAYARRIALEVYQDFMVSVLAMPVFVGRKTRKERFAGAINTLTCEGMMGDGKAL
FT                   QMATSHELGQNFARAFDIDYLGADGARHLAWTTSWGSSTRMVGGLIMAHGDDAGLRVPP
FT                   RLAPTQVVVLPVRDDEKVVATATQIADALKAAGVRATLDARPGLSFGRRVTDWELKGAP
FT                   VRVEVGPRDLAVGNVTLARRDTGEKITVPLAEAAARVPALLDDVQAGLYQQALALRDSR
FT                   TADVTSLADAIEAAATGFARLPWRLVGDEGEARLAAESLTVRCIQNADGTLPTGTDDTD
FT                   DLVCLVARAY"
FT   gene            complement(449708..450007)
FT                   /locus_tag="FraEuI1c_0364"
FT   CDS_pept        complement(449708..450007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78450"
FT                   /db_xref="InterPro:IPR023817"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6536"
FT                   /protein_id="ADP78450.1"
FT                   /translation="MNDTAAGAGDLKTGGDTDELDPEPGHLAELPRSLAVVTTAREGSA
FT                   VEHQLLISPGATAADVTAAMILMPPAAALVGHRGAGDVALVFREPAGLAADAAL"
FT   gene            450622..451737
FT                   /locus_tag="FraEuI1c_0365"
FT   CDS_pept        450622..451737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0365"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="KEGG: fal:FRAAL6535 high-affinity phosphate ABC
FT                   transporter; TIGRFAM: phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78451"
FT                   /db_xref="GOA:E3J8K8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K8"
FT                   /inference="protein motif:TFAM:TIGR00975"
FT                   /protein_id="ADP78451.1"
FT                   /translation="MKVGKRQSAAAGIAVAALLGVAACGSDNNSGGGGSTPSAAGTSAA
FT                   TISCATGSISGSGSSAQKNAMDQWVKDYTAKCSGAQIQYASVGSGAGRTAFIAKQVDFA
FT                   GSDSALAEPQATDANKVCTGGAAIDIPTVAGPITLIYNLSGVSTLKLSPSLVAKIFSGA
FT                   ITKWDDPAIKAENSGASLPSTPIQTIHRSDSSGTTDNFSKFLHGAAPADYPTDHSSDWK
FT                   APGGQGAKGSDGITSVVKSTAGAIGYVEQSYADNAGLPTAEIKNANGEYVKASTDAASK
FT                   GLSTATVADGNDLKVTFDYTSKVAGAYPIYLISYEIVCTAGQDPAKAGLVKSFLTYATS
FT                   DAGQSSITDLGYSPLPSSLATKVRGVIATLP"
FT   sig_peptide     450622..450699
FT                   /locus_tag="FraEuI1c_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.775 at
FT                   residue 26"
FT   gene            451866..453047
FT                   /locus_tag="FraEuI1c_0366"
FT   CDS_pept        451866..453047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0366"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="KEGG: fal:FRAAL6534 high-affinity phosphate ABC
FT                   transporter membrane protein; TIGRFAM: phosphate ABC
FT                   transporter, inner membrane subunit PstC; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78452"
FT                   /db_xref="GOA:E3J8K9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K9"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADP78452.1"
FT                   /translation="MTTEPAIEPGGPAGPGGTEGIEPPPPITPEGGKAKVSLADSLFKN
FT                   LTRACGVVLLLLIAAIAVFLVVKATGALGANKGNFFTTKTWNPNDIPPVFGIAALLSGT
FT                   VITAAIAMLLAVPVGVGIALCITNYAPRRVADPIAYVVDLLAAVPSVVYGLWGLVVLVP
FT                   HMVGVESWMNQYLLWFPWPELAGALIGFVVQRLVGRGTVGSFVTSGGVLGLLVGIVAGI
FT                   AKAPDSIGIFNTHGAGTVGRGIFVASVVLAVMILPTIAAISREVFRQVPTAHKEAALAL
FT                   GATRWEMIRTAVLPYGQPGVISGAMLGLGRAMGETIAVALVLPASFNIPWRVLTPAGNT
FT                   IAANIANAYGEANDNGRGALIASGLVLFIVTMIVNMAARAVIARRAEFSGSAT"
FT   gene            453044..454111
FT                   /locus_tag="FraEuI1c_0367"
FT   CDS_pept        453044..454111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0367"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="KEGG: fal:FRAAL6533 phosphate ABC transporter
FT                   permease; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstA; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78453"
FT                   /db_xref="GOA:E3J8L0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L0"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ADP78453.1"
FT                   /translation="MTTATAEAPAGAPSDDHLHLKGNQLPAYALPAVAAGAVAVALVLY
FT                   FATSIQGKIQTGLIAILLYGIGQTIASSLVEGGRRAVDRFVRTIIFGTLLLALIPLVAV
FT                   LVQVLVKGASRLDGDFLTHSMAGISARDAGGGAYAALIGTLEQIGLASLISIPFGVLVA
FT                   VYLVEYGRRNRLSRTISFFVDVLTGLPSIVAGLFIFAFWILLLHQHQTGFAGSLALVIL
FT                   MIPTVVRSTEEMLKLVPNELREASFALGIERWRTIMKVVIPTALPGIVTGVMLAISRVA
FT                   GETAPLLLTIFGNDYINSNPFVGHQSSLPIFIFTEATKPQASAIARAWAGALTLIILIM
FT                   LLNLIARLVSRRAKV"
FT   gene            454209..454985
FT                   /locus_tag="FraEuI1c_0368"
FT   CDS_pept        454209..454985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0368"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; KEGG: fal:FRAAL6532
FT                   high-affinity phosphate ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78454"
FT                   /db_xref="GOA:E3J8L1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L1"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ADP78454.1"
FT                   /translation="MATRIDIQGIDIFYGKFKAVSKVELAIEPKNVTAFIGPSGCGKST
FT                   VLRTLNRMHEVIPGARVEGKVLLDGEDLYGPGVDPVNVRRRVGMVFQRPNPFPTMSIYE
FT                   NVIAGLKLNGVRKKSLLDERVEESLRGANLWEEVKDRLGRPGAGLSGGQQQRLCIARAI
FT                   AVEPEVLLMDEPCSALDPISTLAIEDLIQKLKNSYTIVIVTHNMQQASRVSDATAFFSL
FT                   EATGQPGKLIEYDKTTKIFSNPAEKRTEDYISGRFG"
FT   gene            455021..455797
FT                   /locus_tag="FraEuI1c_0369"
FT   CDS_pept        455021..455797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0369"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: fal:FRAAL6531 putative two-component system,
FT                   regulatory protein; PFAM: transcriptional regulator
FT                   domain-containing protein; response regulator receiver;
FT                   SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78455"
FT                   /db_xref="GOA:E3J8L2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L2"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADP78455.1"
FT                   /translation="MPAAAAPTAAAAVVLVADAEVDDTLVAAFAARGAEVRVVGDGALA
FT                   LLEAGRLAPSVVLVGANLPVVDGIGVVRALRAMRGRGEVTILLGLGPDDLAQAADGLEA
FT                   GASACVAKPYLVAEVLALAGLPADGLATTPGASALGGPRLAARPGGSGTEADPEVLRVG
FT                   AVSLDIGAHQVRVDGVPVAVPPREFRLLRVLLERAGRVVPRESLLELVWGTSQMDSNTL
FT                   AVHVRRLRRRLGDTAETPWSIESVRGVGYRYRIPTS"
FT   sig_peptide     455021..455080
FT                   /locus_tag="FraEuI1c_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.704) with cleavage site probability 0.661 at
FT                   residue 20"
FT   gene            455930..456430
FT                   /locus_tag="FraEuI1c_0370"
FT   CDS_pept        455930..456430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78456"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L3"
FT                   /inference="similar to AA sequence:KEGG:Sros_0030"
FT                   /protein_id="ADP78456.1"
FT                   /translation="MVESGVDRRSVGRVVPPVGPRALAKVPFVELAHGRLQGVVSSGSD
FT                   IERVYVSSIETRSHAYNCGTNNNRPCGGLTGGGPCNHLRALVDAAVMQYGVERVARYLR
FT                   VDIAEGAGSGSDVLAALRGQRAQLPASAVFSDFLRHLGYLELPDVTEPVPELDWFPAGR
FT                   VVA"
FT   gene            456430..457857
FT                   /locus_tag="FraEuI1c_0371"
FT   CDS_pept        456430..457857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L4"
FT                   /inference="similar to AA sequence:KEGG:Sros_0029"
FT                   /protein_id="ADP78457.1"
FT                   /translation="MLATQLADLLAATPAGVADALAVVDGFDDTLVTGLGRLGADQHAA
FT                   VFALADVLAASPLGPVAREAAEKLATGSVSDDVLATLAGARAAVLGAVHDALLGAVDLT
FT                   VGRERSAWDEGMGSAGATAGEAALGGCRSWLRELAIVGWRGAEDELVSSSAQAREAALA
FT                   VPPLRRLAVLLDGLAAELLAAGPVGVRGRLPVRRWADLWTRGVLLARHGAWAADGSAGV
FT                   STGRLLPLGAEVAEHGTAVRLVVHAVLETAGERPRLMRTAVTAAKVDTIVGPAVWRLLE
FT                   TYPVLVGALVERRAVEFSELVLLSTGDLVWREDAARLAEAADPFVTARVLPAGALAPPV
FT                   APLDRHPVRICEPVLLEGYTATLADDGQTLTFDLGGSVLGVEVEPAAADPAVSLGPLAP
FT                   AVLAGSSACLGLLRWDEGRWLLRPLGVQAVVKKKPLVAHVGDWARGAPDPRIAKARAKN
FT                   EDAVPVLRERAGRLLRG"
FT   gene            457854..459227
FT                   /locus_tag="FraEuI1c_0372"
FT   CDS_pept        457854..459227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0372"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="KEGG: stp:Strop_2018 VWA containing CoxE family
FT                   protein; PFAM: VWA containing CoxE family protein; SMART:
FT                   von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78458"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L5"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="ADP78458.1"
FT                   /translation="MSIPSVSSGPAASAGPAGSAEPELDPAASENRRQVLYWRLLARIF
FT                   APDEQPSLEAASLAIVEDLDLPAALLDPTVSIDNVVQRFPALAPEIDGLLAAPAADLPA
FT                   GSVGAAEVRTAAVMAKLLLNTFATGSGGVTAGQLADWQADAGWLRRTLGPDVGDGPGGP
FT                   GAVLGEIEADLVSRMHLREVLANPTLARRLTPSMSLIEQLLRDKDNLSGVALANAKALI
FT                   RRFVDEVAEVLRTQVEQTSAGTLDRSVPPKRVFRNLDLDRTIWKNLPNWSPEDQRLYVD
FT                   RLYYRQTARRTTPAKMIVVVDQSGSMVDSMVNCTILASIFAGLPRVDVHLIAYDTRALD
FT                   LTPWVNDPFEVLLRTKLGGGNDGPVAMEMARPKISDPRNTVMVWISDFYEFDRSQPLFE
FT                   AIESLHRGGVRFIPVGSVNSSGRGSVNPWFRERFKDLGTPVISGHIRKLVAELKNFVA"
FT   gene            459282..460397
FT                   /locus_tag="FraEuI1c_0373"
FT   CDS_pept        459282..460397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0373"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="KEGG: sro:Sros_0027 hypothetical protein; PFAM:
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78459"
FT                   /db_xref="GOA:E3J8L6"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L6"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADP78459.1"
FT                   /translation="MTAEMLRAPAEVKYAAELDWLESVDGGPRPYSWRLSPRMVRLFVL
FT                   GSRPADGLDRDVDQKWFGDPSLVERAIVTLASDRGLLLIGDPGTGKSWLAELLAAAISR
FT                   DSTLVVQGTAGTTEDHIKYSWNVSMVIAKGQSRESMIPSPIMTAMERGVIGRFEELTRS
FT                   TSDVQDALISILSEKYVSIPELDTDSIAFAKPGFSIIATANSRDRGVNELSSALKRRFN
FT                   FIRIPVVTNKRSEADIVRFRTAELLRRHEIDLDVPPTLLDILLQSFADLRAASAAATSD
FT                   DERLESALSTAEQIGVLEDAILHSRFFGDRALTAGTLAGSLVGSLARRSPEDLAILNKY
FT                   WHGVVEPRSKSDGGLWPDFLEGGRQAIATLS"
FT   gene            460394..463519
FT                   /locus_tag="FraEuI1c_0374"
FT   CDS_pept        460394..463519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78460"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L7"
FT                   /inference="similar to AA sequence:KEGG:Sros_0026"
FT                   /protein_id="ADP78460.1"
FT                   /translation="MTVSPELAEPADVASFEQLRARLVEAAGAFAADSAALAEITTGLV
FT                   DDVSWMLREPLEIFPVCHHSPASALAMSRRLREKRPRVIYLELCEDLRPLLGELRNCRL
FT                   PVAVQAFAHELAGFPTGWGPLSVVAPLTEASAEYQAIAYALDTPGVELVLVDWSADHVF
FT                   QWEAQSDGATAPAGPDDAEGRPVDPDRAEEAALHGDAVGIEIGDLRPRFAELEAFLLAH
FT                   GRVRHWSEWWDQYAEQPLLDADYGVYRQAMALIGSLFRRLRPGGPDDRLARDEERERHM
FT                   WTRIREHLANSGVDRSDCLYVCGAFHAVSRVPEFGTLHAAEPAPFPEPSVLANPARETG
FT                   LAEPAGYRIRPVTATSWLYGLIPSSHSAIEAQFGLAGGSVSIAQATWAKALQRSGATPF
FT                   RLAGKPGEAGPGKRPSARAPRSAKAGSTGKDGSRAALLGGPATGAPRGGEADAGQAGLG
FT                   SGPTEVYIDRLAGFLERPPALDALDEAELLGWSVDIVRLARRGGYLASTADAIAVFETS
FT                   ILLAGLRNRARPTPYDFQDAAVTCIEKDVVPGRRDVRRLCEILLGGDRVGQVGYDALPP
FT                   LARDVLDRLAPLGLDLEKRTVQRALLDLTARPELAACSRLLWMLRYLLPDGAIRPILGV
FT                   RRLGETSPQESWDLAIGRHQRAIIELGYEAVTVEQALEQRLRKAVWAPDATASRALAAV
FT                   EDAILFLGGRRLADELGARAVELLTAERTVDDAPEVLRRIRRLLDYYRVNGPSLPGWCE
FT                   EFVKGGYAHYCTLLPTAFAAEDVGVRQVASMLGFLLTMENLALALGCDRAQLDLAVRQS
FT                   HPEAPDRVALLWAAQSRLGQLSMYELRVRCDDLIANPLVIPTFPRYLVGFVQAVEPVPG
FT                   LAAFVVEVISKAFASLPDAVLLPWLPTLIAALRKDAADHVSTLVREAARTFPSGLPDLD
FT                   AWTPPWSERSPVAGPTSAAASSNVGSSPAGTVRRPTAPTVVTLLGRYPAATDAVAALLG
FT                   VTGEWSAITATRHEQPVEWSDRAGRSTNTVAALLATHPATAAAVHGLITGSA"
FT   gene            complement(463542..464540)
FT                   /locus_tag="FraEuI1c_0375"
FT   CDS_pept        complement(463542..464540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0375"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   Helix-hairpin-helix DNA-binding class 1; iron-sulfur
FT                   cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78461"
FT                   /db_xref="GOA:E3J8L8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L8"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADP78461.1"
FT                   /translation="MNGNQDGRTDAAVAHLPAAGLVGDAAGTFGGAHKTEDGERPFAEP
FT                   VLEWFGLVARELPWRRPEAGPWAVLVSEVMLQQTPVNRVLPVYEAWLARWPDPAALAAE
FT                   PSGEAVRMWGRLGYPRRALRLHQAATAIVERHGGAVPDNLDDLLALPGIGTYTARAVTA
FT                   FAFRQRQPVIDVNVRRLVARAIEGRAEGPVAVSRKDLALVEDLLPADAETAARASAAFM
FT                   ELGALVCVARAPRCAGCPVRERCAWLLAGSPPADGPARKPQGYAGTDRQVRGRLLAVLR
FT                   EADGPVHATLLDAAWDEPIQRDRALRGLLDDGLAVVLSPGVFALPGDAQAG"
FT   gene            complement(464887..465966)
FT                   /locus_tag="FraEuI1c_0376"
FT   CDS_pept        complement(464887..465966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0376"
FT                   /product="DNA integrity scanning, DisA, linker region"
FT                   /note="KEGG: fal:FRAAL6529 DNA integrity scanning protein
FT                   DisA; PFAM: DNA integrity scanning, DisA, linker region;
FT                   protein of unknown function DUF147; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78462"
FT                   /db_xref="GOA:E3J8L9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L9"
FT                   /inference="protein motif:PFAM:PF10635"
FT                   /protein_id="ADP78462.1"
FT                   /translation="MAGPPGDEAFRTTLAAVAPGTPFRDGLERILRGHTGALIVLGHDK
FT                   VVEGVCTGGFQLDVEFSATRLRELAKMDGAIVVSTDLNRIVRAAVHLVPDPTIPTEESG
FT                   TRHRTAERVARQTALPVISVSQSMRIIALYVGGRRYVLDDSAAILSRANQALATLERYK
FT                   QRLDEVAGTLSALEIEDLVTVRDAISVLQRLEMVRRIADEIEGYVVELGTDGRLLSLQL
FT                   EELMAGVETERELTVRDYQPVGAKVGSPAEVLTDLAAMSATDLLDLTALARALGFGSGA
FT                   DALDRQISPRGYRMLAKIPRLPRLIVDRLVDHFTTLQKLLAAGVDDLQAVEGVGETRAK
FT                   AVREGLSRLAESSILERYA"
FT   gene            complement(466272..467795)
FT                   /locus_tag="FraEuI1c_0377"
FT   CDS_pept        complement(466272..467795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0377"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; PFAM: Circadian
FT                   clock protein KaiC central region; KEGG: fal:FRAAL6528 DNA
FT                   repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78463"
FT                   /db_xref="GOA:E3J8M0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADP78463.1"
FT                   /translation="MSDPTATVSGMAVVGSSGNASASGSGSASRRAAGGASGRSRADGG
FT                   FRCSECGAESIRWAGRCPRCQAWSTLEAQKAPPRRAAVAGSGATAPATVTTPAKPVTEV
FT                   DPSPAARRSTGVDELDRVLGGGVVPGAVILLAGEPGVGKSTLLLEVAARSAQAGHRALV
FT                   VTGEESVAQVRLRAGRTGTLHADLWLAAETDLGALLGHVEEVQPTLLVVDSVQTISAAG
FT                   VDGVAGGVTQVREVAAALIRAAKALGLATILVGHVTKDGSVAGPRLLEHLVDVVLHFEG
FT                   DQQTALRMIRSVKNRYGPTDEVGCFEMNENGIWGIADPSGLFLSRGATASAVPGVCVTV
FT                   MVEGRRPLVAEVQALVAPQSYGRGGAGAPAPPPPRRAVSGLDGSRVAMITAVLQKRSGF
FT                   GMLGGADIFTASVGGVKLHEPAADLAVALAMVSSAQDRGVPSDLIALGEVGLTGEIRSV
FT                   SGIERRLAAAARLGFRRALVPRLSGLVPEGMTVTEATDLNAAIANMYDG"
FT   sig_peptide     complement(467727..467795)
FT                   /locus_tag="FraEuI1c_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.725 at
FT                   residue 23"
FT   gene            complement(468027..468773)
FT                   /locus_tag="FraEuI1c_0378"
FT   CDS_pept        complement(468027..468773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0378"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: fal:FRAAL6527 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78464"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6527"
FT                   /protein_id="ADP78464.1"
FT                   /translation="MSRRLGARSIAFPRRPVVSPALPTSPAVAAMHGQTREGAAAHPLR
FT                   RGAVMLAAAALLGAPALAACASGNDAMTNLARTTTNTANGAVGTINLRNVYVAGPVSQG
FT                   GDAQVISALFNGGSQDDALVAISSPDATGGTPGSPATLAPAGGQIYIANGSAPTLTGLK
FT                   KNLPIGTATKVTFTFAKAGAVTLDVPVEAPLPGASAAPSVTAAATTAAATPTATGTALT
FT                   GVTPTAGASATTGLVPTVAPTVTATP"
FT   gene            469962..470444
FT                   /locus_tag="FraEuI1c_0379"
FT   CDS_pept        469962..470444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0379"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: fal:FRAAL6525
FT                   putative CarD-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78465"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M2"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADP78465.1"
FT                   /translation="MAFQVGETVVYPHHGAALIDAIETRVIKGEEKLYLVLKVAQGDLT
FT                   VRVPADNIGMVGVRDVVGQDGLERVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRRDRERGLSAGEKRMLSKARQILVSELALAEGTNEDKAEAMLDEVLAG"
FT   gene            471172..471879
FT                   /locus_tag="FraEuI1c_0380"
FT   CDS_pept        471172..471879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0380"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: fal:FRAAL6524 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78466"
FT                   /db_xref="GOA:E3J8M3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M3"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADP78466.1"
FT                   /translation="MTGPEARVAVVVPAAGRGERLGGGVPKALRPLGGRPMLVHAVQAL
FT                   AAADLVSQIVVAAPPTLVEVVSRLLGPDVRVLAGGAERVDSVRGALRALDDDIRVVLVH
FT                   DAARPLTPPSLVDAVAAAVLGGQPAVIPVLPVADTVKEVDAQGRVLRTPTRDGLRAVQT
FT                   PQGFRREVLEAAYANSDDGPAVTDDAGLVERLGVPVTTIPGAEEAFKVTRPIDLVFAEA
FT                   LLARRPLAESGRS"
FT   gene            471879..472397
FT                   /locus_tag="FraEuI1c_0381"
FT   CDS_pept        471879..472397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0381"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: fal:FRAAL6523 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78467"
FT                   /db_xref="GOA:E3J8M4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADP78467.1"
FT                   /translation="MAAGVTPATAAAIALPRVGVGVDVHPFEQGRPCWVACLQWDGETG
FT                   LAGHSDGDVAAHAACDALLIASGLGDLGKVFGTDRPEWSGASGAALLGETARLLAEDGW
FT                   TIGNVAVQVVGNRPRMAKRRDEAAAAMATALGGAVVSVSATTTDGLGLTGRGEGLAAIA
FT                   TALVARLAG"
FT   gene            472575..472967
FT                   /locus_tag="FraEuI1c_0382"
FT   CDS_pept        472575..472967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0382"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: fal:FRAAL6522 hypothetical protein; TIGRFAM:
FT                   putative F420-dependent enzyme; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78468"
FT                   /db_xref="GOA:E3J8M5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M5"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADP78468.1"
FT                   /translation="MGERLPEKVRTLADAPTYVTLATLQSDGSPRLTVLWIERDGDDLL
FT                   LSTVRGRAKERDIDRDPRVALMFLDQHDPYSYVEIRGTATLTEEGGRDLIDRLAVKYTG
FT                   EPYKWDGPDAIRVVIRISPTRVLTTG"
FT   gene            473179..474699
FT                   /locus_tag="FraEuI1c_0383"
FT   CDS_pept        473179..474699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0383"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: fal:FRAAL6521
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78469"
FT                   /db_xref="GOA:E3J8M6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADP78469.1"
FT                   /translation="MSLHLYDTRTRRVRPFEPLRPGHVGVYVCGPTVQSAPHVGHLRSA
FT                   VAFDLLRRWLLESGYAVTYVQNVTDIDDKIIVNADREGVSVWELATRETRSFDDAYRAV
FT                   GILPPTIQPRATGHIPEMFALIGELMAAGYAYEGDGSVWFRVGRFGDYGALSNQRPDAM
FT                   QASAEVEAGKEDPRDFALWKAARPGEPAWDSPWGSGRPGWHLECSAMAGKYLGDVFDIH
FT                   GGGLDLVFPHHENERAQTVCASAARAHDGSGEPEMARYWMHVGLLTTGGTKMSKSLGNS
FT                   FFVTDALAQVRPQVLRYHLLSAHYRSSLEYSPDALAESAAGYGRVETFVRNALDILGSP
FT                   EEAASLAAEASPAAAPRPAKSRGKGRPQGRAAAGPAGTASPAAAWAAFSAALDDDLGVS
FT                   RALAALFGAVAEGNLVLSKTHRGELAGWLVVVRRMLTVLGLDPVKQWPAAGGQVRAALD
FT                   GVMEIVRDLRSSARARLDYAEADSIRDRLRDAGIIVDDTGEGQRWHLA"
FT   gene            complement(474775..476109)
FT                   /locus_tag="FraEuI1c_0384"
FT   CDS_pept        complement(474775..476109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0384"
FT                   /product="Forkhead-associated protein"
FT                   /note="KEGG: fal:FRAAL6520 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78470"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M7"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADP78470.1"
FT                   /translation="MSARCPEGHLSQDPDYCDQCGLRITSGQDSYGYRSDDRGAPVGSY
FT                   GGGSGRGGGGGGTGAGYDPLGIRRGGEPAGRGTPRGGDPYGGEQYDSGFGAGYDDRPAR
FT                   SSYGADSYDQSGYGSPRGGRDGRAAEGFEGREAGGARGGRDDPDAGYGRGGRDGGGRGA
FT                   PADADGYQSSRGGRDDFGGRGGDQYGRDGGETAYARGGRDDRDGYGGGRGGRDAAAGDG
FT                   GRGYDSDPLGVADRGGARAAGRYPQCPNCRAYYEPGARFCENCGLDFTTGHMPGAGPAG
FT                   SGRRQTDPPVDGGYGEPVITGNAANWNGGGGAPVATTWEAVVEAERDYYDSGDDHRVPF
FT                   PSFYPRRVFPLSGPRLLVGRRSESRGIHPEIDLSGAPEDPGISRAHAVFERQPDGGYAL
FT                   LDPGSTNGTRLNDEPEPIEPHGPVPLQDGDRVYLGAWTRITIRAR"
FT   gene            complement(476420..477568)
FT                   /locus_tag="FraEuI1c_0385"
FT   CDS_pept        complement(476420..477568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0385"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6518 hypothetical protein; PFAM:
FT                   Protein phosphatase 2C-like; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78471"
FT                   /db_xref="GOA:E3J8M8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M8"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADP78471.1"
FT                   /translation="MTVEHDAAGSYDVGGSGYHGGSYDGGSGYDLPERGMPERGRSLID
FT                   ERTNRCPRCAVVLYGDARYCDSCGFALQGPPVVSGDSDHREKDLGQIAGVCDRGVRHAT
FT                   NEDAMGVAEVFGTMIAVVCDGVSTTPGSGEASAAAAATATTILADAVRAHGPGRAVPVG
FT                   RPGDVLDVLEPGDEDDYHDPVTLPAAVVGGFGPEEAELALHHAVHAAQDMIAQLSAAEG
FT                   RMAPSCTIAAAIISPPVAGGPRTVTIGWVGDSRVYLLGPRWSERLSADDTWAAEAARAG
FT                   LIPASEAETHRRAHTLTRWLGGDAEDVAPHTAVFPIEAPATILVCSDGLWNYASRPDVM
FT                   AAIVNQLPPDATAVEVGRHLIEFAIDQGGHDNITVITARVDR"
FT   gene            478266..479366
FT                   /locus_tag="FraEuI1c_0386"
FT   CDS_pept        478266..479366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0386"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: fal:FRAAL6517 tRNA/rRNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78472"
FT                   /db_xref="GOA:E3J8M9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M9"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADP78472.1"
FT                   /translation="MARGGQGGRAAKAGSHRKGASIGSGGQRRRALEGKGATPPAEMRK
FT                   GHPAQRRANAAARSETTSTRAGSTARPTGARDGGPARAGHTGQRDGGPARAGNTGQRDG
FT                   AATGRGGPAGRRPGETDELVVGRNAVVEALRAGIPAATLYVAGGLEFDERLTEARKLAG
FT                   RAGMAVVDIGRFELDRLCGVAPHQGLALVVPPFRYAHPDDLLARARASDPGLLVALDGV
FT                   TDPRNLGAVVRSAAAFGAQGVVVPERRAAGMTAAAWKTSAGAAARLPVARATNLNRTLR
FT                   SYADGGLVVVGLAANADVSLDDLAAATDPIVLVIGSEGRGLSRLVGENCDLLVRIPMAG
FT                   EVESLNAGVAAGVALAEIARRRRQTS"
FT   gene            complement(479397..479654)
FT                   /locus_tag="FraEuI1c_0387"
FT   CDS_pept        complement(479397..479654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6515 putative membrane-bound lytic
FT                   murein transglycosylase E"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78473"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6515"
FT                   /protein_id="ADP78473.1"
FT                   /translation="MSSAMKRLCRRARVAVFASAVVASVSAGMAAATPASAAVSAPRML
FT                   SALVACQSGANPGVVTLSATQQDADATSGAAHHPCWNNGS"
FT   sig_peptide     complement(479541..479654)
FT                   /locus_tag="FraEuI1c_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 38"
FT   gene            complement(480125..480805)
FT                   /locus_tag="FraEuI1c_0388"
FT   CDS_pept        complement(480125..480805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0388"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78474"
FT                   /db_xref="InterPro:IPR040783"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N1"
FT                   /inference="similar to AA sequence:KEGG:Tbis_1962"
FT                   /protein_id="ADP78474.1"
FT                   /translation="MAVSPGLPAAGGGRWVNVAPERVAGWLDRFAERHGSLTWTISPVT
FT                   IVATAADGAVADCQVPLPPLAVEPGTAPGAALAAHAGVERRVGVLLVRLGGYAAGVFEG
FT                   DRLVASKVGSRQVHGRSSAGGWSQQRFARRREGQVRVALGAAADTAAGLLLPAVPGLAA
FT                   MIVGGERRAVGQVLQDPRLAPLRSLVADPFLTVPDPRRRVLEDAPTQFRCVRIRVAESL
FT                   AAGG"
FT   gene            481041..482066
FT                   /locus_tag="FraEuI1c_0389"
FT   CDS_pept        481041..482066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5683 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78475"
FT                   /db_xref="GOA:E3J8N2"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5683"
FT                   /protein_id="ADP78475.1"
FT                   /translation="MGHGNGSGTADRQSGRPWRQDGAREGATGRPLGAASASRARGYRA
FT                   GPDPDLEVWDAEIVDEPWDPAVARSAEDVEIIDAATLDAIAQRLRAAAGPSADEPVVSR
FT                   APAPDPEHPRPPAEATGPVPRPASSAARRRHRPQPAWRTGLERLTAQVTAIAAPSRLGR
FT                   VFPAGGTHGRRGGRAPLAAVAGAVVLLLVVAGLAIVLFGHHSGSRTGATEGRGSAGQSG
FT                   GVDLAPGGLALADGPGSLAGAGAGGSGPVGGQGAEQVSGVQAEPVQGLGVGATPDLATT
FT                   AAPDVARTTAGPTAGASARPSSGASAAPSSPPTATPTAPRCYRGGPITSLLLAVVGVRS
FT                   C"
FT   gene            complement(482124..483131)
FT                   /locus_tag="FraEuI1c_0390"
FT   CDS_pept        complement(482124..483131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0390"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: kfl:Kfla_6883
FT                   acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78476"
FT                   /db_xref="GOA:E3J8N3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N3"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADP78476.1"
FT                   /translation="MEVVEFRPRPAQFAWTFGGVAPIRTVKPGTVLRLWTEDAFGGRLR
FT                   TTSDLPSSSLTMPFVNPQTGPFYVEGAEPGDTLVLHLVELTPARGWGASSTIPFFGGLT
FT                   GTDRTATLAPPLPERTWIYEVDRAKSTVTFTALSSEFQVDLPMSPMLGTVGVAPAAMEA
FT                   RSALVPDRFGGNMDTPEMRAGATCYLGVNVDGALFSIGDGHYRQGEGEACGTAVEGAMD
FT                   VTLIVELVKGRAPQWPRLESDTHFITVGSSRPLEDAWRIGQVEMVTWLSELYGLETLDS
FT                   YQLLSQISEAPLANVVDVNYSALAKIAKAYLPPVAAYDGMHRYLRDLAARIPPL"
FT   gene            483335..484531
FT                   /locus_tag="FraEuI1c_0391"
FT   CDS_pept        483335..484531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0391"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   fal:FRAAL1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78477"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N4"
FT                   /inference="protein motif:PFAM:PF06224"
FT                   /protein_id="ADP78477.1"
FT                   /translation="MRRVAAQLLASPLPARPTAAQRVRTVVQVVGHVLAVQAQDLRGLR
FT                   LAIRSRAAGLTVADVDRAFAERRLVVTWLNRGTLHLVRAEDYGWLHALTAPRQEVNVRR
FT                   RLGEEGVSPAEAERGVALVERALADDGPLSRAQLRDRLAAAGIPVAGQALIHILGLASL
FT                   RGLLVRGPIVGSEQAYVLVRDWLGPVAATSDALDAAPLAAVDESRTPLPAQDETGGTES
FT                   DRDTALVRLAVRYLAAHGPAGERDLASWSGLPLTDARRGLALAAGSGLTEPIGTEPLGA
FT                   GLVDLAGRPRGLGDLPWDEVSPDSLPTRLLGPFDPILHGWAARDWVTGPYRSIVTVNGI
FT                   FRAIALVAGRAAGTWTMPAGQVSLALFEPLPAAVELALRAESSDVRRFLAGDPGLAAG"
FT   gene            484800..486122
FT                   /locus_tag="FraEuI1c_0392"
FT   CDS_pept        484800..486122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0392"
FT                   /product="protein of unknown function UPF0089"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   fal:FRAAL4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78478"
FT                   /db_xref="GOA:E3J8N5"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N5"
FT                   /inference="protein motif:PFAM:PF03007"
FT                   /protein_id="ADP78478.1"
FT                   /translation="MRSESMVDMHAGGRPLSRMDRYMLDFQRAYPTRPVSVTCYLLRVS
FT                   GAPDLDAVRAAVLERVEAFPALTERLVERRGRAPRWEPGGGIDVASQVREYRLPADATE
FT                   DDLRAMAARLSSIVTPLDRPAWEVGLVTSPGADDVHVFFRSSHVWVDGLSQTRVLTCLF
FT                   GDQTAPAPWVRTGRLTARTLASAAVRQATTWSGPSAAPAALTEPSDGTCTVHWAHTDLE
FT                   RLRTLGKVYGGSVNDVYLVTVGGAIGAWSAPVGQRPVQAVLSVSTRRPAERAVLGNAFV
FT                   ATRVALPTEPAPPSERFAMMRQQTSYYKGDSNAALAERFWSDRVPSRFGHATIGGGQEL
FT                   RRAAVNTTNLGPIPGPLTVAGAPVTAALPVPAVREGRRQVLVTLGGVGRTATVGFTVPA
FT                   PRGAELAGLWLTEIENLERAAGIVPVPDQHLPTLAGGLETR"
FT   gene            486229..487755
FT                   /locus_tag="FraEuI1c_0393"
FT   CDS_pept        486229..487755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0393"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cwo:Cwoe_3300 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78479"
FT                   /db_xref="GOA:E3J8N6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78479.1"
FT                   /translation="MVVESRVAVSTASASTVTRAEAMESRAVDPSVMESSAGAAAGRTA
FT                   RFGASAQYALLAGPLLTMLDSSIVNVAVEPISRQTHTSLPTVQWIISGYLLALGAGLAL
FT                   TSYLARRFGTIPAYTGFLAAFTVTSALCAAAPGTGVLIAARVLQGLAGAPLVPLAMSML
FT                   LGGSGGAKSRMSPAAGILLFLGPALGPSLGGLLLGAVSGGDGWRVLFLINVPIGALAIA
FT                   AARRLPAGVSPPPQPAARPDPVGLLLLVAGLVGVLYGVDRITRGSWTPPMTWGPVIGGV
FT                   VVLVLYTLRSRSVEHPALDLSILRDRSVALAFTLCGTASVAAWSIVFVVPVFLESAQGH
FT                   SALMTGVALLPQGIVTGLSTLAGASAGEKIGVRPTVLGGFALLVVASAGLFVLGDQTPL
FT                   WLTALILAARAGAVGLTITPLVLVATEPLRPEQQADANTAFNVVQRILGSFGIGLVATL
FT                   FTRRSAHAGAVPALHTVALVITVLAGLSTFAAFYLPRPRRSGDVSPVALH"
FT   gene            complement(487733..488827)
FT                   /locus_tag="FraEuI1c_0394"
FT   CDS_pept        complement(487733..488827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_8332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78480"
FT                   /db_xref="GOA:E3J8N7"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N7"
FT                   /inference="similar to AA sequence:KEGG:Caci_8332"
FT                   /protein_id="ADP78480.1"
FT                   /translation="MTPLEQRYRAVLKVLPRGYRQLWEDDMVATFLSSVTDLDDPDVAE
FT                   FALPSWPEVGSVVLLAVRLRVDLVRSRLGGAGASPTSVVWGDAVRLIALAGLLVHAVLA
FT                   TLNVLSQLWVNDRIPGFAPPAGYPAAFGIHIGWREQWNAGFVWIPAFGAVLLGYRRIAR
FT                   GLGLIAVLPAALRVLADAWTLRDGQPTVDVQASTLVASILLNVVPVVALVAGFHRDAPP
FT                   VRRPVRWMAAYVALLAGTIGAAAARLGGGLLVDEPAIYAAAFLAAAAIHLSSRARRSAG
FT                   QGAASALALALIAPVVLATRAASLLWTRLTPADATRSTLTTLGLTQVAVVLVVTVPLAF
FT                   LAARSLRRLRRSPAPTTASAARQD"
FT   gene            complement(488824..489156)
FT                   /locus_tag="FraEuI1c_0395"
FT   CDS_pept        complement(488824..489156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0395"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sro:Sros_6088 transcriptional regulator protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78481"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N8"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP78481.1"
FT                   /translation="MTEPAFFVLTALVGAPRHGYGIVGEVRDLSQGRVQLKVGTLYGVL
FT                   ERLVADGLVALDREEIQQGRLRRYYRLTEPGSEALAAEAGRQEANAQVASRRLRALRPA
FT                   GTGGSA"
FT   gene            489382..491922
FT                   /locus_tag="FraEuI1c_0396"
FT   CDS_pept        489382..491922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0396"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: cai:Caci_8514 fibronectin type III domain
FT                   protein; PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78482"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N9"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADP78482.1"
FT                   /translation="MRRWAGPAALVALLVAGVAALVAGSAQGVAARSVSLDDVSAWLLS
FT                   PAVGEAELVDGNSGAVVTRVELGVGALTGTQSGTGEFVADSATGKLRRIDGATYRVSAP
FT                   ATFGKPGEALGVYPAGETVFAVDQPTGLVSLLDPRTLAVRQTYSLAAKVAAGGIVTQGA
FT                   DVLWAVGATTGDLERVDGSGTTIVRHAVDPARTTLVTAAGLPVAVDLTARQVVRLGSRG
FT                   VTGAGTCVDVAATDSSVQVVGSADRPAVYAVSGSRGVLLVSDLATGRCGDAVNLGVAGH
FT                   RLGQPREAAGRVFVPDYTSGQVLVVDVTAGRVIADPTVMPPSTAFELRDEGAVVFYNDP
FT                   ATAKAGVISLDGAIRPIEKYSPATVGTAPGGPASLAGKLPSDAAGGSQPPTGGTSPPSG
FT                   VQPTAVPTRPAATRPQRPTAPLTTIPPVGAGPAVASNDGRTAPTTSTTTEAPATGGGAP
FT                   TVRIAVSAPQARVGTALTMQAVLVAADGTVTAGKLAQVSWSFGDGGSATGSQVTHAWTA
FT                   SGVYTVSADVRLTDGTSAAPVTSVTVVAPNVPPVTTPPVTNPPVTVPPVTTPPTTKPAV
FT                   SPLKAVLSANKGSCTQDSANVTVDASGSAGGSGPLTYAFDFGDGTTAGPASAATVEHGY
FT                   SQTGPFTVTVTITDATGASAKATATATLLHLAASATSVTVGQSVTLTGTGVCAGASLDL
FT                   NIGAQYAGGTSTSGNIGHNVHEPNPYTSTWGTGTTTVSAHWSESDPYSDSNRLTITVTD
FT                   PAPPPPLQVTASSTSITLGQSVTLTATGGVHGSDGTYSWYGANPSGLGTSLCGTTASCT
FT                   TTPDTTGTWKYSVQVYDNAGNRAESNQLAVTVSP"
FT   sig_peptide     489382..489468
FT                   /locus_tag="FraEuI1c_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.438 at
FT                   residue 29"
FT   gene            complement(491950..492759)
FT                   /locus_tag="FraEuI1c_0397"
FT   CDS_pept        complement(491950..492759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0397"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: sro:Sros_6478
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78483"
FT                   /db_xref="GOA:E3J8P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78483.1"
FT                   /translation="MATPSNTYTHGHHESVLRSHRWRTAENSAAYLLPALRPGMTLLDV
FT                   GAGPGTITVDLAERVAPGQVTAVEVSESVLELPRAEAARRGAHTITFAVADVHALRFPD
FT                   DSFDVVHAHQVLQHVADPVLALREMRRVCRPGGVVAVRDSSYSDFDWTPRPPELDEWLD
FT                   LYLRAARANGGEPDAGRHLAGWAREAGFTDVTATTGHWVYESDADRRWWGEMWAERILR
FT                   SDMAGQALARGLASQEDLERISRAWRDWAATPAAAITIPHGEVLARP"
FT   gene            492942..494084
FT                   /locus_tag="FraEuI1c_0398"
FT   CDS_pept        492942..494084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0398"
FT                   /product="Microsomal epoxide hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /note="KEGG: cwo:Cwoe_0285 epoxide hydrolase domain
FT                   protein; PFAM: Epoxide hydrolase domain protein; alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78484"
FT                   /db_xref="GOA:E3J8P1"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P1"
FT                   /inference="protein motif:PRIAM:3.3.2.9"
FT                   /protein_id="ADP78484.1"
FT                   /translation="MTTLPDLRPFRIDVPRRDLDDLRTRLAAARWPAEVTGAGSDYGMP
FT                   LGVVQRLANRWSSGYDWRAQEARLNEIPQFTTTIDGQNIHFLHVRSGEPGALPLLLLHG
FT                   WPSSVAEFLGMIGPLTDPRGHGGGSAPAFDIVVPSLPGYGFSGPVTEPGWDSARMARAF
FT                   ATLMERLGYRRWGAVGGDAGALVGRELGILAPAGLVGVHLLQIFAFPSGDPAELAALSE
FT                   ADRASLSGSTADFQSKAGYQKIQQTRPQTLGYGLTDSPIGQLAWNAELWTGWGDYADYL
FT                   DVDTYLTHVSIYWFTRTGVSSARHYYEDAHSGAGYRELPNKVPTAVAVFPEDYRTVRAF
FT                   AERANNVVRYREFDRGGHFAYTTDPDLVVDDLRQFFADLD"
FT   gene            494431..495348
FT                   /locus_tag="FraEuI1c_0399"
FT   CDS_pept        494431..495348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0399"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   fal:FRAAL4911 chitooligosaccharide deacetylase (nodulation
FT                   protein B homolog) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78485"
FT                   /db_xref="GOA:E3J8P2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P2"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP78485.1"
FT                   /translation="MSRLRRGRWVSDLAPVEARERDAGRSRRRLTAWALVGAIGLASAG
FT                   VAEAAGPALATEPPPAAAPAPARAGAPAPTTAPAAAHAPAAVPAQGSAGASGAARQRPA
FT                   YTVHRVLPNAPANAIALTFDDGPDPTWTPQVLALLRQYDVRATFCIVGRQARAYPDLVR
FT                   RIVAEGHAICNHSMTHPLPFSHRSAAAIDAEIGGAQSAITAAAGTAPRLFRAPGGDWSP
FT                   PVFSAEASRGLTPVAWNVDPRDWSRPGTQKIVTSLLAAKPGDILLCHDGDGEHPAGVDR
FT                   SETVQALRTVLPQLKSRGLTFVTL"
FT   gene            complement(495490..495822)
FT                   /locus_tag="FraEuI1c_0400"
FT   CDS_pept        complement(495490..495822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78486"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1677"
FT                   /protein_id="ADP78486.1"
FT                   /translation="MSFDLAIWEGERPADDPAAGRAFDDLVQRYDEEEAEAPPTERIIA
FT                   YVEALSRRWPDEETGPWSVTPEPAGPFLYLCVAWSMADEVAAYAAGLARSMDLICYDPQ
FT                   SERLLT"
FT   gene            complement(496040..496477)
FT                   /locus_tag="FraEuI1c_0401"
FT   CDS_pept        complement(496040..496477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_9061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78487"
FT                   /db_xref="GOA:E3J8P4"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P4"
FT                   /inference="similar to AA sequence:KEGG:SCAB_9061"
FT                   /protein_id="ADP78487.1"
FT                   /translation="MTQPDDYVPSLFPSVRDQVALYEATDGREGGTLEGRPVVILTHRG
FT                   ARSGKLRKTPVMRIELGPGYLVVASYGGAPNHPSWYHNLIANPLVLVRDGDTLRSMVAR
FT                   EAAGPEKAALWETADAAWPHFPEYRASTTREIPLLVLEPPG"
FT   gene            complement(496489..497262)
FT                   /locus_tag="FraEuI1c_0402"
FT   CDS_pept        complement(496489..497262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0402"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sco:SCO6282 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78488"
FT                   /db_xref="GOA:E3J8P5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP78488.1"
FT                   /translation="MGTLAAKTALVTGASRGIGRAVALRLAREGALVAVHYGSNEAAAK
FT                   DTVDTITAAGGRAFALRTHLGHAGDAEALWSAFDDAIRAHTDSPAVDVIVNNAGIALYA
FT                   TVTDVEDKTFDEVFAVNAKAPFFILQHGLDRLREGGRVINISSGAARLATPMLVAYAMT
FT                   KGALNALTRTLALELGPRNITVNSVEPGIVETDIAFFLSDPRMNELAASWSAFNRLGQP
FT                   ADIADVVAFLASPDARWITGQFIDATGGFLLGPKF"
FT   gene            497337..497939
FT                   /locus_tag="FraEuI1c_0403"
FT   CDS_pept        497337..497939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0403"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO5238
FT                   TetR-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78489"
FT                   /db_xref="GOA:E3J8P6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78489.1"
FT                   /translation="MDRSRGGRPREFDRDAALERAVALFWERGYETTSIADLTAGMNIG
FT                   PPSLYAAFGSKRALFDEVVEAYCQQYRAFMVLAFTEEPTFRRGLERLLREAAAAYTQPD
FT                   RPPGCLVVSAAVNCASAEVAEALQGLRNSGVDQLERLAAAAVRAGELPPGLDARALAVF
FT                   TGVVLQGMALRARDGADRRELESTAMIAFEAWPWPAA"
FT   gene            498175..499011
FT                   /locus_tag="FraEuI1c_0404"
FT   CDS_pept        498175..499011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0404"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL0617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78490"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P7"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADP78490.1"
FT                   /translation="MTGWDFTSAASDDSPGGALPDLRTDRPTPARMYDYFLGGKDNFDV
FT                   DREAAAKVDAALGRTVTYDVVWENRRFLQRATRYLAAAGIDQFLDIGTGLPTQGNVHEI
FT                   AKQVVAAPRVVYVDNDPIVAVHGRALLASDHTTTIITADAREPAGILTHPDMTALLDLS
FT                   RPVAVLLVALFHFIQDHENPAGLLAEFMDAVPSGSYLVLSHLTTDGPPAEGVARTEAAY
FT                   QNATSPMTFRPRATIASYFDGLDLVEPGLVRPWQWHPGDDDSPRTDWLYAGVARKP"
FT   gene            complement(499021..500262)
FT                   /locus_tag="FraEuI1c_0405"
FT   CDS_pept        complement(499021..500262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0405"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="KEGG: sro:Sros_5459 RNA polymerase sigma-70 factor,
FT                   ECF subfamily; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78491"
FT                   /db_xref="GOA:E3J8P8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADP78491.1"
FT                   /translation="MTDARIEDLLRELAPQVLGVLTRRYGRFDACEDATQEALLKAARR
FT                   WPTDGIPENPGGWLQTVAYRVLVDELRRDGSRRRREEAAYASTPQSQALAGLHEAGQHD
FT                   DSLELFFLCCHPSLSTPSQIALTLRAVGGLTTTQIAGAFLVPETTMAQRISRAKATIEA
FT                   GGRRLEMPGRAAGERLSTVQHVLYLIFNEGYTATTGADLMVPSLSDEAIRLTRLLRRLL
FT                   PADGETAGLLALMLLTDARRPARTRGDGSLVPLAEQDRSLWTSALIAEGLALISQVLPV
FT                   GKVGPYQLQAAIAAVYVEAPTMDETDWPQILALYDLLERAAPNPMTTLNRAVAVAMVHG
FT                   PAAGLDIVSSLETDGRLARSHRILATRAHLRQRAGDRDAAAADYRQAAALTASIPERRY
FT                   LIGRAVALGTDGDG"
FT   gene            complement(500281..500643)
FT                   /locus_tag="FraEuI1c_0406"
FT   CDS_pept        complement(500281..500643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0406"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: sro:Sros_5460 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78492"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P9"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADP78492.1"
FT                   /translation="MKYLLMIYGNQEKWDSIPAEDWPSEIAKQDAYNKKYAATGELLGG
FT                   YGLADAAAARLVTRKDGLPTVTAGPFLETKEYMATFYLVDVENEERAYELAAEMPWADQ
FT                   NPTEVWPILHESANDA"
FT   gene            500859..501305
FT                   /locus_tag="FraEuI1c_0407"
FT   CDS_pept        500859..501305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78493"
FT                   /db_xref="GOA:E3J8Q0"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q0"
FT                   /inference="similar to AA sequence:KEGG:Gobs_1816"
FT                   /protein_id="ADP78493.1"
FT                   /translation="MSTSSISTRPSAAFLARRPVWQVSYLAGLAASVVVELWGLAARIV
FT                   GVPMRAAGLGSHHATPITVGMFAMGTMVVTFWFTFVVVLMARFAKSPARTYLRTTVPLL
FT                   VLSLVLPITAADTALTTGLTLAAAHLIAAAIIIPTVRRRLSQPR"
FT   gene            complement(501626..502069)
FT                   /locus_tag="FraEuI1c_0408"
FT   CDS_pept        complement(501626..502069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0408"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: sco:SCO5077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78494"
FT                   /db_xref="GOA:E3J8Q1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78494.1"
FT                   /translation="MIFSDAELEYLIDHPLGRLASIGPDGAPQAHPVAFRVNPDSRLVE
FT                   IGGPELPRSQKFRNVTADPRVSFVVDDQSDTPNPIGQTGRGIEIRGRIEITAQDPPLVP
FT                   GFSQRILRLHPHRIISWNIGELRPAAPGRPPHLQGYHSRNIPS"
FT   gene            complement(502270..503739)
FT                   /locus_tag="FraEuI1c_0409"
FT   CDS_pept        complement(502270..503739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0409"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="manually curated; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; KEGG:
FT                   nca:Noca_4567 DEAD/DEAH box helicase domain-containing
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78495"
FT                   /db_xref="GOA:E3J8Q2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q2"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADP78495.1"
FT                   /translation="MSSFTDLGVPARLTSVLTRLAIETPTPIQRATLPDALAGRDVLGR
FT                   GRTGSGKTLAFLLPVVARLSGGPRAQAGAPRALILAPTRELAAQIDTALQPLAAVAGLT
FT                   SCTVFGGVGQNPQVAAIRRGVDIVVACPGRLEDLIKQRHCSLAQVKITVLDEADHMADL
FT                   GFLPAVRRLLGQTPSGGQRMLFSATLDKAIDTLVRQYLNKPAVHEADSAQSPVGTMAHH
FT                   VLHVERDSRLPVLVDLSSAPGRTVVFTRTKHGAKALARHLNRAGVPTVELHGNLSQNAR
FT                   TRNLDDFQTGRAAALVATDIAARGIHVDDVALVIHADPPADHKAYLHRSGRTARAGNSG
FT                   TVITLATTDQLREVSQLARTAGIKPATTRVASADHPILSTLAPGVRSLTSPTVTAEPET
FT                   RTSPAQRRPAAGTRGTEPTPRAGRRRGRRPASGQRGGRATASAGRATASRPAAATARGS
FT                   SADHEAGPSSSERPRSRPTHSAATFSARRGR"
FT   gene            complement(504084..505535)
FT                   /locus_tag="FraEuI1c_0410"
FT   CDS_pept        complement(504084..505535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0410"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: sco:SCO4377 serine-threonine protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78496"
FT                   /db_xref="GOA:E3J8Q3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78496.1"
FT                   /translation="MTNDRLFLPLLDADPRVVSGYELRARIGEGGMGTVFLATSRAGRP
FT                   IALKLIRPEFADHADFRRRFAAEVAIARRVQGAYTVPVVDANPDAARPWVATAYIPAPN
FT                   LSAAVRHAGPLPARTVLGLLAGVAEALESIHQAGVIHRDLKPGNVMVAAEGPLVIDFGL
FT                   ARATEGTSRELSRPGVAVGTPVFMSPEQVENGQVGRASDIFSLGSTAYFAATGDYPFGG
FT                   DGTVFHRIEYGEPDWDQVPWPLPLVLTRCLAKAPAQRASCEEIIDLCRRLSMELAVRLD
FT                   SVTVPTTYRGLLGEGWLPDTIAAEISSYRRAAATTLARRGREPGTHLVEETSTEDLEIP
FT                   APASRTVPAGRVPRVTAGILAAGAVATLLVLVGALLLVLGHRHGLAATGAVSTSLAPTL
FT                   TNLAEAPQATITPQVSASPRLSTTVSHTVPATELSATVTPSLAPAQTTPPASPDRGLLG
FT                   GLLYLLLGGPAPDPPPASATSTPAH"
FT   gene            506204..506279
FT                   /locus_tag="FraEuI1c_R0008"
FT                   /note="tRNA-Thr1"
FT   tRNA            506204..506279
FT                   /locus_tag="FraEuI1c_R0008"
FT                   /product="tRNA-Thr"
FT   gene            complement(506367..506831)
FT                   /locus_tag="FraEuI1c_0411"
FT   CDS_pept        complement(506367..506831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_01940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78497"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q4"
FT                   /inference="similar to AA sequence:KEGG:Svir_01940"
FT                   /protein_id="ADP78497.1"
FT                   /translation="MRREVLVVEGGASILMGQLLWDASQRRDHASAKLHLDRAAQTGCE
FT                   VGKPTIDGLALPRSTIVALYGERRPDAVLPLAARAIKATRGASGILAGLAMLHAAEAQA
FT                   ILHEPRACEQLLVEAAGCLDGADEAFHLISPRDRPRTAGACHLALGWLRK"
FT   gene            507052..507609
FT                   /locus_tag="FraEuI1c_0412"
FT   CDS_pept        507052..507609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0412"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: npu:Npun_F5031 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78498"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5031"
FT                   /protein_id="ADP78498.1"
FT                   /translation="MKPLVRLGIGVSCAVAVAGLPTPARAASAPTSRPPTMVISQQDRT
FT                   WMVDFARGNRFEIYSGGLAARKGVRPDTRAVGRRLVSDHTTALAALKQLALQLRVSLPT
FT                   TLSADQQRELRKLGSLHGIAFDREFLTFEIADHRKVIGATVQVSRTGTNPQVKAFARHN
FT                   LPTLRTHLRLAQDALTELPPVH"
FT   sig_peptide     507052..507132
FT                   /locus_tag="FraEuI1c_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            507697..507927
FT                   /locus_tag="FraEuI1c_0413"
FT   CDS_pept        507697..507927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dan:Dana_GF13196 GF13196 gene product from
FT                   transcript GF13196-RA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78499"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q6"
FT                   /inference="similar to AA sequence:KEGG:Dana_GF13196"
FT                   /protein_id="ADP78499.1"
FT                   /translation="MSNPGEPFGGLGGDAARGFGAHFEQAQKMQAAMIDAQQELTTPQA
FT                   PHLSWARRAASTSAGSSGTRTSEHATNPEGG"
FT   gene            complement(508162..508253)
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0414"
FT   gene            complement(508633..509256)
FT                   /locus_tag="FraEuI1c_0415"
FT   CDS_pept        complement(508633..509256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78500"
FT                   /db_xref="GOA:E3J8Q7"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q7"
FT                   /inference="similar to AA sequence:KEGG:SACE_1315"
FT                   /protein_id="ADP78500.1"
FT                   /translation="MTIEDRLTTLDTLWSVWAEHGLAMADEHWVRPTRLGTWDVRSLYA
FT                   HVGSWPLAFTSLVDRVRDAEPTHATAAALLRDFNTPDGSANRLRDWSAARALEDAAKYT
FT                   TEQMVEQFASAGPRAIATARQLGPVAVDYFGQAILRLDEAVSIGIVEATVHLLDLHRAL
FT                   GQAPNVPADGLAHTTALLAEMAPPVDFIEAATGRSAADLFPVLT"
FT   gene            complement(509513..509638)
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0416"
FT   gene            complement(509897..510112)
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0417"
FT   gene            510581..513046
FT                   /locus_tag="FraEuI1c_0418"
FT   CDS_pept        510581..513046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0418"
FT                   /product="NB-ARC domain protein"
FT                   /note="PFAM: NB-ARC domain protein; Tetratricopeptide TPR_1
FT                   repeat-containing protein; KEGG: fal:FRAAL4996 putative
FT                   ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78501"
FT                   /db_xref="GOA:E3J8Q8"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q8"
FT                   /inference="protein motif:PFAM:PF00931"
FT                   /protein_id="ADP78501.1"
FT                   /translation="MAERLTDEQVETLAHLITDPFAARQLVAAAGIPMADQPWSTHSPR
FT                   MFWTEVSAAFANGAAVDGAQRLLTLARDQFPANIVLAGPPVFAPAGANTSPRPAVWNIP
FT                   PRPARFVGRADLLTALAGHLSVGGDTPGIAAVTGMGGVGKTALAIEYAHRQRLAFDVVW
FT                   WIPAQRAELLDTHLAALGQQLGLPADAKPLTVLAQLRRTAVTWLLVFDDVDDPATVMPY
FT                   RPTDGHGRMLVTSRQRGWRGIGAAIDVPTLTRPESIALLTGHLPDADPPAANHVAELLG
FT                   DLALAVEQAAAFCERTGIPLVDLAHLLVERLDEALALGEVVERPEVTVATLWDLSVRRL
FT                   AAEQPAAVALLELLALCAPDPLPLDLLAEHAEQLSDSRLSHAVRDPLTWARTVGALVSY
FT                   SLATRDDTTIWVHRLVQAATRRQMHDAHQEHLLADLLALLEADLPEDITLTPQSWPRWR
FT                   LLLPHVRAALARASVPADRNWTTAPYPPATRDAICSLSDRTATYLTEHGRPTEALPLYN
FT                   QSLAITETIHGRDNPRAAPILLHLASALRVLGRYREALPLNQRAVTLTETTFGTEDPRT
FT                   GEARNNLAVTLGNLGRFDEALSSYEKALSIAEATYGPDDFRVSIVLGNMAGAFYHLKRT
FT                   DQALPLIRRAAAITESCRGPDHPQVAVALNMLAMTLTHRRHHGEVIELLQRVLAINEAA
FT                   YGPGHPEVAANVNNLALTLRYSGRAAEALPLFDRALAISEATFGPNHPEVARTQHNRAL
FT                   ALADLGQTAEALALVRHALTIAEATYGPEHPYSAEARNNLGIIYIRHRHPWLPRLTRAA
FT                   KRRRGPARS"
FT   gene            complement(513419..513997)
FT                   /locus_tag="FraEuI1c_0419"
FT   CDS_pept        complement(513419..513997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0419"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_2116
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78502"
FT                   /db_xref="GOA:E3J8Q9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78502.1"
FT                   /translation="MARWQPGATQRLVAAAVDLFAEQGYDATTVAQIAERAGVTRSTFF
FT                   RHFSDKRELLVAGQETLSRLLADGIIEAPANASPLDAVAAGLERASGEMGPANRELGPR
FT                   LKAAVAASTELQERDTLKSVGLAAAMTAALIARGVPEPTAHLAGEMGILAFKRGYTRWS
FT                   EGDRDDGTGLAQHALAALDELRTAAASLG"
FT   gene            514083..514964
FT                   /locus_tag="FraEuI1c_0420"
FT   CDS_pept        514083..514964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0420"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="KEGG: kra:Krad_2115 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78503"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R0"
FT                   /inference="similar to AA sequence:KEGG:Krad_2115"
FT                   /protein_id="ADP78503.1"
FT                   /translation="MHVFVTGGTGTIGSAVVAELLRNGHTVLALARSDASARTLKDAGA
FT                   DPLRGEIADLDVLRAGAAQSDGVISLAFSRDYSDPGTLAQAVAQESAALAALGNELTGS
FT                   GRPIVTVSGTPWVPGRASTEADPLPTDGPVGGRGRSVNALLELASRGVRTSAVRMPRTV
FT                   HNKGRGGFAGLLVDQARRTAVAGYPGDGTQRWPAVHALDAAVLFRLALESAPAGTSWHA
FT                   VADEGDAVRDIAAVIGRRLGLPVEAIPEGDFGPFGPIFAMDQPASSARTRDALGWHPTH
FT                   PGLLEDLENIQP"
FT   gene            515395..515844
FT                   /locus_tag="FraEuI1c_0421"
FT   CDS_pept        515395..515844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0421"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: fal:FRAAL3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78504"
FT                   /db_xref="GOA:E3J8R1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78504.1"
FT                   /translation="MTATDDPATIAPGSRVFSDSELSYLAGQRLGRLATVAPDNSPQNS
FT                   PVGFQVRPDGVVEIYGYNLGASRKFRNVAATGVVSLVVDDIASVDPWRVRGVEIRGTAA
FT                   AVTDIEPPQPWLSHEVIRIHPRRVLSWGLDADVEGLQARTIAADA"
FT   gene            516052..517017
FT                   /locus_tag="FraEuI1c_0422"
FT   CDS_pept        516052..517017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0422"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78505"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R2"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADP78505.1"
FT                   /translation="MPTPPNQLADRNPAAAPDAARLEEVRPGVHAWVQPDGSWWVNNAG
FT                   AVGGAEGLLVIDTCATADRTQRFLTALADATGGAPIRLAVNTHQHGDHTYGNSLLPAAT
FT                   VLIGHEEMREGLRTDFIIDGCPAFWAPVPDWGPIERRLPDVAITASTTVYVGERRVDLL
FT                   HPGGPAHTTGDLVAWLPDDRVLFAGDLVFAGLTPLVFMGSVTGALAAVDWLADLEPEVI
FT                   VPGHGPVLVGGEIDRVLNEHRRYYEFVLALAEGGLARGATPLEVAGAVDLGEFAGWADA
FT                   ERLVLNLHRDYADRAGQEIDLVAALCDAVTWLGHPMPTSV"
FT   gene            517031..517972
FT                   /locus_tag="FraEuI1c_0423"
FT   CDS_pept        517031..517972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0423"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   sco:SCO6303 hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78506"
FT                   /db_xref="GOA:E3J8R3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R3"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADP78506.1"
FT                   /translation="MRFVTYVDDDGDRVGVVADGQVHALPSGVTLLDLLRAEDGLREAG
FT                   ERALASPSAVRPYSDVRLRAPLPTPPTVRDFMTFERHLEGVLLLGGATVPERWYEAPAF
FT                   YFTNPYAVRGPHDDVPVPPGCQLFDLELEVAAVVGRTGRDVSPEAGDSYIAGYTIMNDW
FT                   SARDLQFAEMEVRLGPTKGKDTATTLGPMLVTPDELQDWAAGTSYDLAMTVEINGELIG
FT                   EDRLSSMAFTFGDLVAYASRGTEVRPGDVLGSGTCGGGCLAELWGRNGFDAHPPLRPGD
FT                   LVTVSVEQLGALTTRITAGTDPVPIPAARRRG"
FT   gene            518000..518131
FT                   /locus_tag="FraEuI1c_0424"
FT   CDS_pept        518000..518131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78507"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP78507.1"
FT                   /translation="MMGLREHAVVLAVSSVGAVSSVGAAGKREPRRYGAFHPAWVYS"
FT   sig_peptide     518000..518074
FT                   /locus_tag="FraEuI1c_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.610 at
FT                   residue 25"
FT   gene            518174..518407
FT                   /locus_tag="FraEuI1c_0425"
FT   CDS_pept        518174..518407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78508"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R5"
FT                   /inference="similar to AA sequence:KEGG:Srot_2150"
FT                   /protein_id="ADP78508.1"
FT                   /translation="MGDPAVIGRAGHVTVATRGPGGAGEVQVSVRGGVETYLAWSDDPL
FT                   PKGTSVLVIGTRGPRTVDVVPWTDTLALKSDC"
FT   gene            518423..519538
FT                   /locus_tag="FraEuI1c_0426"
FT   CDS_pept        518423..519538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0426"
FT                   /product="band 7 protein"
FT                   /note="KEGG: fal:FRAAL0521 hypothetical protein; PFAM: band
FT                   7 protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78509"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R6"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADP78509.1"
FT                   /translation="MFGYRVPAPDEAMLISGGKHRGESPFRVVTGHGGFVMPFFRKVRF
FT                   LSLSMYEAEVAETCVTHQGIALNVRAVIAFKVAPDPESIVAAGQRFLSDQDQMSVLAGR
FT                   IFAGHLRSIIGSMTVEQIIQERQKLATEVLDGSKEEMARIGLTVDALQIQSIDDGRLGY
FT                   IAAIAAPHNAAIQRQAQIAQAQANQAAAEAEQESQRKQAEYARQTAIVQAQYRAEIDKA
FT                   QAEAAQAGPLATAQVQRDVIAAQTELAQRAADLRQQQLVAEVVRPAEAEAERVRILALA
FT                   EAEKMKIQAEAAASYNRVALDRMLIDQLPEIVKQAASGLAGANVTVLNGAEGISDIASG
FT                   LVGQGMAIFEALRSGIGQPDYDGKASSSELG"
FT   gene            complement(519623..520015)
FT                   /locus_tag="FraEuI1c_0427"
FT   CDS_pept        complement(519623..520015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0427"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rop:ROP_22680 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78510"
FT                   /db_xref="GOA:E3J8R7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADP78510.1"
FT                   /translation="MALTATRIGTISLVCVPTVEQDTAIAFYESLGFEKRTDTPFGGGY
FT                   RWVELYPPVGSTGIALAPPPPGAGEVTPVLTGITLTTDDIDASHAAMKALGVDVDAEVS
FT                   RMGDPVPPMFWFRDPTGHTLMVVEQP"
FT   gene            complement(520165..521079)
FT                   /locus_tag="FraEuI1c_0428"
FT   CDS_pept        complement(520165..521079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0428"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sro:Sros_5789
FT                   alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78511"
FT                   /db_xref="GOA:E3J9U9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9U9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78511.1"
FT                   /translation="MKTREDPTIGRFRGDRQRDRFLAAYDRAFALWPTPWTQTAVETRF
FT                   GTTHVHRYGPPDAEGGVPIVLLHGAGSNAVQWYPFVAALGERRPVVALDTLGDPGRSIA
FT                   RAPIHEPASSAAWLDEALTELGIGSAHLIGHSYGGWLALNQALHSPDRLVTVAALDPGG
FT                   LEKVGARFFWKMYLNGLAGLTAGPLRRRLAVRLDNPVLLVPELRKVLLTGARSFRTRRP
FT                   APRPLQDDELRRIRTPTLVLIGERSPLLHPDRAQARVTLMPNGRAEILPGVGHGPGFDH
FT                   GNDVNARLLAFLDANAPSTAASP"
FT   gene            521107..521793
FT                   /locus_tag="FraEuI1c_0429"
FT   CDS_pept        521107..521793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0429"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sro:Sros_5790
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78512"
FT                   /db_xref="GOA:E3J9V0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78512.1"
FT                   /translation="MPKRVDHDARRRQIADALLRVAASRGLHAVGFREVAAEAGVSVRL
FT                   VQYYFETKEQLFLFGLRRVGEQFGERVAAQLAPPLSQGASAGERAGRPAESARARIERV
FT                   LLATMPLDEDSRPLYVTYTQYFALALTEPGLAAQPYTGDPDILATWLTDQLRGCQGAGL
FT                   LPPTAVLTDEATVLLALTTGLGTALLAGTRSPAEARQALAHHLDRLLGPPVGVSVDGAP
FT                   GRRGYR"
FT   gene            522091..522507
FT                   /locus_tag="FraEuI1c_0430"
FT   CDS_pept        522091..522507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0430"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: fal:FRAAL6416 hypothetical protein; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78513"
FT                   /db_xref="GOA:E3J9V1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP78513.1"
FT                   /translation="MESEQTEEFWIAPDPAAIRDTRRAVLRLCRETNLPADTRETAVLL
FT                   TSETVTNAIVHGGPPARLVIRVSPGVIRVEVTDSTDRLPVVVPARPDATNGRGIGLVDA
FT                   LATRWGVQRHSGGKTVWFEISQASSPSPPPPSTG"
FT   gene            522639..522914
FT                   /locus_tag="FraEuI1c_0431"
FT   CDS_pept        522639..522914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0431"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   fal:FRAAL0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78514"
FT                   /db_xref="GOA:E3J9V2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V2"
FT                   /inference="protein motif:PFAM:PF04226"
FT                   /protein_id="ADP78514.1"
FT                   /translation="MVWTIIFWLLLGLVAGAIARFLVPGRDPMGWVGTIVLGIVGSFLG
FT                   GFLGYLIFGKDLNEGALQPSGIVGSIIGAIIVLLVYRAATHRRVLR"
FT   gene            523146..523502
FT                   /locus_tag="FraEuI1c_0432"
FT   CDS_pept        523146..523502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5538 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78515"
FT                   /db_xref="GOA:E3J9V3"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5538"
FT                   /protein_id="ADP78515.1"
FT                   /translation="MTTVDPVPDPRPPEPVETPPVVQQHVVRSTRTSQVWSAVVLFALV
FT                   LLILLIFILQNGQRVKVSFLGSHGHLPLAVAMLFAAVAGALLVAIPGIVRMVQLRRVAR
FT                   RHRGADGPAAGENA"
FT   gene            523514..524017
FT                   /locus_tag="FraEuI1c_0433"
FT   CDS_pept        523514..524017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_45610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78516"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V4"
FT                   /inference="similar to AA sequence:KEGG:ROP_45610"
FT                   /protein_id="ADP78516.1"
FT                   /translation="MADIVDLVYADHDWLRRQFFYLDYATGNAELTAVWEALATRLDTH
FT                   ADAEETVFYPTLLKKGDSGDPEEETEDAIDDHNKIRAAVTDARSHRVGTKVWFEAVGAA
FT                   RTENGKHLDEEEREAIPDFIKSTSPELRHQLAMRWLQFYADHRDGAGVNTKSKDAAEYI
FT                   EANS"
FT   gene            complement(524027..526348)
FT                   /locus_tag="FraEuI1c_0434"
FT   CDS_pept        complement(524027..526348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0434"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="KEGG: fal:FRAAL1244 WD-40 repeat-containing
FT                   serine/threonin protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; WD40 repeat,
FT                   subgroup; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; WD-40
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78517"
FT                   /db_xref="GOA:E3J9V5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78517.1"
FT                   /translation="MRGAPLRQGGDVSEVPAGVEPLDDFDPHQLGPYTLLGRLGHGGMG
FT                   TVYLGRRAAAETGAADPATGGNSVTEPATAGPLLAIKVIRPELATVAEFRERFAREARA
FT                   AQSVHNAYTAAVLDVNITGSRPYLVTEYVDGPTLSDRIRRNGPLPAAQLEWLAGAVADA
FT                   LRAIHAAGVIHRDLKPGNILLSPFGARVIDFGIARALDTTTMATQSAIGTPAFMAPEQV
FT                   LNEGVTSAVDIHAWGAVLVFAATGNAPFAGDTIPKVMRQVLEVTPDLTSLPGTLRPLAA
FT                   RALAKDPAARPTAAELGDAVRQIHTPPPTPTSEMSTYSPDRTATRAQPPVTGPPPTPRP
FT                   ASATASPPAPRPATHDGPRGDTGSSTGMSEAGTHLADPGPGRQAVPANVTDQDPGPWPR
FT                   PRRQRRRAVLAAGLAVVVVLAGAVTAFALQGSGGDGGGEPATSVSGTPSSSGNFRALGD
FT                   RLTDAKDQVWGVATTPDGSTLAAASQNGTVTLWDISRPAKPRALPSLSTGDTTGMMAAA
FT                   FAPGGRTLASGSRNGTVQLWDVSNPGAARRLGAPIVAAGGGPAWSVGFAPVGNLLASGD
FT                   GNGTVRVWNVSSPQAPVMAGQPFHFDGGQVWSVAFSPDGSILATAGQDGSVGLWDVSNP
FT                   QAQPQPLGTLPVQSGNGVKAVESLAFTPDGHTLITGSIDHAVRLWDITVPSVPRLLAAP
FT                   SQPNQVWAVALTLDGRVLATAGADRTIRFWDISDPTAPRPVGTPLTGHTDTITKLAFTP
FT                   DGHTLVSGSRDKTVRLWTSG"
FT   gene            526538..527125
FT                   /locus_tag="FraEuI1c_0435"
FT   CDS_pept        526538..527125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0435"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: cai:Caci_0030 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78518"
FT                   /db_xref="GOA:E3J9V6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V6"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADP78518.1"
FT                   /translation="MDIEDDAFDDYFVARLPGLLRFAYLLTGDFGEAEDLTQTALARTF
FT                   RVWKRVRSHDRPDAYVRRVMVNANARRFRRRRPHQVLVAHPPDRPGRSPELGAVEDRAG
FT                   LVQALASLPQRQRAVVILRYCDDLAETEVAALLGCSVGTVKSQASKGLAKLRTHPALSD
FT                   LGPSSRALAAASGSTAPRLTDPRVTAIRREAQ"
FT   gene            527122..528321
FT                   /locus_tag="FraEuI1c_0436"
FT   CDS_pept        527122..528321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_1493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78519"
FT                   /db_xref="GOA:E3J9V7"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V7"
FT                   /inference="similar to AA sequence:KEGG:Rcas_1493"
FT                   /protein_id="ADP78519.1"
FT                   /translation="MNDSPRSRETRQTLEAPTREDVADWLRTAADQVRVRPTATTWAGT
FT                   KTRIARERRSRTIRRAGLVATVAAAVIAVAVLGVGPLDLRHRTTPAGGAESAVAAAAKP
FT                   PPPVPIEVPGAAGQAPIKIHLVDAPRPVPLTEGQKATLVRRCQIPGESPGITYRAFGAF
FT                   QDKQGFVAVLASETQFLVCTIPTDANGAPAFDRATADEEQTAFAYEQYLLPSTAPLTTF
FT                   YYRGGDWAHARYGAGRAAPDVAMVLAVFPTGESVVVPILDGGVFLARFKVEGANFPAWD
FT                   QHLTFYAFDSTGQFLSRLDAWADPPGGGSDLTPQRQSAMEQACLQSASQAPNGPKDLEA
FT                   KAALHPASLPLPAGAPGREGWIQVYVGPVTVTCTGPADASGYSVPATLKFRAFKTGLTG
FT                   "
FT   gene            528621..529211
FT                   /locus_tag="FraEuI1c_0437"
FT   CDS_pept        528621..529211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0437"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: xfn:XfasM23_1067 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78520"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V8"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADP78520.1"
FT                   /translation="MDDDPYVWPGTDCLQNLLGIRDREEFHKAEHEVVRARRLQLDTAF
FT                   LPGNYDTDHLRGFHRYLFQDVYDWAGQFRQGDISKDGQPFTPGGQLIERLDALFERVAA
FT                   RKLLVGMDWEPFVGGFALVYGDLNAIHPFREGNGRTQRAFLRQLAAHAGWTVDWSSLGR
FT                   FANARACERYMKTGKPHHLVRVLAPIIVARNKR"
FT   gene            complement(529338..530786)
FT                   /locus_tag="FraEuI1c_0438"
FT   CDS_pept        complement(529338..530786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0438"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: fal:FRAAL2091 putative transmembrane efflux
FT                   protein; TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78521"
FT                   /db_xref="GOA:E3J9V9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADP78521.1"
FT                   /translation="MTTPRTRTVWTFVITSLAAFMVSLDNLVVTFALPQIRADLGSGLE
FT                   GLEWTVNAYTLPFAVLLLIGAALGDRLGRRRIFTLGLTVFTAGSAAAALAPSIGVLIAA
FT                   RAVQGAGAALVLPLTLTILSAAVPANRRGAALGVWGAVSGLAVALGPLIGGAITDGAAW
FT                   QWIFWLNVPIGVVAIPLALRRLDETRGPSTRLDLPGVLVGAAGLFGVTLGLVRGEGHGW
FT                   TSTPVLASLILGGVAVAAFVAWERRLEARGGQPMLPMSLFRNRGFAAVNVATILFSVGM
FT                   FGAIFLLAQALQNVFGYSPLEAGLRTLPWTAMPLLIAPLAGPLSDRIGGRPLLVTGLLL
FT                   QAAGLAWIAATMSTGMSYSQMVPAFTLAGLGMSLFIVPIATVALGSVRPDQQGLASGTN
FT                   NAVREFGGVLGIAVLSSVFASRGGYGDPEHFINGITPALWVGVAALVAGALAGLVLPGR
FT                   PTSAATPATADATTTRPILEPAAI"
FT   gene            complement(531147..532415)
FT                   /locus_tag="FraEuI1c_0439"
FT   CDS_pept        complement(531147..532415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78522"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0787"
FT                   /protein_id="ADP78522.1"
FT                   /translation="MPDIPASAAPWPYHSQLPGRVVGEPAGRPIASSDAPAAHTRSDRR
FT                   KDLRSAANPSFRKPSGLSPDGVWVSLSGARPKGPRPDLKDGPQKVLLTRLNELNNPYRV
FT                   SYEMVSRQLWSDQAPTKIQRSRTRDLSRQLRGEKAIEWRVVEIYVDLLFPATDPLRASE
FT                   LIVLRDLHTQAFGTTVDPDGAPSPEPEAAPIDPAYVAELERQLEEARTRASFATALLVI
FT                   VQAENTTLRGRNSSFDWFHQPARAGSGRSAAEGGSRSRSGRRAATDQHASSSTNGRTTT
FT                   GRAGGTRSGAPNAAGTPSAPAASSTPRTGRREPGPNAEGEVFRSADPVTTPIVRRQGYR
FT                   AGQRRRPATTRATLADAFPTGPRAVVHPTTAPPAPASTLATPARGRSTSNSLHRAPTPD
FT                   PPADESGLDVLVSREKRRRGKNT"
FT   gene            complement(532966..533868)
FT                   /locus_tag="FraEuI1c_0440"
FT   CDS_pept        complement(532966..533868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0440"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ara:Arad_2644
FT                   epoxide hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78523"
FT                   /db_xref="GOA:E3J9W1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78523.1"
FT                   /translation="MASGAERIQVRAGVLDVTLERSGSRDGRPVVLLHGFPYDARCYDE
FT                   VARLLAAEGADVVVPYLRGYGETRFTQASTPRSGQQAALAHDLLALIDVLGLESPLVAG
FT                   YDWGGRAACVVSALWPRRVGGLVTATGYNIQDIAASSTPRRPELERRLWYQYYLHGERG
FT                   VRGLAAYRSEFARQLWREWSPTWGFSETAFAASARSFDNPDFVDVVVHSYRHRYGLVAG
FT                   DPAYEPTEAALALQPPITVPTVVLDGEHDTVQPPKPRAAYEPHFPALVAHRVLNAGHNA
FT                   PQEAPADFARAITDLWAAL"
FT   gene            complement(533929..534882)
FT                   /locus_tag="FraEuI1c_0441"
FT   CDS_pept        complement(533929..534882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: fal:FRAAL3189 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78524"
FT                   /db_xref="GOA:E3J9W2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADP78524.1"
FT                   /translation="MESRFELRYLAAFLAIAEELHFGRAAARLHMGQPSLSQQLQRLER
FT                   SVGVELVQRAPHQVKLTPAGRVFELEARRLLDQADRAVRVTREAASGRTGSISIGFNFP
FT                   AGQRILEPTLRRLNADYPRISTQLWEARSGPQLTALADGKLDVALAFAGPLAAALRSRR
FT                   LLTVPLVAVVGGRHPWVNRGQVAFRELAEQRCVLFRRHESPAMHDAILAAADLSGIRLT
FT                   IADEVDDSGATGLVVTTRDLVGFASTARGAALPTPGMAAVRLVDPVPTVGVYAVWRPDP
FT                   QPVVGAFLRSLDGAGPFSEQAQAAAPGSASPGMRPV"
FT   gene            complement(534980..535945)
FT                   /locus_tag="FraEuI1c_0442"
FT   CDS_pept        complement(534980..535945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0442"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   mpa:MAP3817c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78525"
FT                   /db_xref="GOA:E3J9W3"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W3"
FT                   /inference="protein motif:PFAM:PF04240"
FT                   /protein_id="ADP78525.1"
FT                   /translation="MAIEAQGGPAAVGTNESAAPEVVKGPTRGGPRVTAAWVLALVALV
FT                   AAVAGAVGGTGPVGDAALGLLTGVALLFSIVHGSLSVGWRGIGTFFVISYAVGFVLEAT
FT                   SVAYGFPFGFYVHNTGGPRLLDIPLVVPSAYFGYGWIAWVLACVIGRGTPARSVGFERF
FT                   TTPLVATLILTGWDFAFDAVFATVDSRYRYTHPGGYFGVPVSNFLGWLLTGWIITQVFA
FT                   LVEQKAATRTPPAARAHWALPSVVWAAPILPLLGCFLSPPAGKVTVGGRTFVSADIYGS
FT                   AFVVSLLTLGLVAALALIRALAPTGTAPDATRDAQLRALP"
FT   gene            536242..536697
FT                   /locus_tag="FraEuI1c_0443"
FT   CDS_pept        536242..536697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0443"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="KEGG: nml:Namu_3976 ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78526"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W4"
FT                   /inference="similar to AA sequence:KEGG:Namu_3976"
FT                   /protein_id="ADP78526.1"
FT                   /translation="MVTGTQERHIARQRAAVTRSFTVGGAQGYLLTSRCSDGTPADLRL
FT                   IMGRPGTTLHGLLDTVAVAISTGLQTGIPLATFVRRFADTRFEPAGLTDDPEIPEVTSV
FT                   VDYVVRRLALDYLTLEDRVPLDVLTPLERAATRPRHAGPVGWRAGRS"
FT   gene            complement(536878..537108)
FT                   /locus_tag="FraEuI1c_0444"
FT   CDS_pept        complement(536878..537108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78527"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6742"
FT                   /protein_id="ADP78527.1"
FT                   /translation="MSNQDPDLDFRNPDALAEAKEGRRRDESVTGADGGPIDEEAMRAA
FT                   DGLTTTAAQDAAYREHLERGAHQKGEGAPNV"
FT   gene            537266..538792
FT                   /locus_tag="FraEuI1c_0445"
FT   CDS_pept        537266..538792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0445"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: chu:CHU_3446 phytoene
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78528"
FT                   /db_xref="GOA:E3J9W6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W6"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADP78528.1"
FT                   /translation="MFRTDVQNERPGTGPFDVAVIGGGPAGMATALRLQAAGVSTVVLE
FT                   AHGHVGGCAGYYRRRGFSFDVGATTLVDFAPGGVGAELIESVGLGPLDAQELPGYVAHL
FT                   PDRQVVLHRDQALWHAERLRALGDSDRHRRFWALLDRLARTFWRASRAGVRLPVRGPAD
FT                   ALHDLRAVGPAGVPLARYMTWTLGDALRRHRLRDDAALVGLLAMLVEDTVHASVDDAPL
FT                   INAALGVTIRGAGLSRHAGGMSGFWRALVAHYRRLGGQLRAGSPVSRVDGETGAYRLAT
FT                   RRGPVHARRIVAAVPAAATAAICAGLPVAGRLRPYLDRDADALGGACVMFLGVPDGEVA
FT                   GQELTHHQFLRSYDQPLGDGNNMFLSVSAAGDTLSAPPGHRAVMISTHTDLAGWAGLGP
FT                   AEYEQRKKWIGEVLVACARRAYPALGERAVIAETGTPRSYERFGFRPGGAVGGVRQRLG
FT                   NSNQHAIPHDLGGRGLWLVGDSTWPGLGTVACVLGSRIVADGMLRERGFA"
FT   gene            538861..539475
FT                   /locus_tag="FraEuI1c_0446"
FT   CDS_pept        538861..539475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0446"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scb:SCAB_7561
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78529"
FT                   /db_xref="GOA:E3J9W7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78529.1"
FT                   /translation="MRSVADTRGRVLDATLACLVRHGYGGTTARAIGQVGGFAPGVIYY
FT                   HFTDLDDVLVAALTTTCEGRVQRYREALAGIDRAGPAVEALRALYLEDTEVGHIAAVQE
FT                   IYAGARPGSRLAAQLALETRRWEEVAVELLTTLLTGKPFATVIRMPVLANAAVAFYLGA
FT                   ETLAHLDDDSTRMTEFFDQAARLAVYFDRIPRLRKRGQQAL"
FT   gene            complement(539550..540818)
FT                   /locus_tag="FraEuI1c_0447"
FT   CDS_pept        complement(539550..540818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78530"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5613"
FT                   /protein_id="ADP78530.1"
FT                   /translation="MELPRPSTARRVAALALSVSSLAVALTACGQGDGTASGSVSCSTS
FT                   APGVTKTEIKAGLLWGDSGSGASSMRAFRAGVDARLDLENDRGGVNGRKITYAWRDDAS
FT                   DQNINLLGARQLVDEEKVFGIIEAPGATTGSVAWLGQRNVPVTGLASDPGWVGLANMFS
FT                   FYYLGNGSSTVYGDVIRAQGGTRAALITTGSKSELDFSRQYSASLAAAHVQIVKEFPVS
FT                   ESTGYQNMAQQLKQNNIDTLAGVLLPDAAVNILPAARALGVQLKVVIMPLGYDPKLLQT
FT                   EGPALAGTLISTETRPWQLNTPEQKTFLDAMNQYSPEIQPPNQDSGADGYVSADLFVRG
FT                   LKAAGPCPTRESFIAGLRAVRDYDGAGLVPGNIDLSQNYKQPRPCYYFVQVSKDGKQFV
FT                   PLFDGQPQCGSPISAQQMDQLLS"
FT   sig_peptide     complement(540726..540818)
FT                   /locus_tag="FraEuI1c_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.661 at
FT                   residue 31"
FT   gene            541261..542529
FT                   /locus_tag="FraEuI1c_0448"
FT   CDS_pept        541261..542529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:T28H11.1 Sperm-Specific family, class Q"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78531"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W9"
FT                   /inference="similar to AA sequence:KEGG:T28H11.1"
FT                   /protein_id="ADP78531.1"
FT                   /translation="MTFYPRNAALRVGTLLGGPVLAAAVLTASPATAAPASPQAIPPIL
FT                   LAGDQSQTGAVDISPTGVVVGTTQAPPPANIPGGTSPSTPLRWLPTPTGYVKQTLSLPA
FT                   GATSATVTGVTDLGEAGGTLTTAAGQQPVRWSVSGLQTTALGPPGSSTTTAVGPGHWAV
FT                   ETGDTISGTATLFARDGSTTALAGTPELAGARIVTAVSIGGPGTVLLGAISGVGMGTTG
FT                   RAVVWRSGSTVSLPVISAFSIGSACLSAIQPDGSVAYSGVVINPAPAQVIGVHRGGVPG
FT                   TEVALPTGGRTATLGCSPAGGPVDALASDGSVVGQLLAAPGQPAEAALWRDGALVPLGV
FT                   AAGETATTAAAVASGGRVILVATTTAGVQQPYLWTNGVRVPLTLPAGWTLRTIVKFTDA
FT                   GAVLGAVQNAAGDIRPVVWRTRG"
FT   sig_peptide     541261..541362
FT                   /locus_tag="FraEuI1c_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 34"
FT   gene            complement(542577..543659)
FT                   /locus_tag="FraEuI1c_0449"
FT   CDS_pept        complement(542577..543659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0449"
FT                   /product="ribonuclease BN"
FT                   /note="KEGG: sco:SCO0686 hypothetical protein; TIGRFAM:
FT                   ribonuclease BN; PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78532"
FT                   /db_xref="GOA:E3J9X0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X0"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADP78532.1"
FT                   /translation="MALIRRRRGQPTELAVGTGPDAAVQEAEPDRLAELRPGSWWAVLR
FT                   RTVAEFNEDALSDRAAALTYYSILAIFPALLVLVSLLGVIGQSATTTVLDNLQNLTPAS
FT                   ARDVVSGAVDGVRGSAGTGSVLAIVGLAGALWSASGYVAAFIRAANAVYDIPEGRPAWK
FT                   IAPLRIGLTVALMVLAALSAVIVVFSGKVARQAGSALGIGQTAVDVWSYAKWPVLVVFV
FT                   ILMIAILYWAAPNVRHQGFRWLTPGTVLALAIWMVASAAFAFYVSNFGSYNKTYGAVAG
FT                   VIIFLVWLWLTNLAILLGLEFDAELARQRAIVGGYPAKTEPYARPRDTRRFPRRPLRKK
FT                   PKPTAPDAPTETTHAEAPTG"
FT   gene            complement(543780..545219)
FT                   /locus_tag="FraEuI1c_0450"
FT   CDS_pept        complement(543780..545219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0450"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: fal:FRAAL4295 putative FAD-dependent
FT                   dehydrogenase; putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78533"
FT                   /db_xref="GOA:E3J9X1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP78533.1"
FT                   /translation="MKNSVALARTARMIEALRQRGADQAQDVTARPEDGSAGGAPPRDT
FT                   RRPRVVVVGGGFAGLGVLRHLEARLPADAADLELVSPTDHLLYTSLLPQVCAGEVEPRH
FT                   LAIPLRASLRRTTLRTGHAVDVDTAARTITVVDGNGSFRLGWDRLVLAPGSLTRTFDIP
FT                   GLAQYGLGLKNLAEAVYLRDHVLRQLEYASTCPDPAERRARGTFVVCGAGYTGTELAAQ
FT                   MRRFTLDALRYFPRLAADDVRWILLDRAPRVLPELDETLGAGALKVLRDRGVEVWPQTS
FT                   VTRVTADSVTLSNGETVPAHTLVWCTGVTPNPLMEKVGTETSKGRLVVDERLNVPGAAG
FT                   VFALGDAAAVPDVTRGGAPAGQTAQHAVRQGAAAGRNIAASLGYGKASPYRHRDLGFVV
FT                   DLGAGDAVANPLGLHLSGAPAALVTRTYHLLALGTGTNRAHVACDWLLAAAFPEQVVQL
FT                   GFLPPPHATIAEIEDTRLYPN"
FT   gene            545624..545785
FT                   /locus_tag="FraEuI1c_0451"
FT   CDS_pept        545624..545785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_6930 PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78534"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X2"
FT                   /inference="similar to AA sequence:KEGG:Amir_6930"
FT                   /protein_id="ADP78534.1"
FT                   /translation="MRFVSEWWPARLVASPAGPDPGRKGRNSADFGSTSVPGLAFVSEA
FT                   TVPQRRTR"
FT   gene            545782..546666
FT                   /locus_tag="FraEuI1c_0452"
FT   CDS_pept        545782..546666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78535"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6489"
FT                   /protein_id="ADP78535.1"
FT                   /translation="MTMSDRSGRNLIASSARTRWKRRLTGLALLVAGAAAVIPAQGALA
FT                   AGNGPQPPSTRVDAAIKAAYLQAFTGGQNQAHNLAAVEDGPALASTLALAEQNFPAATS
FT                   PSQVTVSGIKIKGPAKAALRFDVVYQGGYDIGQRDGTAVVVDRQWKVSRDTFCSVLSLA
FT                   GAVCPPKAGRPPRDPAAARLAIQQAYTRAFTGGEDPAYSLGAVEDGPALAGTLAQAMQN
FT                   FPGATSTAAVTTGDIVFTSPRSAALPFHITYQQGADFGVQNGTAVIVGGQWKVSRQTYC
FT                   TVMGWAGATCPAP"
FT   sig_peptide     545782..545919
FT                   /locus_tag="FraEuI1c_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 46"
FT   gene            complement(546825..549938)
FT                   /locus_tag="FraEuI1c_0453"
FT   CDS_pept        complement(546825..549938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0453"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="KEGG: nca:Noca_2322
FT                   endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; Carbohydrate-binding
FT                   family V/XII; SMART: Carbohydrate-binding family V/XII"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78536"
FT                   /db_xref="GOA:E3J9X4"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADP78536.1"
FT                   /translation="MPRVPRRRIAAAVLSAGIGSVSLAAPALANPGATGLVISEAYLNG
FT                   GSSGASYLNKFVELFNPTASPVALTGDTLQYRAPTSTVTPSGAQVFALSGTVAAHGHFL
FT                   IQLPSNNATTNPGAPLPTPDLSTGGSINPGAGGGTLFLAASTAGVLPTDASVLDKIGWG
FT                   TSNSPEGTAPTGNSVVLSYQRDAAGTDTDNNAADFSVAAPTPQNAASDGGATGGGTVTV
FT                   ASPGTLNATVGTAIAPVTLAASGGTAPYTWTATGLPAGLAISTAGVLSGTPTAAGTASV
FT                   TATATDSTAATGSVSFTVQVVDAAPTVTPIAAIQGTNTDTSPLAGQTVTTEGVVTAAYP
FT                   TGGFNGFFLETGGAGGTAAQDATPGTSDAVFVFGSVSAGQVTVGESVRVTGKVSEFQGE
FT                   TEIGSPTVTQLDTPLPAVVPDQLAWSDLSTDAQKEAHEGELIAPQGDFTVSDNYDANWY
FT                   GSFTLAAGDTPLRQPTDVGTAGSPAAQSAAADNAARMITLDDGSSVNYSTGANANTPLP
FT                   WLTPTNPVSVGAKVTFHKPLVLDYRFSLWNLQPTAQVTDDGAAVATFSDTRTGNAQPAN
FT                   VGGGARLATFNVENYFSMTGEQYVSMGLGTCTYYTDRQGNRIGVNTCTGTDGSPGPRGA
FT                   ANDASFARQQSKIVTGINRLGASIVSLEEVENSSKFGEPRDTTLAGLVGALNAAAGSNV
FT                   WEFVPSPPDDQLPPLAQQDVIRTAFIYKPAAVSLVGAAKVLTGDSADGQPFSIAREPLA
FT                   QGFKKAGATDKDAFLVVANHLKSKGADATGLYPGDAEDTSSPAVDQGAFNATRVHQVTD
FT                   LSAFATQTAAGLGTNRIFLLGDFNAYTGEDPMQVLYGAGYVDLGSTLDPAEQTYSYNSL
FT                   EGSLDHVLANPAALSMVTGADVWQINAQEAVAFAYSRYNYNATQLFNGTDPFAASDHDP
FT                   VVVGLTLPATPLPAAWSASKVYNAPDTVTYNGSTWQAMWWTQNQTPGDPNGPWEQIATA
FT                   PDGIALWTASRVFNTGDVAEYQGKKYVAQWWTRNQAPGDPNGPWKLSS"
FT   sig_peptide     complement(549849..549938)
FT                   /locus_tag="FraEuI1c_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.628 at
FT                   residue 30"
FT   gene            550394..551371
FT                   /locus_tag="FraEuI1c_0454"
FT   CDS_pept        550394..551371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0454"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_3994 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78537"
FT                   /db_xref="GOA:E3J9X5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78537.1"
FT                   /translation="MTESRVPEVSIGIPVYNGADFLGAAIESHLAQTFGDFELVISDNA
FT                   STDGTQDLCRAYAKEDSRIRYVRQAANIGANANYNEVARISRAPFFRWAADDDVLLPEY
FT                   LEQTYRLLSNDDDAVLCHSFAAHIDENGKPLAPAADGVGFVDDKGTYVDGPDPNVATRK
FT                   MRSPYPHVRFRDVLLHTKWCFEIFGLIRRDVLLATPLHQKFYGTDRVLLAELALRGTWR
FT                   VVEEPLWQRRSHSGASNNMSVWQKAQWSNPDAKKSVLPPVTNMIRGYADAVHRQRFPII
FT                   EREQCYAAIGVLAVQPDKFRKLLVPGPHNYFGIGNKKSDASHRL"
FT   gene            complement(551428..552060)
FT                   /locus_tag="FraEuI1c_0455"
FT   CDS_pept        complement(551428..552060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0455"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rpf:Rpic12D_3499 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78538"
FT                   /db_xref="GOA:E3J9X6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78538.1"
FT                   /translation="MPTEEPSRPYHHGHLREALVEAGVGLARTGGPEAVVLRSATRAAG
FT                   VSHNAAYRHFDDRDELLRAVCERCMSQLAQLMEARIDAVPLEGDPVADAWLRLGALGSA
FT                   YVEFATSEPGWFRTAFAVPRTTHMFQPGEGVGNCGLGPYEMLGAGLDELVRVGAIPAER
FT                   RPGAEYVAWSAVHGLSSLIIDGPLRELPDDERARALDTVLEAVVRGL"
FT   gene            552133..553689
FT                   /locus_tag="FraEuI1c_0456"
FT   CDS_pept        552133..553689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0456"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: nfa:nfa14430 putative transporter; TIGRFAM:
FT                   drug resistance transporter, EmrB/QacA subfamily; PFAM:
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78539"
FT                   /db_xref="GOA:E3J9X7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X7"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADP78539.1"
FT                   /translation="MPSMSPRRRLAVLVTVCLAVFAINLDTTIVNVALPDLARQLGATT
FT                   RDLQWIVDGYNLAFAALVLTAGSIGDRFGRRPVLLGGLVGFALMSGIGALCDGAGALVA
FT                   VRFVMGAFAALIFPTTLSIITNAYPDRAERAKAIGVWGAVTGLGVAIGPVTGGLLLAHF
FT                   WWGSVFVALVPVALVAAVLAFVLVPESSDPAAARLDLPGLVTSSAAIGLLVYTIIEAPD
FT                   RGWTSALTLGGFAVTAAVAAAFVMLERRHPAPMLDVSLFRTPAFSAASGAVTVAFFALF
FT                   GFIFLITQYFQFIRGFGTVSTGVRILPVALTIALGSVTGTLLAGRLGTRTIVVTGLVLF
FT                   GGSFAWIAVSSTYQPYLQIAAQMVLMGTGLGLTTAPATESILSVLPAAKAGVGSAVNDA
FT                   TREAGGTLGVAVIGSVFTSIYTHHLAGTAVAALPAQAANAARDSVGAAFQVASQAGPAL
FT                   RDQLVSDVNASFMSGLHIACFVAAGVCWLGALGALALPGRRGMHAPQAEPAVAPEAAAA
FT                   V"
FT   gene            complement(553719..554171)
FT                   /locus_tag="FraEuI1c_0457"
FT   CDS_pept        complement(553719..554171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0457"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: fal:FRAAL0653 transcriptional regulatory
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78540"
FT                   /db_xref="GOA:E3J9X8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78540.1"
FT                   /translation="MTNPLPEPVVPIEVLLVEDDPGDVLMTREAFADYKVKNNLHVVSD
FT                   GVEALSFLRGEGEFADSPRPDLILLDLNLPLKDGRQVLAEVKSDDKLRRIPVVVLTTSE
FT                   AEEDVLRSYDLHANAYITKPVDFERFVDVVRHIDDFFVSVVRLPGH"
FT   gene            complement(554168..555841)
FT                   /locus_tag="FraEuI1c_0458"
FT   CDS_pept        complement(554168..555841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0458"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: fal:FRAAL0652 putative two-component sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; CHASE3 domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78541"
FT                   /db_xref="GOA:E3J9X9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP78541.1"
FT                   /translation="MTDQATVSPPTREDVAPPGPGRRGRLGAITRSWPLRRRLAAALTV
FT                   TSVILLTGVGLTTASLVQLERAIHERTDIVSPARTQAATLMTSLVDQETGLRGYLLDGK
FT                   ADALQPYDDGGKAQTAALTRLDQLVGGRPGLSDDLGALRTTVADWHREYADPVAAAARR
FT                   GDLTAARAIDPENFGKPSFDAVRAADDRLDTSLTTRALAARSRVTSTLHQLIAVLIVIG
FT                   LAFAALMGGIGRSLRLWVTGPLERISQDASTVAGGDLAHTVARAGPPDLAALADSVENM
FT                   RLQLVHELGTVWEAAAKLEEQADALRRSNRDLEQFAYVASHDLQEPLRKVASFCQLLER
FT                   RYGDQLDERGQQYIDFAVDGAKRMQKLINDLLAFSRVGRTTDEFVPVDLGDVLARARQA
FT                   LATAIEASEAEITADPLPTVAGDPTLLAAVFQNLIGNAIKFRGTETPRIHIGVVAQSVG
FT                   AQSGTWELSCSDNGIGIEADYAEKIFVIFQRLHRRESYDGTGIGLALVRKIIEFHGGTI
FT                   WLDTAVESGTTFRWTLPNNAPTLPAIADTARQVAVHEGAT"
FT   gene            complement(555838..557034)
FT                   /locus_tag="FraEuI1c_0459"
FT   CDS_pept        complement(555838..557034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0459"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="KEGG: fal:FRAAL0651 putative sensory transduction
FT                   histidine kinase; PFAM: Stage II sporulation protein E;
FT                   response regulator receiver; SMART: protein phosphatase 2C
FT                   domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78542"
FT                   /db_xref="GOA:E3J9Y0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y0"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP78542.1"
FT                   /translation="MQSVAELPAPAAAEPSQTAWPVLLVEDDDGDAFLVEELLQETAAP
FT                   VRLLRATTIAEARTKAAGARCILLDLGLPDSHGLSALETLRRIAPDAAIVVLTGLADEH
FT                   RGIEAMAAGAQDYLVKGEADGKTLVRALRYAIERRAAEQAARDLHESQLRAEENSRLER
FT                   GLLPTPLLRDTRLRPTTRYRPGRRQALLGGDFYDIVETPDHVVHVLLGDVCGHGPDEAA
FT                   LGASLRIAWRTLVLSGIPEPDRLTYLQDVLASERTNEELFATVCTLAIAPDRTTLTMRL
FT                   AGHPPPALIHPHLTALPDTEVGPALGVLDDLLPSERITVPLPPGWELLLATDGLLEGRD
FT                   GPTGERLGWNGVLTEIATINPPPGDDNLPDVLIDRIERRNGGPLTDDVALLLLRGPTP"
FT   gene            557369..557878
FT                   /locus_tag="FraEuI1c_0460"
FT   CDS_pept        557369..557878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0460"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: tcu:Tcur_0029 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78543"
FT                   /db_xref="GOA:E3J9Y1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78543.1"
FT                   /translation="MTTPTTRLDRPYSAPSAVAVSWEQAEAVLRDAELSWISTVRPDGG
FT                   PHVTPLVAVWLDGALYFHTGAQEQKYANLRANPRVVLTTGAATWDHGIDVVVEGEAVPA
FT                   TDEAILTRLAAAFATKWDGRWRLSARDGHLVNADMGGVSEAFEVRPTRAYAHTKGEPFS
FT                   QTTYTF"
FT   gene            557983..559602
FT                   /locus_tag="FraEuI1c_0461"
FT   CDS_pept        557983..559602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0461"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sgr:SGR_2803 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78544"
FT                   /db_xref="GOA:E3J9Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78544.1"
FT                   /translation="MGHLEVAHVEYYLPDGRVLFSDTSFRVGEGAKTALVGANGAGKTT
FT                   LLRLLAGELKPHGGTVVVSGGLGVMQQFVGSVRDERTVRDLLVSVAEPRVREVAGQVDA
FT                   AELAMMERDDEAAQLQYAQALSDWAEVGGYDAETVWDTCTMAALGTPYERAQWREVRTL
FT                   SGGEQKRLVLEALLRGPDGVLLLDEPDNYLDVPGKRWLEEQLKATRKTVLFVSHDRELL
FT                   SRAAEKIVSVEPSPAGSDVWVHGGSFETYHEARQQRFERFEELGRRWDEKHAQLKRLVA
FT                   DLQQYAARSPDMASRYQAAKTRLRKFEEIGPPPEPPRRQDIRMRLRGGRTGVRALTCAG
FT                   LELTGLMRPFDLEVFYGERVAVLGSNGSGKSHLLRLLAGQPVAHTGQWKLGARVVPGHF
FT                   AQTHAHPELAGHSLVDILWKDHAKNRGGAMSMLRRYELEPQGDLPFEKLSGGQQARFQI
FT                   LLLELAGSTALLLDEPTDNLDLESAEALQTALESFEGTVLAVTHDRWFARTFDRFLAFG
FT                   MDGQVRETAEPVWDEGRVERSR"
FT   gene            complement(559616..561046)
FT                   /locus_tag="FraEuI1c_0462"
FT   CDS_pept        complement(559616..561046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0462"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   art:Arth_1837 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78545"
FT                   /db_xref="GOA:E3J9Y3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78545.1"
FT                   /translation="MSRKRRVFLTGATGNWGRRVLREFAGRADRFDVVALVLPTRRERA
FT                   AIAEFADLPNLRVVWGDLTDYDAVERCVRGSDYVLHVGAIVSPQADDQPELTHRVNVGG
FT                   ARNIIRAVQAQADPGATSVVMIGSVAETGDRNPPHHWGRVGDPLRVSQFDEYGQSKIIS
FT                   ERALVESGLPRWVWLRQTGIFHSGMLEIRDAIMTHVPFAGVMEWATAEDSARLLANICE
FT                   DGVPEHFWGRVYNIGGGEAWRLTNWEMLVRLGTTLGVKDIRRWYDRDWFATRNFHGQWY
FT                   TDSDELEALVPFRQDTVDDALARAVRACPRSVRLAGRIPATVVKNLVIGPLTRQPRGTM
FT                   AWIRADDDARIRAYFGSRADWEAIGDWSTFRIPAPDRSPRLLDHGYDESKDPAAWTDDD
FT                   FAAAADFRGGELLSENLPAGDVAAPLRWRCADGHEFTGSPRLVLTAGHWCPDCVRDPAG
FT                   YAKQAVANRFLAQVEPTS"
FT   gene            561259..562044
FT                   /locus_tag="FraEuI1c_0463"
FT   CDS_pept        561259..562044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78546"
FT                   /db_xref="GOA:E3J9Y4"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y4"
FT                   /inference="similar to AA sequence:KEGG:PFL_2257"
FT                   /protein_id="ADP78546.1"
FT                   /translation="MTLALKLLLAPLLVVASSVAGRRWGPALTGTLVALPVVAGPILLI
FT                   TDLQHGRQFAAQAANAALLGLVTLALFAVAFARASRSLGWKGSLTLAWCACLIADLALS
FT                   LLVVPPPIGLLLALAATGAAVAVMPAAHPVSAAPTLPRPPGWDLPGRALATALLVLSLT
FT                   GAAATLGPRLTGVLAPFPIATSVVAAFTLAQAGHQPTATLLRGVLRGLVGFAAFCFLVA
FT                   ELVGPAGTFVAFAAALAAALLVQLVVAQLLARSRGRTGG"
FT   sig_peptide     561259..561321
FT                   /locus_tag="FraEuI1c_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.659) with cleavage site probability 0.408 at
FT                   residue 21"
FT   gene            complement(562314..562745)
FT                   /locus_tag="FraEuI1c_0464"
FT   CDS_pept        complement(562314..562745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0464"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: rer:RER_36300 hypothetical protein; TIGRFAM:
FT                   putative F420-dependent enzyme; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78547"
FT                   /db_xref="GOA:E3J9Y5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y5"
FT                   /inference="protein motif:TFAM:TIGR03666"
FT                   /protein_id="ADP78547.1"
FT                   /translation="MAISDEKYVAVTTFRKNSVGVSTPTWIVPLDDGRVGFWTSSASGK
FT                   YKRLRNNPRVTVQPSDNRGRVKADTTPVDGTAELAQAGPDFDAIQTKVRSKYGVMVHIT
FT                   KFFNTVGHLGKGPFPYGDTGIVITLAVPAPSPETAAGPE"
FT   gene            562904..563911
FT                   /locus_tag="FraEuI1c_0465"
FT   CDS_pept        562904..563911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0465"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; KEGG:
FT                   cwo:Cwoe_1123 daunorubicin resistance ABC transporter
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78548"
FT                   /db_xref="GOA:E3J9Y6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y6"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ADP78548.1"
FT                   /translation="MTAAVHARGLVKTFGDVRAVDAIDLDIGEGEIFGVLGPNGAGKTT
FT                   MLKMLATLLTIDGGDASIFGVDVRREPHRVRQLVGVTGQYASVDENLTATENLWMFGRL
FT                   QGLSSRRSRETAAELLEQFGLTDAASKRISQFSGGMRRRLDLAASLITRPPLIFLDEPT
FT                   TGLDPRTRGQMWDTIRGLVASGCTVLLTTQYLDEADQLAGRIAVIDRGRKVAEGTPDEL
FT                   KTSVGNLTLRLRLASGADTSLATDVVRRQLGEEPVVTPEAGQLNVALETSDRVADVLIG
FT                   LRQAGVEIASVGVDKPTLDEVFLALTGHDAGEGEQPDPTVPGQAQEKTPQEVAR"
FT   gene            563908..564750
FT                   /locus_tag="FraEuI1c_0466"
FT   CDS_pept        563908..564750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0466"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cwo:Cwoe_1122
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78549"
FT                   /db_xref="GOA:E3J9Y7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADP78549.1"
FT                   /translation="MTTITAEPRTTITIDPREAVARTHPRATPVDTLRQTLVMAWRATK
FT                   KMRRNPEQFFDVTLQPILFTVMFAYVFGGAISGNVKSYLPLMIPGILAQTVLTCCMATG
FT                   VQLREDMDKGVFDRFKSLPMARIAPLAGPMVADLIRYAIASTLTFTMGIAIGYRPGGGV
FT                   LGVAGAILLAIFTGWSLAWVFTFFGTIARSAQSVQGMSMMILFPLTFLSNAFVPIDTLP
FT                   GPLKAFVKVNPVSHLVSADRDLANHAHLSAQVGWTLVACLVVIAIFAPLSVRSYKRHL"
FT   gene            complement(564847..568005)
FT                   /locus_tag="FraEuI1c_0467"
FT   CDS_pept        complement(564847..568005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0467"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="KEGG: cwo:Cwoe_1121 transcriptional regulator,
FT                   winged helix family; PFAM: transcriptional regulator
FT                   domain-containing protein; transcriptional activator
FT                   domain; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78550"
FT                   /db_xref="GOA:E3J9Y8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y8"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADP78550.1"
FT                   /translation="MPIVLTVLDGVRWRGRPVVGERPQALLAALVVGGGQAVPSERLAE
FT                   VVWGENEPGNAGKALQVLISRTRSQCGPDAVVRDGHGYRLGVPSEQVDALRLGDLTRRA
FT                   RRLLAADDLAAARETAAEAMALAETLVEPRDEDCHPLAELRRDATAQRAELAGLLGRVL
FT                   SLAGEHEAALPRLLEAFDRDPSDEAALACLLRSEAAVRGTTAALDRYERHRSELRERLG
FT                   VSPGEALERVHRELLHLDRPVRVGLHYDTSPLIGRADDLRRLRALVGTSRVVSIVGPGG
FT                   LGKTRLAHALGRAAEQPVVHFVGLVGVTSPDDVIGEVGSALGVRDSVHGRRTLTPQQLA
FT                   DVRGRIAQHLNAAPSLLILDNCEHLVDAVADLVAFLVATAADLRVVTTSRAPLAISAER
FT                   VYPLGELGPVESADLFRQRAVAARPDVQLPVDAVMDIAARLDGLPLAIELAAAKARVMS
FT                   VEEISRRLEDRFALLRGGVRNAPDRHRTLIAVIDWSWNLLEERERRALRWLSVFQDGVT
FT                   LTAAERVLGADALGAVQALVDQSLLTVVETAAGVRFRMLETVREFGRMRLAQAGEQDQA
FT                   LAALRAWAVDYANAAAQQMFGAHQFDGIDALDAEEINLADVLRQALAAADPETAIQLLC
FT                   GLGGLWSVRGEHPRVFVLAGSVAETVAGWVPPPELADATRAALVIVRQNAMIGASSEAH
FT                   ATIHDLLVRLGTDEHGDPRINAMVTVLLSHDPSSGEPFGTRLDELAESTDPAVAIAALQ
FT                   WRSHLHENAGDPISAIDGAERALSLMREDFDGPWLAAMLHAHLAALHMQLGRPVTAVPH
FT                   ARAAIPVLARLGATDDLVQLHSVVALAEVAAGHLDEASAYLDEIEQLKGSDAILGGLLA
FT                   LGPAEAEIALARGDPTAGLAAYRASSARLRAFAFPGHQSTGVEPWLLFADASMLTAFAY
FT                   HGTSGDEADGTELFATCRARTLSALGLDDVLLDFPVCGMALFALGAWGLLRSAVPAAEA
FT                   VRLLVLAERFSYSRMIPTMSWDRIAPCAEELAPGSIAALRAEYGDQPGPALVAQARRAV
FT                   DQLG"
FT   gene            568374..568973
FT                   /locus_tag="FraEuI1c_0468"
FT   CDS_pept        568374..568973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK23793 GK23793 gene product from
FT                   transcript GK23793-RA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78551"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y9"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK23793"
FT                   /protein_id="ADP78551.1"
FT                   /translation="MATVAGAALLPLAGCQPAASSSLASATVSPAADSATAQPADPSTE
FT                   GSNLPAPTQTAPVATATALPTATPGTPRPRIPAARGTGGPGSETITITSPVAVSGHVDT
FT                   TVTCGVTGNHYTASASAVVQGYTVAETVVAANYHAPGTYTILVTVSLTIPGEGRYVITA
FT                   VPASAQITDTGGSVSFSATSDSGRTLAGSIAWACSV"
FT   sig_peptide     568374..568448
FT                   /locus_tag="FraEuI1c_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.436 at
FT                   residue 25"
FT   gene            568986..569612
FT                   /locus_tag="FraEuI1c_0469"
FT   CDS_pept        568986..569612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78552"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z0"
FT                   /inference="similar to AA sequence:KEGG:Sare_0339"
FT                   /protein_id="ADP78552.1"
FT                   /translation="MIPDGQLVAEPVGATVGGARRWRWLVALSLVVLLGLLLADRLLVG
FT                   VVEDRLSARLSCLGALTGTRTVHIGGFPFLTQMAEGHYRVVTVTADGVGASARLTDVDV
FT                   TFHDVRMRPLAGLVGRSAPGSITVGSISARATVMFGSAGPASGLGAGDALLDAAGSGRL
FT                   DEPIARLAGLPFPVHLDGAQPVPGGVRVALSVPGTAISGVGRCQS"
FT   gene            complement(569696..570502)
FT                   /locus_tag="FraEuI1c_0470"
FT   CDS_pept        complement(569696..570502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0470"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="TIGRFAM: precorrin-6x reductase; KEGG: rop:ROP_05640
FT                   precorrin-6X reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78553"
FT                   /db_xref="GOA:E3J9Z1"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z1"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADP78553.1"
FT                   /translation="MRVLILGGTREARDLAALLVAEPGMVVTTSLAGRVRDPALPAGEI
FT                   VIGGFGGVAGLRAFLRDRAIDVVVDATHPFATTMSEHAVAVCVGPPDDAPPTAPGAGVP
FT                   LVRLARPGWTERPGDGWHRVADLRTAADQARALCPPGGAVFVTTGRRQLAPFAADPYRH
FT                   YVIRAVDPPTDVLPPRHTVLLDRGPYTVEGETRLMRDHGVRVLVTKDSGGALTAAKLDA
FT                   ARALGLPVVMVDRPALTDPAPPTWSNVAGVLGALHALASSQRPGAR"
FT   gene            complement(570490..571242)
FT                   /locus_tag="FraEuI1c_0471"
FT   CDS_pept        complement(570490..571242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0471"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; KEGG:
FT                   ami:Amir_1779 precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78554"
FT                   /db_xref="GOA:E3J9Z2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z2"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADP78554.1"
FT                   /translation="MTVHFIGAGPGAADLITLRARDLIAASPVCLYAGSLVDPAVLAHC
FT                   PPGARLVDTARLTLDEIVGHLVEADAAGQDVARLCSGDPSVFSAVAEQMRRLDAAGVRY
FT                   DVCPGVSAYAAAAAELNRELTVPGVAQSVVLTRTSENASAMPAGETLAALGAAQATMVI
FT                   HLSVQRIEAVVAELLPVYGADTPVAVVAWASRPDQVVLRGRLDGIAPAVRAAGIRRAAV
FT                   IIVGAALAAEGFRDSHLYSVERDRACVS"
FT   gene            complement(571239..572525)
FT                   /locus_tag="FraEuI1c_0472"
FT   CDS_pept        complement(571239..572525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0472"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating), CbiT subunit;
FT                   KEGG: sen:SACE_5944 precorrin-6Y C(5,15)-methyltransferase
FT                   (decarboxylating); PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78555"
FT                   /db_xref="GOA:E3J9Z3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z3"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADP78555.1"
FT                   /translation="MTGGFGVTVVGIGEDGWDGLGQPARAALAAADVVLGGARQLGLVA
FT                   GRVRAVETWPRDLAAAAAALPDSHAGQRVAVLASGDPMHYGVGGTLTRALGPGQVRVLP
FT                   APSSISLACARLGWPVEEVAVVSAVGRPYAAVGAELRADARVLVLTGDEDGADRVGRLV
FT                   AERGLDAELTVLERLGGPRERVGRHPGRPGIPPHDRLAIVAVRCGPDSTHESQAVASRA
FT                   PGLPDDTFATDGVLTKQEVRAVTLAALAPAPGELLWDVGAGSGGITTEWLRADRRCRAV
FT                   AIEPRADRAAHVRANAERLAGAVEQTAGLATAAGGLRVVEGRAPAALAGLPRPDAVFVG
FT                   GGASVAGVIETCLAALRPGGRLVANAVTIETEAMLADWHRRAGGRLRRIAISHAEPVGS
FT                   FTAFRPALPVTQWVHTAPVHTAQEKRATR"
FT   gene            572913..575093
FT                   /locus_tag="FraEuI1c_0473"
FT   CDS_pept        572913..575093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0473"
FT                   /product="Magnesium chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="PFAM: von Willebrand factor type A; magnesium
FT                   chelatase ChlI subunit; KEGG: gob:Gobs_0546
FT                   cobaltochelatase subunit; SMART: von Willebrand factor type
FT                   A; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78556"
FT                   /db_xref="GOA:E3J9Z4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z4"
FT                   /inference="protein motif:PRIAM:6.6.1.1"
FT                   /protein_id="ADP78556.1"
FT                   /translation="MPLFPFSAIVGMDDLRLALVLNAVCPEIGGVLVRGEKGTAKSTAV
FT                   RALAGVLPPVAVVAGCRFSCDPARPDKECPDGPHPAAAPASHRPTRLCELPVGATEDRL
FT                   LGSLDIERALTAGVVMFEPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAALGVAHVER
FT                   DAVSVRHAARFLLVGTMNPEEGELRPQLLDRFGLTVQVAAPREPALRAEVVRRRLAFDA
FT                   DPDAFAARYEDAERELSARIAAARAALPAVRLPDRELTRIAAVCAAFEVDGLRADLVTA
FT                   RAAVAHAAWAGRAEVTEDDVRAAVELALPHRRRRDPFDAPGLEPDALDAALEAARKELD
FT                   ALPSQDDAGQDDEGRDGPSEGQGQGDQDATHDAAPPTGPDGQTDLDSDPDPGGPGGGVP
FT                   AAGADDEGHPAPEGQAGDQMAPPPATRPAVGVVAPAATFRARRLEVPGVGGGVPGRRSR
FT                   AATPSGAVVGAQVPAGRLRDPHLLATLLAAAPHQLARGRGGPGLRLRPADLRQARREGR
FT                   EGNLVLFVVDASGSMAARARMGAVKAAVLSLLLDAYQRRDKIGLVTFRGEDARLALPPT
FT                   SSVDVAATLLADLPSGGRTPLADGLLLAHRVLARERLRDPSRRPLLVVLTDGRHTAGPR
FT                   PGPAARLLARSGVAAVVVDCEAGRVRLGLAGELAATLGATLLGLAELGAPGTGPEAAGP
FT                   GGGRGRRDPAGLDSAAAGAGLAATVRALRDAA"
FT   gene            575093..575707
FT                   /locus_tag="FraEuI1c_0474"
FT   CDS_pept        575093..575707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0474"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="TIGRFAM: cob(I)alamin adenosyltransferase; KEGG:
FT                   cai:Caci_6038 cob(I)alamin adenosyltransferase; PFAM:
FT                   ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78557"
FT                   /db_xref="GOA:E3J9Z5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z5"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ADP78557.1"
FT                   /translation="MAPQGQVESVPADGLTTRQRRNRPLLVVHTGDMKGKSTAAFGLAL
FT                   RGWNQGWPIGVFQFVKSKKWKVGEENALLALGRLHEQTGEGGSVDWFKMGSGWSWTQRG
FT                   PQDDHAAAAAEGWERIKADLAAQTYGLLVLDEFTYVMEWGWVDVEDVVETLAARPGFQH
FT                   VVITGRRAHPRLIEVADLVVEMTKVKHPMDAGQKGQRGIEW"
FT   gene            575778..577226
FT                   /locus_tag="FraEuI1c_0475"
FT   CDS_pept        575778..577226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0475"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: gob:Gobs_0544 cobyrinic acid a,c-diamide
FT                   synthase; TIGRFAM: cobyrinic acid a,c-diamide synthase;
FT                   PFAM: CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78558"
FT                   /db_xref="GOA:E3J9Z6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z6"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ADP78558.1"
FT                   /translation="MRIPRVVLAAPASGAGKTSIATGLLAALRARGLAVSPHKVGPDYI
FT                   DPSYHALAAGRPGRNLDPWLVGEQRVAPLFLHGALHPRRADVAVVEGVMGLFDGHATRA
FT                   GFGSTAHVATLLAAPVVLVVDARSAGRSVAATVHGFRSFDPAVRIGGVVLNQVGTERHA
FT                   EILRAAMAEIGMPVLGVLGRRPDLVTPSRHLGLVPAAERAAPARDAVAELGAAVGSGLD
FT                   LDALLALAATAPDLPAEPWDARVAALEPVGSPVPAGPRPVVAVAGGPAFTFGYAETPEL
FT                   LAAAGAEVVGFDPTVDEALPAGTSGLIIGGGFPEVHAGALAANAALRSRVRAFAATGAP
FT                   VAAECAGLLYLSSALDGAPMCGVLGEVTAAMTPRLTLGYREAAAVTDSVLAARGTTVHG
FT                   HEFHRTVATPAAGGSTGGDARRGAAPAWRWRDASGVEVAEGFVRGAIHASYLHTHWAGV
FT                   PGAAHRFVAAARAAHQTEAFRAAG"
FT   gene            577213..578190
FT                   /locus_tag="FraEuI1c_0476"
FT   CDS_pept        577213..578190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0476"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="KEGG: stp:Strop_3555 cobalamin biosynthesis protein;
FT                   TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78559"
FT                   /db_xref="GOA:E3J9Z7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z7"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADP78559.1"
FT                   /translation="MPRAERRRGVGPGGVAAAIVAGAVADLVFADPGRFHPVAGYGRAA
FT                   AVVERRLYADSRAAGAGFVAVAVGGPMLAAAALDRLVPSRARPVLLAAALWAALGGTSL
FT                   RREGAVMARLLTSGDLPASRDRLGHLCGRDPSGLDEPELARAAIESVAENTADAVLGPL
FT                   LWGAALGLPGVVGYRAVNTLDAMVGYRSPRYLRFGWAAARLDDVANLVPARLCAALTAL
FT                   VAPVVGGSPRQAWRTWWRDGDNHPSPNAGQCEAAFAGALGITLGGTNIYDGEVEARGRL
FT                   GDGGPAAGADVARSADLSGAVGAAAVVLAALAGAVRVTARRGGS"
FT   gene            578187..579785
FT                   /locus_tag="FraEuI1c_0477"
FT   CDS_pept        578187..579785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0477"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="KEGG: tcu:Tcur_1288 cobyric acid synthase CobQ;
FT                   TIGRFAM: cobyric acid synthase CobQ; PFAM: CobB/CobQ domain
FT                   protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78560"
FT                   /db_xref="GOA:E3J9Z8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z8"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ADP78560.1"
FT                   /translation="MSGALLVAGTTSDAGKSVLTAGICRWLARQGVRVAPFKAQNMSLN
FT                   SWVTADGAEIGRAQVMQAAAAGVEPEGAMNPVLLKPGAGHRSQVVLRGRPVAEAGALDY
FT                   RALKGRLFTEVLASLADLRSRFDVVICEGAGSPAEINLRADDIANMGLARAARLPTLVV
FT                   GDIDRGGVFAAMFGTLALLEPADQALVAGFVVNKFRGERALLEPGLGMLSGLTGRPVLG
FT                   VLPWRDGLGLDVEDSLGLPGPGETRGDLDGTLRVAAVRLPFLSNFTDLDALAAEPGVAV
FT                   RYVDRPEDLDAADLVVLPGTRSTVADLAWLRGRRLDGPLARRAATGRPVLGVCGGYQML
FT                   AETIVDEVESGAGRVDGLGLLPVTIRFAAAKTLGRPDGVAYGQPVRGYEIHHGVASVHG
FT                   GEPFLDGCRAGAVWGTTWHGAFENDGFRRAFLADVAARVGSPWQPRGEVSFAAVRERRL
FT                   DVLGDLVAEHLDTDALLRLLADGPPAGLPFIPPGAPTGAAGPALAGGAPAPPVTAGLPE
FT                   AGHLRSSVPDLGSRP"
FT   gene            579782..583462
FT                   /locus_tag="FraEuI1c_0478"
FT   CDS_pept        579782..583462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0478"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="TIGRFAM: cobaltochelatase, CobN subunit; KEGG:
FT                   fal:FRAAL2330 cobaltochelatase subunit CobN; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78561"
FT                   /db_xref="GOA:E3J9Z9"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z9"
FT                   /inference="protein motif:TFAM:TIGR02257"
FT                   /protein_id="ADP78561.1"
FT                   /translation="MILLLSTSDTDLSCARACGEDYRLGNPARLDVADLPGLLDGVDVV
FT                   VLRLLGGRRAWPEGVDALLARGLPVVVLSGELIPDAELMELSSVPAGVSAQAHAYLAHG
FT                   GPDNLRQLARFLSDALLLTGLGFDPPVPTPAWGLRPRPDTAAPDERPTVAILYYRAHEL
FT                   AGNTAFVDALADAVDAAGGRAVPVFCASLRTADTELLAELGRAATLVTTVLAAGGAALG
FT                   AIPAEVGAGGRDEDWDIGALAALDVPILQALAVTSSREQWEASDDGLSPLDTATQVAIP
FT                   EFDGRIITVPFSFKEIDADGLSRYVPDPERAARVAGLAVRHARLRHVANADKRIALVLS
FT                   AYPTKHARIGNAVGLDTPASVLALLGALREAGYDVGPETGPGALPGLEAGDGDAFIHGL
FT                   IAAGGQDEDWLTAEHLAGNPVRVPAAVYRSWFATLPQDLRSAVEQHWGPAPGDLFVDHG
FT                   TDPDGEIVLAAVTAGNVVILIQPPRGFGQNPIAIYHDPDLPPSHHYLAVYHWLRNGQDA
FT                   AGFGAHAVVHVGKHGNLEWLPGKAAALSASCAPDAALGDLPLVYPFLVNDPGEGTQAKR
FT                   RAHATVIDHLVPPMARADSYGDIARLERLLDEHAQIAAMDPAKLPAIRAQIWTLIEAAK
FT                   LDHDLGLTNRPHDAEFDEFILHVDGWLCEIKDAQIRDGLHVLGAAPTGDARVNLVLSML
FT                   RARQLWGGAVALPGLRQALGLGSEEGTTRTDAVEAVARELLTELDDRDWDPAAVDEVVA
FT                   EVLGVPAETDAIDRAPDDPDLVDRAAVAAVLTFAATEIVPRLARTTDEIDRTLHALAGG
FT                   FIPAGPSGSPLRGLVNVLPTGRNFYAVDPRAVPSPLAWETGRAMADSLLARHLADTGEY
FT                   PRSVGLSAWGTSAMRTSGDDVAEILALLGVTPLWDEASRRVRGVEPIPLAELGRPRIDV
FT                   TVRISGFFRDAFPHVVDLLDDAIRLVADLDEAPEDNYVRAHADADAATHGDRRRATTRI
FT                   FGSKPGAYGAGLLPLVDSGTWHDDADLAEVYAAWGGFAYGRGLAGRPARDDMTAAYRRI
FT                   SVAVKNTDSLEHDIADSDDYFQYHGGMIATVRALTGRGPRAYIGDSTRPDEVRTRTLGE
FT                   EMARVVRARVVNPRWISSMRRHGYKGAFELAATVDYLFGYDATAGVVADWMYEAVTEAY
FT                   VLDEENQKFLTDSNPWALHGIAERLLEAVDRGLWSAPRPETLDALREVYLRAEGDLEGR
FT                   A"
FT   gene            583463..584716
FT                   /locus_tag="FraEuI1c_0479"
FT   CDS_pept        583463..584716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0479"
FT                   /product="nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; KEGG:
FT                   gob:Gobs_0576 precorrin-3B synthase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78562"
FT                   /db_xref="GOA:E3JA00"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA00"
FT                   /inference="protein motif:PFAM:PF03460"
FT                   /protein_id="ADP78562.1"
FT                   /translation="MAAARDRVTDRCPGALVLHEAADGGLARIRLPGGLIAGGTLVALA
FT                   ELAESFGPRGAVELTSRGNLQLRGVPAGRHSELADRVAELGLLPSATHERVRNIVAAPF
FT                   AGLVGTAGGAGDSALDGLVRALDLGLCADPDLAGLSGRFLFGLDDASGAVAALEADAWA
FT                   VPLDAGRWWVGPAGVAVDGPDVVGELLAAARGFLRAAVDAAVSAAPAGHPIWRVRDLPD
FT                   GGAGLAAELRAGRPEVARPEPPPGRRPVGVWRRPDGGHAAAALVPLGRLSRAGAEMLAA
FT                   AGQGMDPAAVSLRVTPWRSVVVPRLADPASFVPAARRAGLDAEPQSLWALVTACAGRPG
FT                   CASALADVRADAADAVAAGRLTPAFAARPLPPGARAHWSGCARRCGRPAGSYVDIVAGP
FT                   DGYLVHAAGAEPKESSRW"
FT   gene            584710..585360
FT                   /locus_tag="FraEuI1c_0480"
FT   CDS_pept        584710..585360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0480"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="KEGG: fal:FRAAL2332 precorrin-8X methylmutase; PFAM:
FT                   Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78563"
FT                   /db_xref="GOA:E3JA01"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA01"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADP78563.1"
FT                   /translation="MVTGSSQRRYDYERDGAAIYRQSFATIRAEAELADLAPDLEHVVV
FT                   RMIHACGMVDLPADVEASPGVVGIARTALRAGAPVLCDAQMVASGITRRRLPAANDIVC
FT                   ALGDPGVPELAARLGTTRSAAALELWADRLAGAVVAIGNAPTALFHLLELIGAGGPRPA
FT                   AVLGLPVGFVGAAESKQALADNPFGLPFLVVHGRRGGSAMTVAAVNAIASEAL"
FT   gene            585357..586910
FT                   /locus_tag="FraEuI1c_0481"
FT   CDS_pept        585357..586910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0481"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="KEGG: nfa:nfa31520 putative precorrin 2
FT                   methyltransferase/precorrin 3B methyltransferase; TIGRFAM:
FT                   precorrin-3B C17-methyltransferase; precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78564"
FT                   /db_xref="GOA:E3JA02"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA02"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADP78564.1"
FT                   /translation="MTTQPPAAGTLYGVGVGPGDPELVTVKAVRLIGAAPVVAYHAARP
FT                   GRSLARASAAPYLRPGVVEEELVYPVTRGVTPHPGGYQGAIEEFYERSADRLADHLAAG
FT                   RDVVLLAEGDPTLYSSFTHMQRRLVPRFRCVIVPGVTSVSATAAAAGVALVTGDETLAV
FT                   LPATTRADRLRTLAGTADGLVLMKVRGDLGGVRQALADVGRLDDALLVSRASREGERVT
FT                   ALRDLGGSDQDVPYMSSVLVPGASAARPATPGQAVAGSVTVVGLGPAGAEWLTPEAACA
FT                   LAAADDVVGYETYLRRVPPRPGQRRHGTDNRVEAERAAFALDLARRGSRVAVVSSGDPG
FT                   VFAMASAVLETQADGGYQDVPVRVLPGVTAANAVAARVGAPLGHDYCVVSLSDQLKPWP
FT                   LVLRRLRAAAVADLVLALYNPGSKTRRAHMDEVRACLLEARGPDTPVVVGRAVGADGER
FT                   IEVIRLADLTADHVDMRTLLIIGSSRTRWDAATGAVFTPRHHDGLPGPVTADAAAGTHP
FT                   "
FT   gene            complement(586876..587652)
FT                   /locus_tag="FraEuI1c_0482"
FT   CDS_pept        complement(586876..587652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0482"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="TIGRFAM: precorrin-6A synthase (deacetylating);
FT                   KEGG: fal:FRAAL2802 precorrin 6A synthase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78565"
FT                   /db_xref="GOA:E3JA03"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA03"
FT                   /inference="protein motif:TFAM:TIGR02434"
FT                   /protein_id="ADP78565.1"
FT                   /translation="MADPAAPPRRSVLLIGMGVGDPASLTHEASAALAGVDVLFTIDKG
FT                   PAKADLNALRAEICARHARPGLRVVEVSEPDRDRAPDDYQAEVRRWHTARAEVWSRALL
FT                   TELGESDRGAFLVWGDPALYDSSLRILDDIRARGLVDVAVTVIPGISSVQVLAARHRVP
FT                   LNTVGGAVHVTTGRRLAAEAGGQDSVVVMLDGATAWLDLDASRWDIYWGAYLGGADEIT
FT                   IAGPLAEVGAEIATAKQTARARKGWIMDVYLLRRRR"
FT   gene            587940..588524
FT                   /locus_tag="FraEuI1c_0483"
FT   CDS_pept        587940..588524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0483"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: scb:SCAB_66441 putative acetyltransferase;
FT                   manually curated; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78566"
FT                   /db_xref="GOA:E3JA04"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA04"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78566.1"
FT                   /translation="MSLRHESAHDRESVRGVVTRAFGGEHGEVVADLVDDLRATISPGT
FT                   GLSLVAEDDGEIVGHAMFTRSLLDAPRRLVEVQVLSPLAVLPEYQKRGLGSALVRHGLE
FT                   ILAESSSPLVFLEGDPSYYHRFGFVPGGGLNFRKPSLRIPDAGFQVVTLPAYQPWMTGT
FT                   LVYSELFWRHDAVGLRQNEAEKVAPPVPGSA"
FT   gene            588835..589677
FT                   /locus_tag="FraEuI1c_0484"
FT   CDS_pept        588835..589677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0484"
FT                   /product="putative esterase lipoprotein"
FT                   /note="KEGG: mbt:JTY_3323 putative esterase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78567"
FT                   /db_xref="GOA:E3JA05"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA05"
FT                   /inference="similar to AA sequence:KEGG:JTY_3323"
FT                   /protein_id="ADP78567.1"
FT                   /translation="MTRRLVVDGRTRTFTLHRPAAAPAGRLLPVVLAFHGGFGNGSGMA
FT                   GLTHLDAVADQNGFLAVYPDGYQRSWNDGRGSTPADRAGVDDVAFVAALIDELVRDERA
FT                   DPRRVYATGISNGGIFTERLGCELADRLAAIAPVAGPMPADLVAGCRPARPIGVLEIHG
FT                   TADPIVPYSGGHVNGRGGGGQVASVAATGELWRRLDGCAAQPDVRPVADRVSDGTHLSV
FT                   ATAVGCPDGVGVVVDSFTGAGHTWPSGRQYLPKALIGRTSRQLDASRAIWAFFADYHR"
FT   gene            complement(589693..590928)
FT                   /locus_tag="FraEuI1c_0485"
FT   CDS_pept        complement(589693..590928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_2552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78568"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA06"
FT                   /inference="similar to AA sequence:KEGG:Mvan_2552"
FT                   /protein_id="ADP78568.1"
FT                   /translation="MTEPQVEPAPDPASVSTEDELRAAVLALLGDSYDRAVERRTGLSK
FT                   TTVNDVRNERRRLTAKTLTLIVEAYDPHRRDVWLAAWRRVRTRSERAGASLAADDDAHP
FT                   AGPGDGLAGTDTDADPIAAAEANLAGVTGGSPLLDGSRGGAGMGQPAGPGRSGSGPWRT
FT                   VSLAAGIALVASAGAALITYFAVRGDAAPPSAPVATNAAPAGGPGPVLPGQAPPLGPGG
FT                   PGAAWPVGGIGPPRIDQSPAARGPAPVARGCYSLPLQTRADVVAQSGADAAGLRVTELR
FT                   YTYYPAWHPSLAFGGRLSGPVPRSSRLVFAAWADPSTTDSTRDHNRGNGRFYPGDDLPT
FT                   TDENCFTVPPYNLSYGGYPGITTRLYAMLVDATDVKPFLRAAGQSAGLTDTDLARLGIR
FT                   ILGYAVVPSKPE"
FT   gene            complement(591291..592634)
FT                   /locus_tag="FraEuI1c_0486"
FT   CDS_pept        complement(591291..592634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0486"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: sen:SACE_4097 putative deoxyribodipyrimidine
FT                   photolyase; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78569"
FT                   /db_xref="GOA:E3JA07"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA07"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADP78569.1"
FT                   /translation="MTTLAVFTRDLRVHDNPMLTAAALAGEHTVPLFVLDAAMARSGFA
FT                   TGARERFLAESLADLDRSLRELGGRLVVRAGDPVEQVCRVADEVDAGTVHLAADCSGYA
FT                   QRREAALRSALAERGRTLHCHDEAHVVVAPGRVTPAGRDHYAVFGAYHRRWEAAGWRRV
FT                   IAPPARLRLPAVDPGALPPIGGPAGGESAGGGFHGGETVGRRRAEEWLREGVEVYDERR
FT                   DQLAADATSRLSPYLHLGCLSALELATQAGTGDAARDFVRQLAWRDFFHQLLAARPAAA
FT                   HEDYRDAHRTWRDDPAALDAWRSGHTGIPIVDAGMRQLLTEGWLPNRARMITASFLTKT
FT                   LGLDWRAGAAHYTEHLLDADVANNSLNWQWVAGTGTDTRPGRVLNPLRQAERFDPDGVY
FT                   VRRHVPELAGLPGRQVHRPWRLPDRERAALDYPEPLPILPERLTSEQF"
FT   gene            complement(592631..594118)
FT                   /locus_tag="FraEuI1c_0487"
FT   CDS_pept        complement(592631..594118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0487"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sma:SAV_1211 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78570"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA08"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78570.1"
FT                   /translation="MRCVVVGATGYIGSRLIPELLARGHTVRAAARRPDRLAGAPWLDQ
FT                   VDLVTADVGDPGQVAAALAGQDVLYYLVHSLHQRDFVERDRAAAQTVARAAREAGVRRI
FT                   IYLGGISPAGQRLSAHLASREEVGLTLLGSGVPTVVLRAAVVIGSGSASFEMLRYLTER
FT                   LPAMVTPRWVRSRVQPIAVRDVLYYLTRTAELVPAEVNRGFDIGGPDVLTYWEMMRRYA
FT                   TVAGLPRRVVVPVPLLTPWLSAQWVNLVTPVPRSIAVPLISSLVHEVVCRDHDLAAYVP
FT                   DPASGLTGYDDAVALALARTREADVPSRWARATTPRTRSLPPSDPLPTDPDWSGGTVYQ
FT                   DVRELATAADPTRLWQVIETVGAENGRHVIPAARAVAARPGRVTRSAEALRRRLVRPAG
FT                   AADAPLSGWRVEDAERPRRLRLRAQLRLPGRAWLELSAAPAAQGSVYRQRAIFEPHGLL
FT                   GQLCWKSFAPVRGLVLGRMAHTVAAAAERPAPVGQPW"
FT   gene            594286..595533
FT                   /locus_tag="FraEuI1c_0488"
FT   CDS_pept        594286..595533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0488"
FT                   /product="diguanylate phosphodiesterase with GAF sensor(s)"
FT                   /note="KEGG: fal:FRAAL3871 regulatory protein; PFAM: EAL
FT                   domain protein; GAF domain protein; SMART: EAL domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78571"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA09"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADP78571.1"
FT                   /translation="MVGTVESGARVIEPDRKVTDLLDVLRQHLGMDVAALAIWQDRQLV
FT                   VQLFAGDGRSFGLVPGITIRNGGELYRDVQDERIPMVSGNAHGYARARHSSALDELDVG
FT                   AYAMTTLTDGRDEPYGLLFCLTHEACPTLQERHQQFVQLIATFLRDSLLDLREMWQTRS
FT                   QIWSAISDVIDSGGPGMAFQPIVRLDTGEVGAVEALARFSARSGGRIRTTEEWFRDARL
FT                   VGLSTELDLAAIRRAVAVIPDLPPGLKLAVNASPSTVATVLGEFVKDLPHRDRLIIEIT
FT                   EHENYTAGPETVLAVGHLRDLGVRIAIDDAGTGYSGLEKLVLLRPDVIKIDQVLTRGID
FT                   VDPARRALTAGLVALAGEIGGTVIAEGIETRTERDAMLRSGVHYGQGYYLGMPSPSLVP
FT                   RTPAWVGVGPSWRRAP"
FT   gene            complement(595658..596332)
FT                   /locus_tag="FraEuI1c_0489"
FT   CDS_pept        complement(595658..596332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_1029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78572"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA10"
FT                   /inference="similar to AA sequence:KEGG:Sros_1029"
FT                   /protein_id="ADP78572.1"
FT                   /translation="MLDIIGVGFGRTGTLSLKSALEQLGFGPCHHGDEVIAHRETAVDW
FT                   IQAADGRPVDWDAIYDGYRSTVDWPGARFWRELTAHFPEAKVILTFRDPEQWYESMCNT
FT                   VFRAISNVPAQVPPEVLPLITMIRRVTMDGVFGGEVPDRETALRIFAEHIEAVRAQIPG
FT                   DRLLIFDVAEGWGPLCAFLDVPVPATPFPRANDQDFFTTTHQTRLATAALAAAAGDEAS
FT                   KS"
FT   gene            complement(596540..597508)
FT                   /locus_tag="FraEuI1c_0490"
FT   CDS_pept        complement(596540..597508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0490"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: msm:MSMEG_5330
FT                   SIS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78573"
FT                   /db_xref="GOA:E3JA11"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA11"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADP78573.1"
FT                   /translation="MDAELFQADLEAKPARLRELSAQLGHLWAGVDTDRPILLLGMGSS
FT                   HYAGGVVAARLRAAGTPAVAEIASNDLLPRPRPGTLVIAVSASGGSTETLDAVRRLRDA
FT                   DPGGAVTFVALTNRAGSELESSCDVAVPMLAGTELGGVACRSFQHTLATLLALPALAGR
FT                   TPWPETVGKAAEATEDLLARRDTWLATTAELLLGPHGTHVAAPARRLSSAQQSALMLRE
FT                   GPRLPAVACETGDWSHVDVYLTKTTDYRLLLCGGSRWEPELFRWTKERGSTVVAVGAPA
FT                   PDAAYTLRYRHDEDDGVRLLTETLVAELLAADAWRRSAATA"
FT   gene            complement(597508..598686)
FT                   /locus_tag="FraEuI1c_0491"
FT   CDS_pept        complement(597508..598686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0491"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sro:Sros_1800 uncharacterized protein probably involved in
FT                   trehalose biosynthesis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78574"
FT                   /db_xref="GOA:E3JA12"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA12"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADP78574.1"
FT                   /translation="MADGSPTLPLVVELVDGAWRARPSGPGAGVALLALLRSDGDVPDG
FT                   FRITRGVSRPFEPTERRVTADQTNESWIIGEAAVVKWTTQPLVGPDPERLRRLVAAGFS
FT                   RTPALWGMIEWRTPDGHWVPVATVNDLVPGAEDGWTWCVDEARHALAALDPPAAAPVPR
FT                   GDEGDGRVGRPFGAELGALTAAMHLALADRTPATASPDEALSWLEAAEDLLGQVSSPLL
FT                   DAHRDSIAAALGPLGQAAGTPLVAAHGDFHVGQLLRAPGGPLFVIDFDGNPTLTPRQRR
FT                   APQPAALDVAGMLLSLENVGHVVCHHNPEVPAAAAATWTASVQAEFLDSYRAGLGSAGR
FT                   GDLLDESLLEAYGWQQLCRELAYADRHLPRWRYVPEAALRRRFPPPAGPEDA"
FT   gene            complement(598679..600001)
FT                   /locus_tag="FraEuI1c_0492"
FT   CDS_pept        complement(598679..600001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0492"
FT                   /product="UDP-glucuronosyl/UDP-glucosyltransferase"
FT                   /note="PFAM: UDP-glucuronosyl/UDP-glucosyltransferase;
FT                   KEGG: sro:Sros_1806 macrolide glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78575"
FT                   /db_xref="GOA:E3JA13"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA13"
FT                   /inference="protein motif:PFAM:PF00201"
FT                   /protein_id="ADP78575.1"
FT                   /translation="MPLTVLFVPESAYGPTNQCIGLGKVLLDRGHTVVFAAERSWEGKL
FT                   APFGFGEALVDLAPPATDQGEADQGAEVAGQFWIDFINETAPEFRKPTIEQLETFVAPT
FT                   YQALIDGARYCEAQLKAIIAEHRPDVLVEDNVIAFPALTTADGAFVRIVSCNPLEIRGA
FT                   GVAPAFAGYAADDRSQWDAFLAEFDRTHQPMWAEFNDWVQAQGAKPLAERDYIETSTHA
FT                   NLYVYPAELDYTDARPLDSTWHRLDSSVRETDDAYELPARFAFRGPDEALVYLSLGSLG
FT                   SADVGLMQRLIDLLATTRHKVIVSLGPRADELKLGPNMVGAAMLPQTTIIPQVDLVITH
FT                   GGNNTTTECMHFGKPMILLPLFWDQYDNAQRVHERGYGIRLPTYGFADDELTGAVDRLF
FT                   TDTALRTKLDAVGAAIRGRDGLRTGADVIERVGLDHVAARG"
FT   gene            complement(600087..601547)
FT                   /locus_tag="FraEuI1c_0493"
FT   CDS_pept        complement(600087..601547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0493"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: sen:SACE_4737 DedA/PAP2 family phospholipid
FT                   acid phosphatase; PFAM: phosphoesterase PA-phosphatase
FT                   related; SNARE associated Golgi protein; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78576"
FT                   /db_xref="GOA:E3JA14"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA14"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADP78576.1"
FT                   /translation="MSRIVDGLINLPPWLVLLVAFALPAAEASIFVGVVFPGEIAIIVA
FT                   GVLAHAHKLPLWLVIVVGTLGAVIGDSIGYEVGARYGDWVLARLPKRLVKPEHVEQGRA
FT                   LLRRRGGWAVLIGRFTAALRALVPGLAGTSRLPYRTFLPYNIVGGLAWVTMSALIGYVA
FT                   GASYKAAEHQVSLISGGLLALIVLVLLHQVARRSQRVQSWLARHGDKLPDRWLSVSVLV
FT                   LVAGGWLLGGLVQDVENVQGPTGATTSDSRLLDDVIGYRRSWLTPVVRGITVLGSSPVT
FT                   YGVVAVLGALVVWRTRNWVLPLCSVALLGAGQGVRLAISHAIARPRPPRAVWLTGAHGY
FT                   AFPSGHTTLATIAYGLAGLLLLRLLPASRLATALVSLVAVVLAAAVGLSRVYLGVHWPS
FT                   DVLAGWSLGAGWLALAATAFTLVRLIRRRRSTPTAAAKTVPEAQTAAEAQAVSAAPDVR
FT                   RLAIETPAEPSPARDGAGSGAAFRPDLG"
FT   gene            601819..603282
FT                   /locus_tag="FraEuI1c_0494"
FT   CDS_pept        601819..603282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0494"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sro:Sros_7073 arabinose efflux permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78577"
FT                   /db_xref="GOA:E3JA15"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA15"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78577.1"
FT                   /translation="MTELSTQSAQPAAQVPGRAPTARTAPPKNGRANLHLLVVGAGALM
FT                   VSLSQSVLIPVLPSLPTTLHTSASTVEWLLTSTLLVAAVAVPVMGRLADMFGKRLLLLV
FT                   ALGTLVVGSVLDAVTNNIPIVIVGRCFQGVSVAAVPLGISLLTVLLPRERVGAGIATIS
FT                   SMLGVGAAVGLPLSGLVAQHLGYHSLFWFIGAGGLLTFVGVLGLVPEAPNRSGGRVDVL
FT                   GAVLLGLGLMAIMLPLAETASWGWGSGRVIGLLVAGAVVLVVLGWVELRTREPLVDIVA
FT                   LRRRPLVLTNIASMLFGFALFASLLGTASYVQAPSETGYGFGASMLVGGLCVLPSGIGM
FT                   LLLAPVSARLVAWRGAGQTLALGAIIVAAGWVVRILVTGALWEIIVGTTVVGIGTGVGY
FT                   AAMPSLINNFTPPAEIAAANGLNTLFRAVGSSLASAIGGSILAAQVMHLGPAALPSLTG
FT                   YRILFGICACAAVLAALAALAVPNRRAEV"
FT   gene            603351..604055
FT                   /locus_tag="FraEuI1c_0495"
FT   CDS_pept        603351..604055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0495"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="manually curated; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; KEGG: sro:Sros_1570
FT                   hydrolase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78578"
FT                   /db_xref="GOA:E3JA16"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA16"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADP78578.1"
FT                   /translation="MPASGSTGMTLVFDADDTLWSNNVRFERVIHDYLDWLAHPTLDRD
FT                   ALYALLLDIEAANTVAHGYGTKVFLRSLHELFERLRDRPADERERREIAELAAALADHR
FT                   VEPMPGVADTLRELGGRHRLALLTKGAVDEQQGKIDASGLAGFFELGTHIVREKHVDAY
FT                   RGLAERLELDPTGTWMIGNSPKSDILPARAAGWRAVHIPDENGWALEHADLDPADQGVL
FT                   RLRSFQDLLRHF"
FT   gene            604283..605179
FT                   /locus_tag="FraEuI1c_0496"
FT   CDS_pept        604283..605179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0496"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: cai:Caci_7474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78579"
FT                   /db_xref="GOA:E3JA17"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA17"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADP78579.1"
FT                   /translation="MATQHPPLPAATRRRRFRLGIALLVSCVALVAWIADLSVSLPMHY
FT                   ETEGWRLAWTGYDVAELGALATTAYCALRDRWALIPASVVTATLLLCDAWFDMALSSGT
FT                   DDFLISLATALLVEIPTATVLLLVAWRLTRRLRDKATDAVQPGAATLDVALRDAAFGAE
FT                   LRAILDGPSIATLAMIGTDGEPHSRVVGLHREGDALLLSIVAPRQPSSDLAKDAQVSVS
FT                   VFDLTNPRTAVEIRGIARLLADGERPGPVALAREAEPTPTPLARTSEPPELLDPADPSG
FT                   IRLVARLFPTAITRLAS"
FT   gene            complement(605302..605658)
FT                   /locus_tag="FraEuI1c_0497"
FT   CDS_pept        complement(605302..605658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0497"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; Domain of
FT                   unknown function DUF35, rubredoxin-like zinc ribbon
FT                   domain-like; KEGG: mpa:MAP3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78580"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA18"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ADP78580.1"
FT                   /translation="MTTSRLDAGDRLLVQRCLACERWTYPEAARCSACGGELGVEPVSG
FT                   DGTVFTFTVNHHPFHPTLPVPYVIAVVQLAEQDDLRVVGNIVGCAPEDVAVGMTVRAAF
FT                   ERHGDAVRQDFRKR"
FT   gene            605816..607015
FT                   /locus_tag="FraEuI1c_0498"
FT   CDS_pept        605816..607015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3113c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78581"
FT                   /db_xref="GOA:E3JA19"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA19"
FT                   /inference="similar to AA sequence:KEGG:MAP3113c"
FT                   /protein_id="ADP78581.1"
FT                   /translation="MTGLPERRAIISGIGISRIGRRTGIPGLDLTVEASRQAIADAGLR
FT                   PEDIDGVATLGDTPVKAACDALGLAPDYLGGGIDTGGLLSPVMSAVVAVGTGRARHVLV
FT                   YRTVQMIGGAVLPDGAAPHLEGAGLGPTPDGDSGSVYPARDGLAGGMDELMGAHAYSAA
FT                   NWLAMHCRRHMHLYGTTKQQLGALAVNSRRNAGLNPAAVFQTPITLDDYLSARPISEPF
FT                   GLLDCDVPIDGSIALVVSVADHATGCEHPVQVEAMGGSTGPGGWYLRPDYPRMASSDAA
FT                   AQLWSRTDLRPADVDFAELYDGFTFLALAWLEAFGFCGEGESGPFVEDPGRIALEGSFP
FT                   INTYGGQLSAGRMHGYWIVHEACLQLRGQAGDRQLGRHRVAAVGAGGGPIAGALLLTAH
FT                   "
FT   gene            complement(607090..610905)
FT                   /locus_tag="FraEuI1c_0499"
FT   CDS_pept        complement(607090..610905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmu:Hmuk_2419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78582"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA20"
FT                   /inference="similar to AA sequence:KEGG:Hmuk_2419"
FT                   /protein_id="ADP78582.1"
FT                   /translation="MSDAVAFNTGLPLAADLRTHLLSQLGAEEEWIGPGPDGTGLLWRH
FT                   SELGTLLELLPVPDGASAVAVLRVTTPVSTIGDPARARALCQRLNAEITLNRWIAGPWP
FT                   AIPDRPDPDADEDEDDEAADHPSLADDPTQPTARVEPAGTIPPATKAKAGPTAEASPEA
FT                   GAAATGADGGPEAETATATEARPEAETGTEAEPGTGAEAGTEPGAPARSADLDLSDRLA
FT                   LEAFLDESTDLDPDALYLSCSFVVGRLEQGDDDEDEDDDPDEDSDDEADDTAPGGAALA
FT                   RLAVAAVGDQIATAVAALGDGLHDEVAGVPFVARDADGEARPGRHRVTRYHDLLHAGAE
FT                   ADNTPLWRALLAAFDGLRYDQESDGGPVWGAGDGRGFRCEVPFSWGPFFTPEDRPVEVV
FT                   TAPEPAPAGLLTSVVLASRQDPRPEAGEGLLITMRTPVTVRPSDDVAGVLTALNIQDAR
FT                   DPGAAHGVGAWVLRGGAPTWTVFLPNAVMAAGTRTTVTLLREVLLAAAGASMLARRVLL
FT                   TGEDLTPADRYPIGPASRRPAGLAFAASSTACDEPALALDALYASLVGPDVEWSVLGSA
FT                   GFDWWPYQGRQRLRVTPRPAPDDRRAGSLRISTEVASKVPASPDVLRLLARRNADDGRS
FT                   ALVLDPVAGTVEAVARVHLGPSLWSPDRSWARLVAVDQLIRADEAASALVGLGGPARGA
FT                   VPAGSAHPTNGPRPSRDILFDALPDIRLGAQEAMNGDDAVRPLVLPITLTALMAPPHRV
FT                   TGHEPGRTLTAEWWTRTYDPSGPAARCRSELTVTDHQDLGLGIRVRTCLDYLPGDVDER
FT                   AAWCNDRNRALLAETSADDLTVVGGWGLDATDAPCLTTWFFPETMLGDHPDEIAGALGR
FT                   LVRYQQWIVFVSLADSPVAPLSDTRTVAELAAGLPSLFGAFRAVLDYPAGLSLTAATPV
FT                   GDDARSETVVVEWTRPVTPPVHEELMSWPRLAEPISEPSRPRLVTRLDAPLDGLRGPLA
FT                   LLLTALAAGSRTWLPDLSVPPDPGRPGAKPLTVPGHLGNAFRDAHVRDALGRLLFDGQI
FT                   ADDGHGTGFLVLAEPLAPGEQGETQPASRSEASATGSLDTADGEASGFGLGADPEFSFT
FT                   ADDEVGLGRRAPATIARLAPPTPGDHPFYGAGTMILDTHLDPGLLRPGDLERLGELSRM
FT                   GQLDRLGTFDDAGVPSGAGRPADDAELTAALIAISTLAPAQTCGAWIAHEKSGTLAYRI
FT                   CLPPSCLLWPAPEAVGSIVDAAWRVAIAQVRAAAHLLSAQAMSPGA"
FT   gene            complement(610898..611947)
FT                   /locus_tag="FraEuI1c_0500"
FT   CDS_pept        complement(610898..611947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78583"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA21"
FT                   /inference="similar to AA sequence:KEGG:SAV_2941"
FT                   /protein_id="ADP78583.1"
FT                   /translation="MSKRPNPTRADLLALLGAQPETSVAAICRSYLSRRRELLASDPDH
FT                   RRPEVARLDDAFTRLRAATDLESRLDDYPCAEVKIGVEDTTVVVRSAPAGTASGEFPFP
FT                   GVERVHVLTAFNPRSRRLRPHENANRQRALAGRVATTGLPSWPAVGGGRQAQTSIAVAG
FT                   LTRARARALGAEFEQDAVVEWTPTALSVVPCDELVAPREFGWRSSRLTKPLPNPAAAAR
FT                   RAEAARAAHAVHAATDTQAADTDRLPATDEARAAADGSGPVSEAHEILVADAVRALAAE
FT                   ESETAAIARARELTAATPTEDSGATPNGTTAGGPTAGGPPAPRKADPAAGGATPDPHDL
FT                   PASHGGNGE"
FT   gene            complement(612339..615752)
FT                   /locus_tag="FraEuI1c_0501"
FT   CDS_pept        complement(612339..615752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0501"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: fal:FRAAL3851 putative serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; PASTA domain containing protein; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78584"
FT                   /db_xref="GOA:E3JA22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA22"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78584.1"
FT                   /translation="MAGGGLPASRCQGLSDVSGIRQKTTKLSPGASSQWDARPSDISLV
FT                   NGGDVDSRGGASRALARPPARATQLPGSPLRPSDPRELDGYQLLRRLGEGGMGTVYLGR
FT                   SPTGRRVAVKIVRAELADDPEYRARFRREAEVARRVARYCTAEVLDAVDPPDGAPYLVT
FT                   EFVDGPPLSQTVSRRGPLGSADVERVAVSVASALTVIHAAGLVHRDLKPSNVLLSQFGP
FT                   RVIDFGVAWAPDSVAVTRDLVVGTPAFMAPEQARGQRVTSAADIFSWGGLIIFAATGRR
FT                   PFGGGAVPAVLYRIVNSDPDLDGLDEGLTEVVRDAMRRDPAERPTAAEIVNRLQALSTI
FT                   RATTPIWVTPPASEPVAAESGALAQAGTAANGAEPNGAAPAADSAGTDAAGSDAASSGA
FT                   AEPVTPADGSGGGLGEDAPAVNAGAAGESAASAESEADAGSSAGAEAAATGVPAADGTD
FT                   AASSDTSDAGAGTPAAGVVSAAAAQDGTDPAANADQAGTGAGSAARTGTAAGSPGADAA
FT                   EDGSQGDSSVGDSSLGDGTLGDGASAADAGAHVSATADDSQGPADDAVSEPGADMAGDD
FT                   EDPPTVGSGPIPVAGLNDDFTFGDLSVWGDDGTELTVGYLARLGSVGEELDDSDDHGFR
FT                   DLDYTDFDSASGLDSDGLEYADFDDGSGGVNRISQRTVTLRGDSPRGPGRTLETLSLNG
FT                   LDDSGRSTWPPPRRRGPLAALARWFPGFAPGGRIPWTTVISAFSVIVALAAVGVAAAAA
FT                   VDSSGRSANATLAAQLTIPNNLVGLSVKEAEARLHAAGFAHLQFEMTPDLKPKGTVLSV
FT                   QPGEGIEIEASDTVTLVVSAGLDSVKIPQVVGLTDSAARSNLQDAGLTVVVRSISGPAS
FT                   VSPGHVAAIFPAAGVEVPPGSSVTILVVVPAGTKSLASVPNVIGMTTNDAQDALHKAGF
FT                   TDIAISSVAASEPAGTVTASDPAANTTTAKNATVTLTVSTGPGQTAVPDVAGRTQADAE
FT                   AALAQAGLVATVRQDPGPSTITAGLVETVDPAPGSKVPVHAEVTITVVSTQVAMPDARG
FT                   RQRADAERLLTSYGLTVTVTQQSSSAAPGTVLTQSTTPGAMIGRGSNVTLVVAKAADSP
FT                   TSPPTSPSPPPTSPPPTGPTSPSPPASATA"
FT   gene            complement(615812..616204)
FT                   /locus_tag="FraEuI1c_0502"
FT   CDS_pept        complement(615812..616204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0502"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_2027
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78585"
FT                   /db_xref="GOA:E3JA23"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA23"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADP78585.1"
FT                   /translation="MKLAQVMVLVDEYDPAIVFFTEVLGFELVEDSPATTNDGRPKRWV
FT                   VVRPPGAETSILLARADGPAQSAAVGHQAAGRVGFFLHVDDFEASYQRMLAANVTFLGE
FT                   PRDEPYGRVVVFLDLAGNRWDMIQPA"
FT   gene            complement(616244..616966)
FT                   /locus_tag="FraEuI1c_0503"
FT   CDS_pept        complement(616244..616966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78586"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA24"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6488"
FT                   /protein_id="ADP78586.1"
FT                   /translation="MPSTSSRTRSLASPPPTAPATRVLAARRPGARAVLPVLALVVGVL
FT                   AGCSSGGSAAPSTPATSSGGPTATSSQVATPRPSPSEAQAPSAPAWPSGPTSKVRSTTP
FT                   PPELVNVTAGHDIADGLSFDRVVFEFTGGLPGYTAQYVNQVLKPGQGTAMALAGQAFFQ
FT                   IVLTPAAAHDAAGQPTVTSPIDGGGLPAVRQIALAGDFEGYVHFGIGLSGVAGYRVTEL
FT                   AKPDRLVFDFAAQATGAP"
FT   sig_peptide     complement(616802..616966)
FT                   /locus_tag="FraEuI1c_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.440 at
FT                   residue 55"
FT   gene            complement(617140..620079)
FT                   /locus_tag="FraEuI1c_0504"
FT   CDS_pept        complement(617140..620079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78587"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA25"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6441"
FT                   /protein_id="ADP78587.1"
FT                   /translation="MTRTPRSGPPAPSSAGPVGTPGSSGLAGLGPLAGPAAAPGDEHAE
FT                   QNGGPRDEPAPSGRARRLTSIAAALALVAVGGAAALGRGSHSVALTLSDGGGWLASERL
FT                   GLLFHVNGPSGQADAAVTLPGAAGHPLTVLTGFARPAAAAPTDAAPSGPAGTRPSASAT
FT                   TPTPSAAAARAPGAAATGAAADLGAGWPSDQAEAVIVVDDLAGTVWLVDPSLLTISASV
FT                   ALPPGAVVLAAAGDAYAVDAATGRVIRLDPRTLAQLGAPITFPAGLGTAAQTPDGTLWV
FT                   PVASAGTVVPVRAGTPGTPVPVAPAGDRLDVTTVAGSAVVVDQTAGTVVRLAMDHADAA
FT                   IRLPDAPATSGAAARLLLPTSTDGQVLALAQPANGELLLADLATGRVSTTTLPAVGAAD
FT                   VDVSALAAATGTGTGAGHQVGAPVSHDGQVYVPDSNAGVVWDFDPKTARFAAPVPVAPV
FT                   GTPSRISLDVQSGQLWINDETGPTVVLVNGASRRTLLKFGAALPGGLRTNTPRPLPPGP
FT                   TPTASQSSSQGGGTGAGGTGSGGRPGLIWPGWTPSSRPGTRGDGGGRADGTGRGTGGRG
FT                   DDRTGAGNGRGGGQPGGQTGEPTGNRPTGPGQPEPPASNTAAPPQPEPTAGQQTPGEPT
FT                   GSGGPGGGQTGGTDQAGAGGGVGTGGSQAASGAGVDGQSPNQAGDGAPGPADPPAAQPT
FT                   TAPAPTGPPSGSAGAPGHPTGPATPTPSPGHAPTPPDQGSPRPPGFWLLTADGTVLARG
FT                   TAQAVASTGADPGAVAIAPTATGRGYWLVDATGAGRPVGDAPAVPAAAGTGTVVAAAAG
FT                   PTGGGYWTVTATGTVVPHGTLTGYGSLLSAPGAPVVGIAATPTGGGYWLLDAAGGVYPF
FT                   GDAEAIAPGAQPTGPATGPQRSVGIAASPTGAGYWTVTAAGLVSAHGGAGGYGSASGSS
FT                   TVVGIAATPSGRGYWLLDTAGGAQAFGDAITTGATAAAGTRVIAVAAAP"
FT   gene            620530..621495
FT                   /locus_tag="FraEuI1c_0505"
FT   CDS_pept        620530..621495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0505"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: fal:FRAAL6439 putative MoxR-like
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78588"
FT                   /db_xref="GOA:E3JB58"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB58"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADP78588.1"
FT                   /translation="MSAELDIFATAFSDVVTNVERVIRGKREAIELAVICLFAEGHLLV
FT                   EDVPGLGKTTLARSLAASVNASSHRIQFTPDLLPSDITGTTVYNQRLGEFGFRPGPVFA
FT                   NLVIGDEINRASPKTQSALLEVMEERYVTVDGTRYPVPLPFMVVATQNPVDMDGTYALP
FT                   EAQVDRFLMRLRLGYPSTEAELEILESRQVGRRVEDLSPVMRAEDVVTHSERTLSVHVA
FT                   PALRRYIVDLVASTRRIPDVLRLGGSPRGSVALLRAVQVRAASTGREFATPDDVKALAA
FT                   PVLAHRLVLSPETELKRVTAEDVVAEVLRAVPSPRRLIGV"
FT   gene            621559..623037
FT                   /locus_tag="FraEuI1c_0506"
FT   CDS_pept        621559..623037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0506"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   fal:FRAAL6438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78589"
FT                   /db_xref="GOA:E3JB59"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB59"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADP78589.1"
FT                   /translation="MPSTGVAAVALSADGLALGGPAAAPKEAPEQRPTVVTRVTPLGVG
FT                   VLATAVVLAAGAFVLRYAELAALAAAALAALLIAAFAVARRPRLRATLRVGPAGVPRGE
FT                   PATLVVELRNPHRRPSPRVRVEIPWSHGARGAVPAAGAAGTIVVDVRRLDGASSRAVEL
FT                   PLDTQRRGVVGFGPVLVRRSDPFGLISSATWLAAADVLRVRPRAVPLGAPPAAPARDPD
FT                   GRTADGAAGGVIFHGLREYVSGEDLRFVHWPSSARTGVLMVREHVEPSEPASTVVLDTR
FT                   PAAYPPGEVGADTFEEAVDVAASVLLGCARESLGVVLLTTAGVRRSGRGRAPETYALLD
FT                   DLAEVDLDPAGTLDVLGTVRRGGVGTLVVVTGGFDDGQLRAVAPVVHRFGQVVVVRVGA
FT                   RSLAAARARSRRTPADRPRLRRASSAPDAATLLGRFDLIGRPSEIGTSVAGRLRVVDIP
FT                   DAARLAEVWPVGSRGRAAGVRSNARAGYFGGGAV"
FT   gene            623525..626515
FT                   /locus_tag="FraEuI1c_0507"
FT   CDS_pept        623525..626515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0507"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: fal:FRAAL6437 hypothetical protein; PFAM:
FT                   transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78590"
FT                   /db_xref="GOA:E3JB60"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB60"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADP78590.1"
FT                   /translation="MPAEPAARRATSLLLVVALALVDGWGFVRLFSAADLRLLVPVAAV
FT                   APVLLVVAASWGRRRPAPFALSALLWTVGFVLVAAALVTARAGGPVARLAEVRTGVLAG
FT                   PTRLLDVAVPAPGDADLLVVPFLVTWLAAALGAELVVRTRTRLLPAFPALLALLAATAA
FT                   AVPGQGSNLAPATALAAVAGLLVLVRRPAALTGTPASTGSAAPTGTAAPTGTAVPGTSA
FT                   GPGGLPDPGPRSTRLADGSAPGPAGGEATPSKPEDGLTPARPTRITLGPGRPSRPLAAA
FT                   RALGALTVVVAAAVTAGAVLPSAFAAGGPVDPRAYRATPADQVAGLNPLSALAGWTTRP
FT                   DDKLFTVRLTGQAAGPVPLRLAVLSDFDGANWTSSARYTRAGQTIPAGRDQPATGGAPV
FT                   TQELTVAGLTGTQLPTLDRPVQVGSATDAGLAADLADGLLLRTAPLTTGEHLTVVSRPA
FT                   PARAVAQLATLTSGTAATAEQDAEYLALPANVPPVLRALARVAAGQGTGPFQQAALLQH
FT                   YLATNFQFDPRVPPGHSLAHVEHFVADTRRGTSEQFATTFVLAARVLGLPARVVVGFTP
FT                   AAPAGAATVTVTGRQALAWAEVRFDGAGWLPFFPTPSAVDARGAALAGSTQGESDAQAA
FT                   LVDAAVRGPLAVPAAVNRPAATAATPSGRAGHLRGLVEWVAAGLGALAAGYVAVALARP
FT                   VARRRRRLSARRSPRERVVLAWEHAVDALLAVGVPVPVSASPAEVVQLGADAVGGERAD
FT                   GRRAGAAGAGASMSALRGLAHLATLALFGPDDGAGRTGAGAVLVAGATVMPVPVPVPGT
FT                   GPIPTHRHGPTHAAGRASRGLPAGRTGPLALPAGRTGPLALPPGRTGPLPLPSGRTGPL
FT                   RSGGTGMGPRSNGRTGPGPEPAANGRTGALALADGRRTGPFGLPAGRTGPLALPGGPGG
FT                   VEPSVAAGAGATGWDGVAGRRAADEARRLALTVEQAAWRSTPWRRRLTSRLSPRAVLTG
FT                   RWPSASG"
FT   gene            complement(626545..627243)
FT                   /locus_tag="FraEuI1c_0508"
FT   CDS_pept        complement(626545..627243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0508"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   tfu:Tfu_1544 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78591"
FT                   /db_xref="GOA:E3JB61"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB61"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADP78591.1"
FT                   /translation="MPKLEHDGEVYVLDLGDGENRFTKDWLVEVEALLSEIEATDGPKA
FT                   LVTVARGKIWSNGLDLDWMIAHTDELTDYLGSVQALFARVLTLPLVTVAALQGHAFAGG
FT                   AMLSLAHDFQVMRADRGFWCLPEVDLRLPFSVGMSSLISARLPARTAAEAMVTGRRYGG
FT                   ADALAAGIVDAIAAAGVTDASEAERAVETTAIEIARPLTGKASPALGVIKSRLYAATVA
FT                   ALHAMEPVSL"
FT   gene            628021..628281
FT                   /locus_tag="FraEuI1c_0509"
FT   CDS_pept        628021..628281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78592"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB62"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6436"
FT                   /protein_id="ADP78592.1"
FT                   /translation="MTTPTSAPAGRGQTAQHADARSGKVAAGPARGRTAEAGEGATDQE
FT                   MTRQVFRQTASDRAVEPFFERERDGAATEVEAAKADADELT"
FT   gene            628750..628977
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0510"
FT   gene            complement(629004..629897)
FT                   /locus_tag="FraEuI1c_0511"
FT   CDS_pept        complement(629004..629897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin1913 peptidoglycan binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78593"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB63"
FT                   /inference="similar to AA sequence:KEGG:lin1913"
FT                   /protein_id="ADP78593.1"
FT                   /translation="MTIGFAMTFVLRTGFSISTTTGFSTTLTAAGAWPLAALGLVDARD
FT                   FIAGAALLAAAGLSLGAGLPADAALPDDAGLLADPALLADPDLLADTDLLADTDLPAGA
FT                   DLAADPGFETDADFGTDADFGTDADFRTDADFGTDAGFGADTDRLPDLDVTAGAGLLAD
FT                   ADLPAGADLPDDADLPAEPDLSAAADLPLVARVVGLVRVAGLVAEVARAVDRAGELARA
FT                   AGLAAGRVDGARAAGFAGFATAVEARGFAVLRGADAAGGAAGRTVPDRFADVALGAGAD
FT                   LPASGLMAPPETVARG"
FT   sig_peptide     complement(629808..629897)
FT                   /locus_tag="FraEuI1c_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.612 at
FT                   residue 30"
FT   gene            629914..630747
FT                   /locus_tag="FraEuI1c_0512"
FT   CDS_pept        629914..630747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_00711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78594"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB64"
FT                   /inference="similar to AA sequence:KEGG:CCNA_00711"
FT                   /protein_id="ADP78594.1"
FT                   /translation="MLRQKVVEKPVVIEIERPVLRRKIVDRPFDVEIEKPVIRQKVVER
FT                   PVVIEIEKPVITEKVVERRVVVEKIVEKPVFKEKIVEKPVVVEKVVEKPVVREKVVEKP
FT                   AGGPGVRPSSGVGADPVRKEPPPVPKAPLTGGAPAHLAPRPTPPPPAGPKPAAPKPAPP
FT                   RPSGLVRPPGAPPAPLAPELAATGRPPAAGSGPRSGPDPNAPRPAQASQPAGGVSFVAP
FT                   TGGGPPDRGGPASGRLDNSTPIADLRSAARELSVNGWARLPKDELVEAIRKVNRR"
FT   misc_binding    631170..631266
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   30.34"
FT   gene            631544..634606
FT                   /locus_tag="FraEuI1c_0513"
FT   CDS_pept        631544..634606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0513"
FT                   /product="glycine dehydrogenase"
FT                   /note="KEGG: fal:FRAAL6434 glycine dehydrogenase; TIGRFAM:
FT                   glycine dehydrogenase; PFAM: Glycine cleavage system
FT                   P-protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78595"
FT                   /db_xref="GOA:E3JB65"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB65"
FT                   /inference="protein motif:TFAM:TIGR00461"
FT                   /protein_id="ADP78595.1"
FT                   /translation="MTENATGTPTLPATSYPVFADRHIGPDPSAQATMLAELGYPTLAA
FT                   LTDAAVPAGIRSGALALPTPIPESAALDELRALAGRNRRVTTMIGLGFHPAVMPGVIQR
FT                   NVLENPAWYTAYTPYQPEISQGRLEALLNFQTMVTDLTGLATAGASLLDESTAAAEAMQ
FT                   LAHRADKAKRSTFLIDADTLPQTIEVVRTRAEALGLDVHVADLRVGLSPIPSPAPGEGP
FT                   VEALPAEPGEEPQEAAGALPADVLADTFGVLLSYPGANGEVRDLRGVIAQATGRRIVVT
FT                   VAADLLALTLLTSPGELGADIAVGTTQRFGLPVMFGGPHAGYLAVRKGLERNLPGRLVG
FT                   VSVDADGKPAYRLSLQTREQHIRREKATSNICTAQVLPAVLASMYAVYHGPAGLAGIAA
FT                   TVHDHAVRLAAGLRAGGVEVVHGSFFDTVLARVPGRAADVVAAALDHGVNLRLVDGDHV
FT                   GISCNEATLDADLTAVWSAFGVAAPDSQAQGALAVPAELVRTSAYLEHPVFHSHRSETA
FT                   MLRYLRRLSDVDFALDRGMIPLGSCTMKLNATAEMAAVTWPEFAEIHPFAPVEQAAGYL
FT                   EMISDLERWLVEVTGYAGISLQPNAGSQGEFAGLLAISSYHRDHTPAGAPARDLCLIPS
FT                   SAHGTNAASAAMAGMKVVVVACDDDGNVDLADLAAKATQHAERLAALMVTYPSTHGVYE
FT                   EGIGEACAIVHAAGGLVYVDGANLNALVGLAKPGEFGADVSHLNLHKTFCIPHGGGGPG
FT                   VGPVAVGEKLLPYLPNHPLRPEAGPATGVGPISEAPWGSAGILMIPWVYLRLMGAEGVT
FT                   AATSVAVLNANYVASRLRPHYPVLYAGQNGLVAHECILDLRQLTKDTGVTVDDVAKRLI
FT                   DYGFHAPTMSFPVAGTLMVEPTESEDLGEIDRFCDAMIAIRAEADKVADGTWPKDDNPL
FT                   RNAPHTAEMVTGDAWDHAYPRSVAAYPVTSLRAAKYWPPVRRIDGAYGDRNLVCTCPPP
FT                   EAFATDLTLTDAAPATLPDARTALTPVGAAG"
FT   gene            634800..636005
FT                   /locus_tag="FraEuI1c_0514"
FT   CDS_pept        634800..636005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0514"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: acp:A2cp1_0593 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78596"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB66"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADP78596.1"
FT                   /translation="MSCEYDAYLPDPLVAREFRFDGRTVADLVDAEHAIVSLNREAIAL
FT                   RGTEVLARMLLRAESVGSSWIEGLEVGGRRVLRAEAGRELGEPVTDVTASEVLGNIDAM
FT                   AYATELVNVGDPITTDGLLEIHRRLLAGSRLQEHGGRIRAAQNWIGGSSYNPCAAAFVP
FT                   PPPEAVPALLDDLAAFCVEDELPAVAQAAIAHAQFEAIHPFVDGNGRTGRALIHMVLRR
FT                   RGLATDVLPPVSLILATRSRDYIQALSRTRFVGPADSEEARASADEWISLFAGACIRAC
FT                   ADVTDFEARIDEIQRGWRERLGEIRPDSTLERLLGLLPAAPVLTVQSAARLLGRSAQTA
FT                   NQAVSRLVDAGVLRQVTVGRRNRAFEAPEAIDAFTLLERRLASPQSDTLTSPPTRRVPR
FT                   RP"
FT   gene            636178..636633
FT                   /locus_tag="FraEuI1c_0515"
FT   CDS_pept        636178..636633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0515"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="KEGG: scb:SCAB_15591 hypothetical protein; PFAM:
FT                   MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78597"
FT                   /db_xref="GOA:E3JB67"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB67"
FT                   /inference="protein motif:PRIAM:4.2.1.17"
FT                   /protein_id="ADP78597.1"
FT                   /translation="MGSIIQGIDGAKALAGQDWGTSNWVEVTQEQVNTFADATGDHQWI
FT                   HVDVEKAKSGPFGGPIAHGFLTLSLIPVLFHDVVQVEGISMAVNYGLNKVRFPAPVPVG
FT                   SKLRAQIKNLTVEDVTGGVQVVNQVTIEREGGTKPVCVAEFISRYFA"
FT   gene            complement(636691..638937)
FT                   /locus_tag="FraEuI1c_0516"
FT   CDS_pept        complement(636691..638937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0516"
FT                   /product="MmpL domain protein"
FT                   /note="KEGG: nml:Namu_0497 MmpL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78598"
FT                   /db_xref="GOA:E3JB68"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB68"
FT                   /inference="similar to AA sequence:KEGG:Namu_0497"
FT                   /protein_id="ADP78598.1"
FT                   /translation="MSGFLRRVGGACAAHPWRVIGTWVVALVLALGLASLSGGTPQDNY
FT                   DTPGLPSQQGTDLLRAGFPQFAGADARVVLHSAHGRLDAAELRAVGGRLRGVQYVDLVA
FT                   PPRLSDDGDTALITVYYDRPVTDVGGKKALDHLETALAPARAAGLGAEIGGQVSENINS
FT                   VDGKAEAIGIVVALAILLAAFGSVIAAGVPLAVAFLGLGVGSAGITLIAAATDVSTIAP
FT                   TLGSMVGIGVGIDYALLLVTRHVEGLRAGLPVREAAARATATAGTSVVFAGATVVLALM
FT                   GLRLVRLTTYASTGFTTAVVVVAVVTSSLTLVPALCGLAGHRLLGRRARRRAARMMAPV
FT                   PGQLESTGRAENAGQAENTSAASPAGGGLTARWAARIGRRPLPWALAALVLLLTLAAPV
FT                   LAMRTWPQDAGSQPTSTTQRRAYDLVAANFGPGANGPLLIVADLRELPRTQLDPLVRTL
FT                   RTTGDIADVQAPIVSADGSTAVIVAEPTVGPSDAKASALVRHLRADVLPPGVRITGWTA
FT                   AFTDISAYLAGRIWVVVGFVVGVSLLLLLVMFRAPVVALKAAVMNLLSIAAAYGVIIAV
FT                   FQWGWGVRALGLPHAVPMSSWLPLLMFVVLFGLSMDYEVFLLSRIREDWKATGDARGSV
FT                   VRGLAKTGRVITSAGLIMIAVFAGFSLDPDVTVKMLGLGMAVAVLVDMTVIRMVLVPAT
FT                   MALLGGANWWLPGWLDRLLPHIDLHGDQATPATETVDLPAPRGKITDDEPAAIG"
FT   gene            639387..641036
FT                   /locus_tag="FraEuI1c_0517"
FT   CDS_pept        639387..641036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0517"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sen:SACE_3289 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78599"
FT                   /db_xref="GOA:E3JB69"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB69"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADP78599.1"
FT                   /translation="MAPAHDLRRARPEPMAPSPHSGPGPAGSQPPSPVGLTSSASAARA
FT                   MMTAAPWTGWLWLGYLGAGAVAAFGYSAVPASGGWLVARMVGGCGIGASSVVAVFVGLR
FT                   RHQPRPRRPWVLIGLSQLLFTSASVVFYAAEFLSADQRILGVSILLYLAHYPVLAAGLL
FT                   LIVRRRAPRGDLPALLDGLLVATGATTLSVLHLIGPGLHEDIPRLVTWTATGYPIADLV
FT                   LLTIGVRLVASAGFRPPAFILLSVSLFAILAADTGYGLRQLHAIYAVGGPLDGIWLAGS
FT                   LALGAAALHPTMAGVAQPSSRPAGLGRARLCGLYLAGIIPPLSLVVPRGAANGVTELVS
FT                   AIAMVISTALIMIRMRYAEVSQRRLANTDVLTGLCTRRFLETRLALASVRASQPGATLA
FT                   LLLIDVDHFKAVNDRFGHPAGDRALAEVARRLREVARSADVVARYGGEEFALLTTYLGQ
FT                   DDLYVLGERLRLAVAASPVAVDDGIVLPVTVSVGAAATTLPASPAELIDRADRALYAAK
FT                   SAGRDCCVLASPAPQPDAGRAAAEAHCSSSAA"
FT   gene            complement(641083..647166)
FT                   /locus_tag="FraEuI1c_0518"
FT   CDS_pept        complement(641083..647166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0518"
FT                   /product="pentapeptide repeat protein"
FT                   /note="KEGG: sro:Sros_2975 WD40 repeatdomain-containing
FT                   protein-like protein; PFAM: pentapeptide repeat protein;
FT                   WD40 repeat, subgroup; SMART: WD-40 repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78600"
FT                   /db_xref="GOA:E3JB70"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB70"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADP78600.1"
FT                   /translation="MWGESAPTAGEVRRIFLSVAGPDERWGSWLDHVLRDAGYEVDFYR
FT                   RSFPLGANFVDQIDAALTRADRMIAVVSPAYLDRSSWVREEWQAGMRLAHTRDGFLLPV
FT                   LVEQCDLPPLLGTINMIVLLGLDRAKAVQTVLRGLVEPATGRPEPEHEPPFPGYEIAGP
FT                   AQRLALPAGAAALPALMAGPPEALGPTMPALGPTTPTPGFTASTPGFTASVPALPEPRA
FT                   DATLAAADRGGERTSITLLHLPALAAPTRPGHAPDTGPEPFGAPLLDDLAVLAASPGLT
FT                   PDLVVVTGVALEGRRGEYEQAAVRLALLADRLGLPVDRIALVPGRGDVSAAAARAYFAA
FT                   CEDEEIEPTAPYWRKWRHFVDFHANLYRELGERTFAVGQEWTLYPMADLRLVVAGLNST
FT                   MAMSHLQADDRGEVGQAQARWFADRLAGYERAGWFRLAVGHHPPLAADRVHSAKATDAY
FT                   GVDLILGGHVNLLLAAHGHGAPTPDGPLPAVPTRLPRSGTTLISAHPPHPVPTADTALR
FT                   YQILRISRAEVTRLDRRFSRRAGAWRPAEEVGAAGTVTYRTRWEHAATTFPRPTRRPPA
FT                   IEGPGSAGKAAARSSNGRKPTGEHRTDDPDSADGPGPRRGETFADRVAEIAELSSPGAT
FT                   ITRISPTGVAPEYLRVTVPHGPVFEQRPVGIAEDGVDESAVDRFVEHVHRQYAATDPQL
FT                   TSDLVYGGPLPAPDELVRQASVRGVRLRSFVEYQGLLDLRGYLRRQSDRLAADRLYPPA
FT                   LYLPQRFRVIDGGPVTADPTDAAPADTTPADTMLDGTLNGMVPTGDGSTDQASGPDGGD
FT                   LLGQLVDWLTADSARFVLILGDFGRGKTFCLHELARTLPERRPHLIPLLIDLRAMEKAH
FT                   SVDELVAAHLVASGEQRVDVSVFRYMLRRGRLVLLFDGFDELALRVTYETAAEHLGRLL
FT                   DAVEGQAKVVVTSRTQHFLSHGQVRGALGARVELLPASRIAEVGDFTERQIEEFLVRLH
FT                   HGDAARARERLELIHDIRDLLGLSHNPRMLGFIASLDTNRLRAVQARTGVISSADLYGE
FT                   LIEEWLRYEERRARPPGAGPALTAGERREAVTALALRLWRTTDQVINLSELTATTSTAL
FT                   DAMTDRVDAGQLDSSQAAHMVGSGSLLVRADDGGFTFIHQSVMEYLVAAAAAQRLADVD
FT                   DLGGGGDVLGARVMSPLMVDFLRGVAGDAAATAWARRALAEPEAGQAPRANALAIARRA
FT                   DPTAARGARLGGAHLEGADLTGLDLSDADLAGANLTDADLDDANLTGANLTGARLTGVR
FT                   ARRLRLTGANLTDADLRRARLTDPDLTGTVLTGSKWERAALLGATPPDRARTAPELAAA
FT                   AVPGRDPVEVVIDSGLRWTQALSPSHDLLAYGTGHHVALEDLADGHVLAVLRGRGEWIR
FT                   AVAFSADGSRLAAGDVAGGIQLWDVAAAEEVASFVGHASRVRALAFSPDGSLLATGCWE
FT                   GRVHVWDLATLTRVATLHKSADRIKTLQFSPDGTLLAYGDEVRLWDVRTRSDLSVLGKP
FT                   TEQARTLRFSPDGTLLAWVNGENTARVWNLAAGREVGRRRGDHHFARALAFDPSGSLVA
FT                   IGADDGTIRVWDLAGDSLRTTLRAARGWVTILEFVGAEGKALIAGTRDGTVQVWKVTDG
FT                   APPGRTLLTGRTADVLATAFVPEQSLVAAASENGSLRLWDTRTAAQVHIGSGEKAWCYA
FT                   MSLTDDATLLAAGGGDGLVRIYELSPGRAGDGRSDLDTPVRRLNTRRTPVRALAFSPDT
FT                   TILAVGHPDGTVGLWNPWTGHPMATLKAGGLRVLTVAFSPDGERLAAGTDTGTVHVWDA
FT                   VGARGGSAAAARRLVGHSDWVNAVAFSPDSELLASGSGSGTVRIWDAATGVLRNRLVGH
FT                   GGRVRTIAFAPDGRLLAAGGEDGIVRLWDPGTGSELARLAGHTEEIRSVAFNAAGDVLV
FT                   SGGADGTARLWQVGDSHRSDGSRELATMLGLAGNRWTALFPDGSYKTSEDRDADSVRTV
FT                   WWSIRLSRFDPDELTPYLPRIRRRPLEAPLATPPS"
FT   gene            complement(647258..648211)
FT                   /locus_tag="FraEuI1c_0519"
FT   CDS_pept        complement(647258..648211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_31631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78601"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB71"
FT                   /inference="similar to AA sequence:KEGG:SCAB_31631"
FT                   /protein_id="ADP78601.1"
FT                   /translation="MVYNNYPRGWNGGQTGWQYHPGWNAPASPVSPRYTVPFFGLPAPR
FT                   LGWRVVYADNRGNFLELPPGEKLDKVIWRNYYFVDNQTYGLNIETESASSANTSRFRLV
FT                   VAARWCIYSPIEFLRAPLAPVGHCDRITRSILSDITRSIEPGSARLVQDLIDAKRGVGF
FT                   TIGSGLVVWIDNVIVHPPAGFEELQGELEQGRAQIDVDRLRRLRRNEQRVDDLDYDAAQ
FT                   RETERGVRRDRGAAFLDRADEGAQRGAPVDGFRPRAELVAGDDHLFDPEPAQADPGEAD
FT                   KDAPTRPAWPEPPAADIPSASIPDPPWWDQQPDAGS"
FT   gene            complement(648201..650459)
FT                   /locus_tag="FraEuI1c_0520"
FT   CDS_pept        complement(648201..650459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0520"
FT                   /product="apoptosis regulator Bcl-2 protein BH"
FT                   /note="SMART: apoptosis regulator Bcl-2 protein BH; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78602"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB72"
FT                   /inference="protein motif:SMART:SM00337"
FT                   /protein_id="ADP78602.1"
FT                   /translation="MFGAALHAARVVFKVSGGNLNFGSQFTGTAGAAGAGSGGVPGIIS
FT                   QPELARVVGAFVAAPCHGQLYKKLADNHLVVLRAAPGWGRTATAEYLLYECLTTSSGHP
FT                   PSPVPRGLDLHPAAVAQVRISRLNASTDLRGLTSDHLRPAGDEENPQPGGLLLDVATPH
FT                   GAGLLRGSDLERLANVLRANRDYLVVTVDAGTVFGDELDEFLIDADEPPPAIRVVARHA
FT                   ARRLGRPYPDVLDEARESTELSGLVDQLVGEGYSAAGLAQLGRIWAEQGSERGSQKATD
FT                   TLRQWVTDFIEARFADWLAAPGQDPEHRAFVIALAVFDGMPYAKVTRLARDLEDRMLIA
FT                   SRRFLRPAPLETWGFDPAPHERSDPYASQPLFTRPRSGRLAAASAEVRVGTETTRYGST
FT                   ETEVVAFTCANYPSRILFWLWTEQDALHSVLLRWLAALGEDTDPAVRAHAAAAVGVLAS
FT                   WSFDEILLRVLLPWADDDLPWQRGAVAAALSLALDWRPGLAPVVIEMLRDWKMHTQHPA
FT                   RRLAAIRVWGTSLGPFDPDVALDQLAYLMAPLEDAEEDENPEDVDLNVIDNVSLSVFEI
FT                   FSAPLIAVHGETDRPTRPGGATDAVLRRLGVWTEPGSGPTQRFAGILAFLRLALHLRLG
FT                   VDSPGQGSPALLTLCMPGRGDRLTLRRIAELWRRALDEPATNQLALDCLRQWTADTEAD
FT                   DDLARTTFAHLVWESLRSRADFDRLQREFRRWEKRWPRTCQVVLATIERSTNGDSGGL"
FT   gene            650941..651912
FT                   /locus_tag="FraEuI1c_0521"
FT   CDS_pept        650941..651912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78603"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB73"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0801"
FT                   /protein_id="ADP78603.1"
FT                   /translation="MTQQLSDLELRTLAEVYFDRWAGGELLKRAGLSPADQPQGAGIVL
FT                   DFWRQVNASLGAGILADGRRRILAAAAADYPANEVFRRGLSDAATSGRPGGDPATPVSR
FT                   GDLASEPDEAGGAGATLRAARMEFKVSGGNVNFGHQGRVVGSSAPVSSREGLDARARSQ
FT                   RHPDSGSPDRTAPDVLVLADAEDESWGQWVAWHLHADGYRVELDDWSQYLADQAGLLLA
FT                   DAVRATSLTILVRGHGDPVWSASYFQLAGFQELAVKKRGRIVGVRVSAHAADVVPMDGV
FT                   TFVDLVGLGENESAARLTAAVRRLLTGWEPTAVKPAFPGDGP"
FT   gene            complement(652078..654411)
FT                   /locus_tag="FraEuI1c_0522"
FT   CDS_pept        complement(652078..654411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0522"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: fal:FRAAL6427 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78604"
FT                   /db_xref="GOA:E3JB74"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB74"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6427"
FT                   /protein_id="ADP78604.1"
FT                   /translation="MFARLARGVTGRPRIVLTVALLFVLGAAVLGVGAFGKLLSNGFDD
FT                   PKSDSTRAANEVDTRFGGTPNLVLLVTARSGSVDDPAVAAAGRSLAAELGKEPGVRGVV
FT                   SYWTGAGAALRSTNGREALVVASVDDDHAKAVATKIEKAADDGPVTVRPGGRAGVNRDV
FT                   NAQVTKDLSTAESIAIPITLVLLVVAFAGVVAAALPLGVGLIGILGGFAALSVIGSLTD
FT                   VSIFAVNLATAMGLGLGIDYALLMVSRYREELAAVRRGSAEPLTGIQKRAAVIATVRTA
FT                   GRTILFSGATVIVALAVMLVFPPYFLKSMAYAGIAVTLVTMLTAVLVLPAVLLLLGERV
FT                   NALPVRGLIGLVRRQRTAERGAASDVPREATESPFWRGVATRVMRRPLLAGLPVVALLL
FT                   LLAAPVLHVSFATPDDRVLNAAPSRQVGDVLRADFGSNVSGAMNIVVNGPTSEATLTSY
FT                   AAALSRLPGVGRVDSAAGAFQHGARTSPPGPADARFAADGATYLQVVPSIDPMSASGER
FT                   MAHAARALPAPPGTQVLVGGVSAGLVDGKHAIGSRLPLAIGLIALATFVLLFLFTGSVV
FT                   LPLKALVLNGLVLGAVLGVSVWIFQDGHLSGLFGFTPGPLDTSMPVLLFCIAFGLSMDY
FT                   EVFLLSRIKEEHDAGTPNAEAVAAGLARTGRIVTTAALLLAVTFAAFATGSVRFMQMFG
FT                   LATALAIVLDASLVRGVLVPAFMRVAGDVNWWAPAPLRRLHNRIGLSEGGPAAGPTAPE
FT                   TVAVPRPSAEPDLGLTEKSSSTAS"
FT   gene            654529..655305
FT                   /locus_tag="FraEuI1c_0523"
FT   CDS_pept        654529..655305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0523"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6428
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78605"
FT                   /db_xref="GOA:E3JB75"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB75"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78605.1"
FT                   /translation="MNPLAPRRERLRAATIAEIKQAARDQAATGGVGAISLRGVAKAMG
FT                   MAPSALYRYFDSHDVLVTELCADAFASLADALEAAYVVERDIDHARRWLSLARAYRRWA
FT                   HEHETEYILLFGPRSTLDLDDKSGRCGAEMRRAVGVLFQCMITEIAAGVIDPSHLDAGL
FT                   KPELRERLAAWGVEEGAPISSAALAGCLIVWTQLHGFLSLELFGHLPPILGDVSDLYDQ
FT                   QMLDVIVRIGYREPIDLAAVTAPGPDPVTVATGSGV"
FT   gene            complement(655325..656395)
FT                   /locus_tag="FraEuI1c_0524"
FT   CDS_pept        complement(655325..656395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78606"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB76"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6429"
FT                   /protein_id="ADP78606.1"
FT                   /translation="MQTLDPTTLDLDAIEEDRLAKGITLSLLIPARGPESANTLGNMIA
FT                   GIRDRWMRDRHVLDEIGVVVDPTSDGDEHGLVEIAEEAGASWAVRGEAVLARHAGPESA
FT                   AFGGKAGAMRSLAYLAFGSRLIFHDSDLENYDPVTVGRLAAAMTTDEGLMFVNGASPRL
FT                   TGSGQPGGRTTEMLRSLYAKQLSGYVPAITSTVQPLIGEFALDADVFAALAFSRGYGVE
FT                   TSVKVLAMDLLAPEEYAQVELPIKYQVGQHYHDLVKQFHEISFTVDVLEAFFQRRRTDP
FT                   LATVCEIADDYGLLFPGRQYALRRPPGYDQVDFVPRLGFYPPLASSPAYQARMPEIAAA
FT                   RHAALDSLGRKMRTSA"
FT   gene            complement(657137..657646)
FT                   /locus_tag="FraEuI1c_0525"
FT   CDS_pept        complement(657137..657646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0525"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: fal:FRAAL6416 hypothetical protein; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78607"
FT                   /db_xref="GOA:E3JB77"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB77"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP78607.1"
FT                   /translation="MTPVPRAESKGELVSVDVVRRAGSTTPQATHILAELPYLPSAVPR
FT                   ARHVLRESLRSAGLDEDATAVAELLVSELVTNAVKYGQPPVWLLVELRPGLVHASVSDT
FT                   STSLPERRAVDDDSEGGRGLLVLDALAGSWGAVTADHGKYLWFDLVVTPAPATEPDPGK
FT                   PGVSAA"
FT   gene            complement(658123..660564)
FT                   /locus_tag="FraEuI1c_0526"
FT   CDS_pept        complement(658123..660564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0526"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="KEGG: fal:FRAAL6415 putative regulatory protein;
FT                   PFAM: Stage II sporulation protein E; ATP-binding region
FT                   ATPase domain protein; SMART: protein phosphatase 2C domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78608"
FT                   /db_xref="GOA:E3JB78"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB78"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP78608.1"
FT                   /translation="MDGAGLDGRPPHHTITLPPAAESPRSARRFLLSALRGTVDEDTLD
FT                   SALLLVTELVTNVVVHAGTPATVDVTAEPVGELTIQVRDLHPVRIGAARHRPGNGGSDS
FT                   ANDPFSESGLGGLREDGRGLALVDALASSWGTAHGAGGKSVWFRLTAAAQPAPDEPGEP
FT                   LTGSGNVPQDGPSGPDTDVTLDTSTPTSTATVAASTPRQAGSGERTGAEAARAGAVPAA
FT                   NPIAGPTLPTAVPTDPPPPAAFPPGHGTNGSGPATTHTATTGAEGGGPGRRAPVLLDKA
FT                   PAGPVPRVPRIVSRSTARALTAEGEVAELLAQLVDTQPVTGGLVHRPSQDDPRPEVVAS
FT                   LGGLGDAGAAVAIPLDPTQDTLGEVLLWPDPTQPGYLGQPGAVDLERVELVARWMALAL
FT                   GGGDMRQAEERRIGMLSFLAEASDLLAGSLELEHTLSMLAHLPVPRLGRWCAVYLRRDD
FT                   GNPTLAAVAHAEEAAEPALSDTATDLTGPLMIAVRGAGTTPVRQVSTPDGPVLVAVLRA
FT                   RRRVLGMVAVGRDVGGSFTADDADLLADLARRAAFAVDNARLYSRQVELADGLQAGLRP
FT                   PVLPEIPGLDLGAAYGAAQSAGLDVGGDFFDLMPGPNGWTVAIGDVCGKGAEAATVTGV
FT                   ARAVLRLLTGQATPVGQILGDLNRTLRDTATAYPHGQPRFCTLATASLAEPTQRGVHLV
FT                   LHLAGHPQPVLLRADGTASYVGVPGTLLGVLDDDEVTFPSVDVELCSGDALVLYTDGVV
FT                   EARAGRELLGEQRLLEAVVDCAGLSAQGIADRVRAAADRFAGGNLRDDVAIVVLRTPAS
FT                   G"
FT   gene            660679..664956
FT                   /locus_tag="FraEuI1c_0527"
FT   CDS_pept        660679..664956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0527"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /note="KEGG: fal:FRAAL6414 putative two-component system
FT                   sensory histidine kinase; PFAM: ATP-binding region ATPase
FT                   domain protein; response regulator receiver; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; histidine kinase A
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78609"
FT                   /db_xref="GOA:E3JB79"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB79"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP78609.1"
FT                   /translation="MSLDRDHETPDARQDDGALPGSSTSPKAGSAVAGHPGTTDGAQPD
FT                   TMTTTNGPAPNGGPGSNGEQVAEVPAAGNGVATGLLDPPGDGLGSGGGPVSVDMLLSDL
FT                   LAGLSGLCDGDFTVRLGHRDGLGGEVARRFDELAATQERHSRELERVSNVIRRDGRLTQ
FT                   RMDDLGGRDGWRSITRSVNSLIDDLARPTHEVGRVIAAVAEGDLSQHMPLEIAGQPVRG
FT                   EFLRIGTTVNTMVDQLSSFADEVTRVAREVGTDGALGGQANVKGVSGVWRDLTESVNSM
FT                   AGNLTTQVRNIALVTTAVAQGDLSQKITVDAQGEIAELKSTVNTMVDQLSAFADEVTRV
FT                   AKEVGTEGRLGGQAQVKGVSGVWRDLTDSVNVMAGNLTTQVRGIAEMAAAVQRGDLTRQ
FT                   ITVDARGEVAALAHTLNTMVDQLSSFADEVTRVAWEVGTEGNLGGQAHVRGVSGVWRDL
FT                   TESVNSMAGNLTAQVRNIALVAKAVAGGDLSQKITVTAQGEIAELKETLNTMVDQLSSF
FT                   ADEVTRVAREVGTEGNLGEQAHVRGVSGVWRDLTESVNSMAGNLTAQVRNIALVTTAVA
FT                   NGDLSQKITVNAEGEIARLKDTVNTMVDQLSSFADEVTRVAREVGTEGKLGGQATVTGV
FT                   AGTWRDLTDNVNQLASTLTTQLRAIGDVSTAVTRGDLTRSISVEAEGEVAELKDNINQM
FT                   ITRLRETTDLNAQQDWLKSNLARIGSKMQGQRDLYAVCQMIISEMTPAVNAQQGTVYLL
FT                   DFIEGDKLRYVAGYGSVPRRRSDGTFLFGEGLIGQAAVEKTRIRVEKVPPGYLTIRSGL
FT                   GSAPPSDLVVVPVLFENQVLGVIELASFTPFSDLHLTLVDQLVDTIGVVLNTIMANART
FT                   EELLAQSQRLTQELRSQSVELQRTNAELEEKAQLLEEKNTEIEQARTGLEEKAEQLALS
FT                   SQYKTEFLANMSHELRTPLNSLLILAKLLADNQDDNLTYQQIEFARTIHSSGSELLMLI
FT                   NDILDLSKVEAGKMDVEATAVGTAAMCDALAQAVRPVAEVKGLTFEVQVADDVPAEFVT
FT                   DEQRIQQVLRNLLSNAVKFTDSGTVRLDVTVASSDGPFIVPSLRSAPTVLSFAVSDTGI
FT                   GIATDKLRMIFEAFQQADGTTSRRYGGTGLGLSISKEIARLLGGSIAVSSVLGQGSTFT
FT                   LYVPSVMPADQPFYGPIPGEPDDVLIIIGGDGALSTAGVPYGSPLQALGSGTGGDPWIA
FT                   DPAQAAPFTGSAPVAAPAGTPELGAPWHPTGDLVGAGASRPKLESSIPEPVGTPFLTET
FT                   SRPRRELGPDEVDPLQGATVLVVDDDVRNVFALTSALEMFGMRVQYADNGHDAIRLVQQ
FT                   ASVAIRLVLMDVMLPGMDGNETTSTIRAMPAFADLPILVLTAKAMPGDREKSISAGASD
FT                   YITKPVDLDHLLSVMRSHMSDRP"
FT   gene            665195..665836
FT                   /locus_tag="FraEuI1c_0528"
FT   CDS_pept        665195..665836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0528"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: fal:FRAAL6413 two-component regulator; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78610"
FT                   /db_xref="GOA:E3JB80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB80"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78610.1"
FT                   /translation="MTERTGGPVDPGGGPSTERPRSKILLVDDRPDNLMALEAILASLD
FT                   QELVTASSGEEALKRLLVDDFAVILLDVQMPGMDGFETAHRIKQRGRTRDTPIIFLTAI
FT                   DREPHHAFRGYAVGAVDYIAKPFDPWLLRAKVSVFVELFEKNERLGELVHQRGQDFDLM
FT                   TEVAERLIALDVLLEGARDASPEEIIAAAGAEVRGLVARMSPFARSTPTT"
FT   gene            complement(665994..666425)
FT                   /locus_tag="FraEuI1c_0529"
FT   CDS_pept        complement(665994..666425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0529"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   fal:FRAAL6408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78611"
FT                   /db_xref="GOA:E3JB81"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB81"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADP78611.1"
FT                   /translation="MSTSPRTGGEVDPTAGRNPPTGQNPVASTEPGPGADPAAGATSAV
FT                   AEPAPPHGYSHHREDYLARLRRVEGQVRGLQRMVSDDKYCIDILTQVAAVTRALQSVAL
FT                   GLLEDHLGHCVADAAAEGGPVAEAKLREASAAIARLVRS"
FT   gene            complement(666549..667298)
FT                   /locus_tag="FraEuI1c_0530"
FT   CDS_pept        complement(666549..667298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0530"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: fal:FRAAL6406
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78612"
FT                   /db_xref="GOA:E3JB82"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB82"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADP78612.1"
FT                   /translation="MTDTETATATSGATNGPAVFGTVDAEPYAWPYNGTFTAATTAVIN
FT                   IDWQVDFCGKGGYVDAMGYDLELTRAGLAPTARLLEALRPLGFFIIHTREGHRPDLSDC
FT                   PPNKLWRSKNIGAGIGDEGPQGRILTRGEPGWEIVDEVAPLPGEVVIDKPGKGSFYATD
FT                   LNLVLNRAGITHIILTGITTDVCVHTTMRDANDRGYECLLLSDCTGATDYGNYLAALNM
FT                   VKMQGGVFGAVATSDALLASVGAPVNA"
FT   gene            complement(667556..668731)
FT                   /locus_tag="FraEuI1c_0531"
FT   CDS_pept        complement(667556..668731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0531"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: basic
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78613"
FT                   /db_xref="GOA:E3JB83"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB83"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ADP78613.1"
FT                   /translation="MRFRFRRATVACTALAAALTLAAAGCSSAASHDSTTSGASGSSAP
FT                   GKGSKAVGFIFVGPKDDYGYNQAAYEGSQEVKKAFPDLQVITAENVPEDDNAARVMDSM
FT                   IQKGAKIIFATSYGHLDAALKVAAEHPDVVVVQQGNVIANGKVTANVGTYFGTVYEPVY
FT                   LAGIAAGKATKTNKLGYVYAFPIPQTIANIDAFELGAKSVNPAAKTYTVNTSNWCDPAK
FT                   QAQATQSLLSQGVDVITQHQDCTATVIKATEAAGAYTVGYHADASSLAPKGWLTGSQWA
FT                   WGPLYTDIVKTAEAGTFTGSKYNANYRVGYKNGENPFIQSPFGPSVTQETKDAIAAAKT
FT                   KISAADGSPFVGPVTDQDGKVRIPAGTVPDYATLDTIDYFVDGVVGQLPKS"
FT   sig_peptide     complement(668636..668731)
FT                   /locus_tag="FraEuI1c_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.809 at
FT                   residue 32"
FT   gene            complement(668925..669842)
FT                   /locus_tag="FraEuI1c_0532"
FT   CDS_pept        complement(668925..669842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0532"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   drm:Dred_2174 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78614"
FT                   /db_xref="GOA:E3JB84"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB84"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP78614.1"
FT                   /translation="MSNLAVDVLSGAVGGGTAIMYAGLGETISERAGVINLGTEGSMLG
FT                   GALAAYAATATSGSAWVGVLAGIGAGAALSAVHAILVIARKANQFASGLTVMFFALGLT
FT                   SLFGAAYVGRQIHALNPWKVPGLASIPWLGPILFDHDPLTYLSYFVAPAVWWVLYRSRV
FT                   GLLVRTAGEHSEVLLVHGYSTSAVRYVSVIVGGGLCGLGGAQLSIAYSNAWFENMTVGR
FT                   GFIAVALVIFATWNPLRVMAGSYLFGAALALSPALQARGYGINQFALDAIPFVVTILVL
FT                   AILGKRTLLAAPDELRRVFETRTT"
FT   gene            complement(669839..670975)
FT                   /locus_tag="FraEuI1c_0533"
FT   CDS_pept        complement(669839..670975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0533"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78615"
FT                   /db_xref="GOA:E3JB85"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB85"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADP78615.1"
FT                   /translation="MTDTTIPAQFSPDEGGTVLTKATTPVGPVVAAPAESRLAGAGRAT
FT                   ARWALALAGAIAIFTVLLLAKGANPASVYANVWTSTFTNSQSIEQIFIKAAPLLLGALA
FT                   VVVPARAGLVNVGGEGQIVIGAVAAGGIGISLGDKLSGGLAMLLMAVAAMLAGAAWAGL
FT                   AAVLRLTVGINEAVSTLLLNYIALDVLLYLIYSPWKDPHGTGQPTTAELADTAKLPYLG
FT                   TTSVHIGIVFALIATAVVWALLRYTTWGFRLRVIGGNPEAARRAGLPVAMLLLSAMLVG
FT                   GALAGLGGMVHYAGVEYKLRTGITTNFGYIAFLASWLARHNPVSVVVAAVALAAITVAG
FT                   DSLQLDSGLPAATVNILMGLVLIAVLGWTARRKNGTAR"
FT   gene            complement(670972..672612)
FT                   /locus_tag="FraEuI1c_0534"
FT   CDS_pept        complement(670972..672612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0534"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rca:Rcas_1634 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78616"
FT                   /db_xref="GOA:E3JB86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB86"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78616.1"
FT                   /translation="MSAVTATAPDGQTATAEPLLRVTDFTKRFGEVLANSDVSFDVRPG
FT                   EVHALIGENGAGKSTLLKLIYGMYKPDSGELRVAGEQVAVGSPTQARALGIGMVFQDLR
FT                   LVPAFTVTENYALALATSGITIRQAELRRRITEASETYGLAVDPTALVRHLSIGERQRT
FT                   EILKVLMSGARIVILDEPTSVLAPTEVEALFAMVNGLRAQGLGIVIVTHKLAEVRAIAD
FT                   RVTVLRGGRVVLSGVDPKPMTDAELIEAMVGQTVAALPAERPTVTSDAPPALELTDVSA
FT                   LGDRGVTALRDVTLTVNPGEIVGVAGVAGSGQRELCEVAVGARSVSAGTVRVNGRELGR
FT                   GGPTAGIAAGAVDVPEDPVNDAVVPTLTVLEHMALSHLKAFLRRIGVDWRRAGKHTTDI
FT                   NEKVQLRMAPAHRRVADLSGGNIQRVMLSRALGREAPLVVAAYPSRGLDIATTRRTQEL
FT                   LLARRAEGAGLLVVSEDLDELMAVADRIAVFCAGRLTGVVAAATTNRQELGALMTATGP
FT                   ATDQPADTTPAAAAASGTQTDAQTGGEQS"
FT   gene            complement(672917..673726)
FT                   /locus_tag="FraEuI1c_0535"
FT   CDS_pept        complement(672917..673726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0535"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: fal:FRAAL6405 putative transcriptional
FT                   regulatory protein; PFAM: GntR domain protein; regulatory
FT                   protein GntR HTH; SMART: GntR domain protein; regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78617"
FT                   /db_xref="GOA:E3JB87"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB87"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADP78617.1"
FT                   /translation="MTPTQPPTARPSSAQPTAGRPSTAQAPTERFTPRPPSARNATTGN
FT                   LREHAYVGLRQRLMAGEFSFRDRLTEERLAALLGVSRTPVREALTRLAGDGLVEKRLDG
FT                   GYYPAEPDLDGLRDLYEIRVVLELHSLERALESGVPHDPALLEPLRENWEALRQAPPDP
FT                   DPSFVALDEGFHLTLCRASGNVELANMLDAINARIRPVRMHDFLTEDRIHMTIEQHLDI
FT                   VETVLGGDLPEAVRKLRNHVGESMEVVEKRAASAITQMALRRGRSPR"
FT   gene            674175..674939
FT                   /locus_tag="FraEuI1c_0536"
FT   CDS_pept        674175..674939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78618"
FT                   /db_xref="GOA:E3JB88"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB88"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6404"
FT                   /protein_id="ADP78618.1"
FT                   /translation="MGTITARTTPAPSFLLLHGAATTGAIWAGVRRALGDRPAFAPDRP
FT                   SSGDLDSELAAVREAVALAAAATPAAARSVDAPAPPRLAAGAAVTTTREGPRAVVFGGV
FT                   SGGATLGLAALATGVPLAAAVLHEPAVGSLLPGLLAPMAAAYASGGVAAFASALYGPSW
FT                   RPTDGPADPDAVARDLSMFLRFEPAAPGPTPGPVVVTVGERSPEIRHRAAAALHRELGL
FT                   EVRVLAGCGHAAHLEAPAQFADLLAEIAATLG"
FT   gene            complement(675007..675294)
FT                   /locus_tag="FraEuI1c_0537"
FT   CDS_pept        complement(675007..675294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0537"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: mkm:Mkms_5487 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78619"
FT                   /db_xref="GOA:E3JB89"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB89"
FT                   /inference="similar to AA sequence:KEGG:Mkms_5487"
FT                   /protein_id="ADP78619.1"
FT                   /translation="MTSENEARNDSPVVDAAARPAGGSGPGPGPGSGEAAGPSATTRSA
FT                   AAGARPRLRPSDLDWDNEPVHGLDPEDSRAGRADNLARLLDDVPPHHVDH"
FT   gene            675421..675651
FT                   /locus_tag="FraEuI1c_0538"
FT   CDS_pept        675421..675651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78620"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB90"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6400"
FT                   /protein_id="ADP78620.1"
FT                   /translation="MSAVDDGEQLVGIGDIAFQLKITRQAVDYWTRKDPRFPDPVQVIN
FT                   APAGSGAKGTRVWRKREVDAWIVEHYRRRKP"
FT   gene            complement(676055..676405)
FT                   /locus_tag="FraEuI1c_0539"
FT   CDS_pept        complement(676055..676405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0539"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: scb:SCAB_53081 hypothetical protein; TIGRFAM:
FT                   regulatory protein, FmdB family; PFAM: Putative regulatory
FT                   protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78621"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB91"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADP78621.1"
FT                   /translation="MPTYQYRCTACGNDLEAVQSFSDAALTECPVCGGQLRKVFSSVGL
FT                   VFKGSGFYKTDSRSGSSATAPAQRKDGTADTGSKEAPKTDAASSPSTTSPAPAAAPATS
FT                   GSTSATSSASAA"
FT   gene            complement(676710..677405)
FT                   /locus_tag="FraEuI1c_0540"
FT   CDS_pept        complement(676710..677405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0540"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="KEGG: fal:FRAAL6398 putative ligase (partial match);
FT                   TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78622"
FT                   /db_xref="GOA:E3JB92"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB92"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ADP78622.1"
FT                   /translation="MGEQDADDAIARAKSDLRRALAACRRGVGPRPGPGPVIGLPGSWA
FT                   ASDREPAGPSPSIQTGAQPRAQEAADGAQIARRVLSLPEVTAADRIAAFVSLPGEPSTL
FT                   PLLDTLRARGVHVLLPAVRGDLDLDFREYTGTLVPGALGTREPPRAAATVDLASADVVL
FT                   VPAVAVDPRGHRLGRGGGSYDRALRRVRDAATLVALVDEHAIVEAVPVAAHDRSVSVIV
FT                   TPTRLLRCR"
FT   gene            677668..678588
FT                   /locus_tag="FraEuI1c_0541"
FT   CDS_pept        677668..678588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0541"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="KEGG: fal:FRAAL6397 UTP--glucose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78623"
FT                   /db_xref="GOA:E3JB93"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB93"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ADP78623.1"
FT                   /translation="MPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEAA
FT                   RAGLRDVLLVTSRSKKAVEDHFDRDAELELALERKGDGARLARVRGSAELAEVHSVRQG
FT                   APRGLGHAVLCGAPHVGDEPFAVLLGDDLIDERDPLLEEMLAVQERFGGSVIALMEVPE
FT                   EVVSLYGVATVDPAPVAAGGRYETVRIRDLVEKPPADEAPSNLAIIGRYVLAPKVFEVL
FT                   RRTPPGRGGEIQLTDALRELAQAADEVGEPVHGVVFTGRRYDTGDRVDYLKAVIRLACE
FT                   RADLGPEIYPWLEEYVANGGPKADN"
FT   gene            678890..680182
FT                   /locus_tag="FraEuI1c_0542"
FT   CDS_pept        678890..680182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0542"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: fal:FRAAL6396 molybdopterin biosynthesis protein MoeA
FT                   2; SMART: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78624"
FT                   /db_xref="GOA:E3JB94"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB94"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADP78624.1"
FT                   /translation="MKTVDEHISDILESVGVLPARRLPLAAAHGCALATDVRATIALPG
FT                   FDNSAMDGYAVRAADVEQASPESPVLLPVTGEIAAGAALPDLVAPGTAVRIMTGAPFPP
FT                   GADTVIQLEWTDGGTETVAVHRAARRGLHIRRAGEDVTPGSLVLPAGSVLGSTQIGLLA
FT                   AINVARPPVRPRPRVAVLSTGSELVAVGNAVGPGQIVDSNSHAVAAAAREAGCEVRRLT
FT                   GVPDDPAQFEAALRAILPEVDAVVTTGGVSVGAHDVVKEVLAATGEVRFERIAMQPGQP
FT                   QGFGVIDGVAVFTLPGNPVSALVSFELFVRPALRRMRGLTGPDRPRPVVTVAERLTSPP
FT                   AKRSFLRVLVGRGADGGLVAQSAGGQGSHHLSAAAGANALLVVPEDVTVVEPGDQLTAI
FT                   LLAADPADELLAGPVVDAVPAGAVAPLEANV"
FT   gene            680183..680767
FT                   /locus_tag="FraEuI1c_0543"
FT   CDS_pept        680183..680767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0543"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: fal:FRAAL6395 molybdenum cofactor biosynthesis
FT                   protein C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein C; PFAM: molybdopterin cofactor biosynthesis
FT                   protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78625"
FT                   /db_xref="GOA:E3JB95"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB95"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADP78625.1"
FT                   /translation="MDAPARLTHVDETGAARMVDVSAKDVTQRVATAGGRLLVSPAVVE
FT                   LLRGAGMPKGDALGTARIAGIMGAKRTSDLVPLCHPLPISGVSVELTVADDAVDIVATV
FT                   RTTGRTGVEMEALTAVAVAGLTMHDMVKAVDPAAELTGVRLLAKSGGRSGDWRRDEAAG
FT                   HGGPAADRGPAGENGAAPANGRSGDLREETG"
FT   gene            680764..681315
FT                   /locus_tag="FraEuI1c_0544"
FT   CDS_pept        680764..681315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0544"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: fal:FRAAL6394 molybdenum cofactor biosynthesis
FT                   protein; TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78626"
FT                   /db_xref="GOA:E3JB96"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB96"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADP78626.1"
FT                   /translation="MTGPAQVPTGARASVVTVSDRASAGTYADRSGPLLAAGLVELGFA
FT                   VDGPVVVPDERGRIVAALRAALSAGADLVVTTGGTGLAPRDVTPEATAEVVERDVPGLA
FT                   EALRAAGRDKVPTAMLSRGRAGVVGRALVVNLPGSTGGVRDGLGVLGAVVGHALDQLRG
FT                   GDHRPSDGPGPQSRRPDPSQ"
FT   gene            681312..681950
FT                   /locus_tag="FraEuI1c_0545"
FT   CDS_pept        681312..681950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0545"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6393 putative ribosomal-protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78627"
FT                   /db_xref="GOA:E3JB97"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB97"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78627.1"
FT                   /translation="MNPPGWPARLADGPVAVRPLRMRDGPAWVDVRRRNGDWLAPWEAT
FT                   PPGMTGIRVGWAQRQTLGVYSQMLRGLRRAARSGSALPFATVYGGALVGQITVSTIVRG
FT                   AFNSGHVGYWVDQGHAGRGITPTALALVVDHCFGPAGLHRLEANVRPENAASRRVLEKL
FT                   GFREEGMHRRYLAIDGQYRDHVGYALTTEDVPEGLLHRWHATRSVERRP"
FT   gene            682498..683856
FT                   /locus_tag="FraEuI1c_0546"
FT   CDS_pept        682498..683856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78628"
FT                   /db_xref="GOA:E3JB98"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB98"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6391"
FT                   /protein_id="ADP78628.1"
FT                   /translation="MSALIWLAIVGVWGFVLIPMWLRRHDGALEQRSADRFSTAMRVLS
FT                   RRGGRAQPERHPETDLGDGLADEDDEADDADDLESTMELQTRPAAADDAPDGRQATASR
FT                   PAGDPSGPTAGRVTAGPAVPTRADVPVPSRGAVPARPATRSQAVARDARGEQDETAHTV
FT                   PVGAARPVPPSRPVDPERHALLRLRRQRLYVLLAAVPVTVGLAIGLAGMWIVVQALVDV
FT                   GLGAYVAHLRRSARTERRLAASRAARDRRIAADRAARRSNWAGPAHGTAGVPGARTAAS
FT                   PARATPPAAVRQGRPADPATAGPAGRPHVSAGGRAAASPEYAPVRLSDDHAAPLSSEEL
FT                   ATARAETVEIATPSPALPVAPEPAAVDDGYTNNVRVTAARPTGRPTVRPPTSRPGRVQV
FT                   NPPGTHGGLTAPPQPAAAAPAATPPAEPGTAQDGTPTDAEVAAVRLLRPAVGN"
FT   gene            684793..685407
FT                   /locus_tag="FraEuI1c_0547"
FT   CDS_pept        684793..685407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0547"
FT                   /product="Protein of unknown function DUF2493"
FT                   /note="PFAM: Protein of unknown function DUF2493; KEGG:
FT                   fal:FRAAL6316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78629"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB99"
FT                   /inference="protein motif:PFAM:PF10686"
FT                   /protein_id="ADP78629.1"
FT                   /translation="MTFEAWLGRLRNDGYLLCPASTAVPVELRAVRPDGWGLHLRCRGV
FT                   HVRLGLYRPGRPAWQVPLRDRHVIPEEALELWEHRPLRQAADPGAGLPAGTRIVFTGAE
FT                   DLPDHQLVFDGSREHGWRGHEAGLLRAPAAAEIFATLLAAAEPELDRWRPSVATAGGLR
FT                   LSPASLSAAEAAPRKGAAVPSARVAASARPTVAAGADQARS"
FT   gene            685485..685561
FT                   /locus_tag="FraEuI1c_R0009"
FT                   /note="tRNA-Ala1"
FT   tRNA            685485..685561
FT                   /locus_tag="FraEuI1c_R0009"
FT                   /product="tRNA-Ala"
FT   gene            complement(685673..686772)
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0548"
FT   gene            687148..687483
FT                   /locus_tag="FraEuI1c_0549"
FT   CDS_pept        687148..687483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78630"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA0"
FT                   /inference="similar to AA sequence:KEGG:H16_B1069"
FT                   /protein_id="ADP78630.1"
FT                   /translation="MPFDVRGNWQIVQTSGHIVDMNVPDENPDGTFDYGATAHEKLSGN
FT                   GTLSDARASDSEAVFLISWSNGARGRYSGHFDFQGRLTGVCHDETHPSSVASWYAKRGN
FT                   GDLFGPM"
FT   gene            688200..688483
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0550"
FT   gene            688587..689171
FT                   /locus_tag="FraEuI1c_0551"
FT   CDS_pept        688587..689171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0551"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: kra:Krad_2630 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78631"
FT                   /db_xref="GOA:E3JBA1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA1"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADP78631.1"
FT                   /translation="MPDGGAQARRDDRSFEEFVAERGTALLRTAVYLAGDRQAGEDLLQ
FT                   DVLLRAYGRWVKVDEPEAYTRRALVNAATNRRRGYRRSREDLVDLSDSPVERPTLPGGR
FT                   GDLAGVVGDRHDLLGALRQLPPRQRAVIVLRYFDDLTEAEIAAQLGCRPGSVKTHAARG
FT                   MSRLRELLGASTVADRMGGVVGPDQVREASA"
FT   gene            689168..690421
FT                   /locus_tag="FraEuI1c_0552"
FT   CDS_pept        689168..690421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RRC32 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78632"
FT                   /db_xref="GOA:E3JBA2"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA2"
FT                   /inference="similar to AA sequence:KEGG:RRC32"
FT                   /protein_id="ADP78632.1"
FT                   /translation="MSGEHRPTTAPPVDDGFATWLRAALAAQALDIELPATAGSSLLAR
FT                   AGAGDDPRLRTAPAARSPRRRWVATAVVAAAVLLVTVGAATLPRALRGHGDQVVPASVP
FT                   DMVAPTFYGVRVGWLPGEVQLYRDFLSAGIQIGGIATPGEAMNMESAEWATPAAIRARS
FT                   DSGSAASGGYSLLVIRAVANGGNVPSVKADTSTEQTTTVRGHIAVWASSRSPGNAGGSL
FT                   TWTVDFPAGTGGKATDHVFVQVLGPDETVVRRIADNLSVGPRPSGPTDKASAVAAMAAS
FT                   ASAAFDGASGVAMADAVDDPQAVLDGIGAALRTRPDALHAVSFAGVGPAPAGSQPDPRM
FT                   PQSVVVFLSDTEAQLSGVWIGGTTKEELAPATVPPNTTPPGMIDATIRFTLTSRGWKVG
FT                   RASFCGALVGVVTCPTNP"
FT   gene            691384..694125
FT                   /locus_tag="FraEuI1c_0553"
FT   CDS_pept        691384..694125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0553"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: cai:Caci_3624 transcriptional regulator, LuxR
FT                   family; PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78633"
FT                   /db_xref="GOA:E3JBA3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADP78633.1"
FT                   /translation="MSATAPVALVGREPETELLAGLLERIRDQGGAMLVRGEAGIGKSA
FT                   LLTEAGRIAAAGGMRVLTTAGAESEVQLAFAGLHRLLRPLLPYVDELPGPQSEAILAAF
FT                   ATGEAGASDFFLIALATLNLAAVAAARAPVLLIVEDAHWLDRASADVLLFVARRLAFEP
FT                   IMLLAAVRDGFESSMDNTGLPELSLKRLDDAASATLLDSRFPDLRPPVRARILGEAGGN
FT                   PLALVELPVTVAGTGSAEALPAWLPLTTRLERAFAERVSGLSVATRTLLLVAALNDGDT
FT                   LAETLAAGTVVAGEQLSLDDLAPALAVHLVDTTGERLRFRHPLMRSAIRQRSTIGQRQR
FT                   VHAALARVLAEDSDRGVWHAAAASLGPDEVIAAELEAVATRAQRRGATTEAVAALEHAG
FT                   RLSEDPGHRRERMLRAAECAVELGRPDVVVRLLHEAGPDELSERHRARRMLIGGGFDDG
FT                   IRDANDGAVVLAEAATRVAADGDVALALRLLWGAALRCFWAQPGPEASARVIAAAEALP
FT                   VDELDAQLLAIFAFAAPIERGAVVIDRMRRSAASWNGDAQTARMLGDAALLVGAWDLSL
FT                   QFCTAALPELRAQGRLGLLARALGAQAWSAVRLVDLGVAIPAAEEASLLAQETAQPLMY
FT                   ATAQSAAALLAAVRGDEDRLEEVAAEAERVAIPVDAHPVLATVQLARGLAALGDGRHDY
FT                   AYEQLRRMHDPADPAYHAGLRCHGVGELVEAAVYSGNGDAVRPVVAEMEEIARATPAAA
FT                   LHIDLRYARALLAADADAEPLFLAAQNAELVPWPFARARAQLAYGAWLRRQRRAADSRA
FT                   PLRTARETFDALGAVPWSERARQELRASGEVSRGRAPDARDQLSARELQIAQMVAQNLT
FT                   NKEIAQRLYVSHRTVSSHLHRIFPKLGVTSRSALRAALEPPA"
FT   gene            complement(694150..694947)
FT                   /locus_tag="FraEuI1c_0554"
FT   CDS_pept        complement(694150..694947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0554"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cai:Caci_3623
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78634"
FT                   /db_xref="GOA:E3JBA4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78634.1"
FT                   /translation="MATPTPVIFIHGLWLHASSWGPWIDLFRTAGYDPSAPGWPGDPDT
FT                   VDEARADSQAMAGHGIDDVVAHYAEIISHLPVKPILVGHSFGGMIAQRLLGQDLAAAAV
FT                   AIDAAQIKGVLPLPLSALRATLPVFKNPSNRNKTVPLTAEQFRYAFGNTIPEDESQQLF
FT                   DTWVIPAPGKPLFEAAAANFDPHSPAAVNTKNEGRGPLLLIAGGKDHTVPEVVTRATLK
FT                   QYRHSSAVTDILDFADRGHSLTIDHGWRDVADASLDWLRKQGL"
FT   gene            complement(695076..697613)
FT                   /locus_tag="FraEuI1c_0555"
FT   CDS_pept        complement(695076..697613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0555"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: nml:Namu_4457 PKD domain containing protein;
FT                   PFAM: PKD domain containing protein; SMART: PKD domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78635"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA5"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADP78635.1"
FT                   /translation="MSGTSGLGASRVRHAAGPALRWAPRLLLAVLVLAGACAVIAGNGA
FT                   GAAARSVSLEDSAAWLLSPTIGETELVDGNTGAVITRVTLGAGQLAGAQSGADEVVADT
FT                   GGGTVRRVDGATYRVSAAVRPGRPGEPLTVYPTKSTLFIANRTTGLVTAADPERLTTRY
FT                   TASLSARMPVGGVAADGNTGLWAIDATTGDLAHVGPSGTTIRRHAVDPAHTQLVTAAGR
FT                   AVAVDLTAGRAVTITASGGGGPAACVDTAVGDTTVSVVPATSAEQVYVTSGQRGVLLIS
FT                   DLATGRCGRAIDLGVAGHRLGQAVETARRLFVPDYTTGQVIVADLASGRVIASPTVLPP
FT                   GTLFELASQGSITFFNDPSTARAGIISLDGTVRAVQKYDAANPGSSAGGHSGSSGPSGG
FT                   SDPLTAADVSGPTGPVTPGPTPTPTTPVTGRSSVQPSNGPATVGGSLQTAVPLDGRTPA
FT                   AAAPGARIEVSAPRARMADPLTLHAVLVGANGQVSDARITSTAWTFGDGATGGGVRVSH
FT                   AWAAAGTYQVGAAIRLRDGTSTAASTVITITAQAPPITGPSTTPVSPPPSSRPTTPPTT
FT                   PAAKPKAALFAQQSTPSSGQQVPLEVAADATGSSGSGALRYTFDFGDGTAAVGPQAGVT
FT                   ARHDYAATGTYPVRLTVTDATGATDAVEESVLVAPAGAAWVDVRPDSGQGPPLTATADA
FT                   SASSGTGTLHYTFSFGDGSASVGPQTGATVTHTYTAPGQYALSVTVTDAVGGKYVNSSD
FT                   VVVDPVWTVTPSSGPAPLTVEAQVVASQAGATYDWGFGDGTPGTGWQTAPTATHTYTAP
FT                   GTYQVFLEFQYASGAFGTRTMNVTVTGPAAAPG"
FT   gene            complement(697777..699363)
FT                   /locus_tag="FraEuI1c_0556"
FT   CDS_pept        complement(697777..699363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0556"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   fal:FRAAL2367 putative glutamate synthase(ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78636"
FT                   /db_xref="GOA:E3JBA6"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA6"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADP78636.1"
FT                   /translation="MFRPATLGSLTLLTAGGVAIGLTVGWAGWVLAGVAAALTVVAVHD
FT                   LAQRRHAILRNYPVLGHARFLLEGIRPEIQQYFIERNYDGRPYDRDVRTVIYERAKGIH
FT                   GEQAFGTERDVGAVGYEYLLHSTVPLAVPDGAQPRVRIGGPDCTVPYDMALLNVSAMSF
FT                   GALSANAVLALNHGAARGGFAQDTGEGGLTEYHLRGGADLVWEIGSGYFGARTKDGDFD
FT                   PDLFADKAANPAVRMVELKLSQGAKPGIGGVLPAAKVTAEIADARGVPRGEKCVSPSSH
FT                   RVFGTPRELVLFIARMRQLAGGKPAGFKLCVGSRRELLAICKAMLAEGVTPDFIVVDGS
FT                   EGGTGAAPLEYEDHVGTPLTEGLIAVHNALVGVGLRSQIRVGASGKVATGTDIVKRLAQ
FT                   GADYTNAARAMMMAIGCIQAQRCHTNLCPVGVATQDQARAKAIDVPDKSERVRRYQEAT
FT                   VAQAAQIIASMGCPGPDALRPAHIMRRVDHVTTRSYAELYTWLEPGQLLAEPPADWATD
FT                   WAAADPDRFHG"
FT   gene            699848..700492
FT                   /locus_tag="FraEuI1c_0557"
FT   CDS_pept        699848..700492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0557"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO1904
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78637"
FT                   /db_xref="GOA:E3JBA7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78637.1"
FT                   /translation="MATLTARRDDARRNRETILRVADGAFADGSDAVPLDEIARRAGLG
FT                   RATVYRHFPDRHALAVAVAAQNLEALREVVRADGDDRCPFRDILGMVFSTQASMRPLVA
FT                   LMLELPVREQLQYTEALIEALTPPFRQAQADGELRPDAEPADLALVMAMINTAVDAVPV
FT                   GLDHGAALRRIVTTILDGLFGPSTPVDDQDRADGPEEPAAAGSRCRTRRFV"
FT   gene            complement(700500..700745)
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0558"
FT   gene            700902..702182
FT                   /locus_tag="FraEuI1c_0559"
FT   CDS_pept        700902..702182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0559"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sen:SACE_3205 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78638"
FT                   /db_xref="GOA:E3JBA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78638.1"
FT                   /translation="MARRSLGRRFGWLWAAYAVSAYGSGLALGAFPLIAVLVLRAGPAK
FT                   VSALSAVGPAMGALIALPLGPWVEYRRRRPVMISMDLARFAALMTIPVAYAFGRLSFAQ
FT                   LLVVSAVVAAAKIAFNAAAGAYVKALVQPRDLLVANARFESTTWSSIAVGPPLGGAAIG
FT                   VFGPVVSVVADALSYLLSALGITAIRGREERPRRTESSRMRAGDLLDGWRYILAHPGLR
FT                   ALYANTVLVNGLIMATEPLLAVLLLGQLGFPPWQYGLAFAVPCVGGLVGSRLARRVVTR
FT                   YGQARVLRTAGMLRAVWLIGLAFIRPGMLGLVTVIAVEFAIIVNMSLFSPVLATYRLEH
FT                   TPKDRIARTLSAWSISSGLSIALFTALGGLLADATSPRTALTAAGVLILASPLLLRRPD
FT                   SFGRVSGPELPTEGRQPQVASVSGETG"
FT   gene            702394..702564
FT                   /locus_tag="FraEuI1c_0560"
FT   CDS_pept        702394..702564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_3373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78639"
FT                   /db_xref="GOA:E3JBA9"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA9"
FT                   /inference="similar to AA sequence:KEGG:Caci_3373"
FT                   /protein_id="ADP78639.1"
FT                   /translation="MPLIIAILIVALLFGGLGFAVHALWIVALVVFVAWILGFVLRSGS
FT                   STGSRGRWYRW"
FT   sig_peptide     702394..702465
FT                   /locus_tag="FraEuI1c_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.962 at
FT                   residue 24"
FT   gene            complement(702753..704408)
FT                   /locus_tag="FraEuI1c_0561"
FT   CDS_pept        complement(702753..704408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0561"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: fal:FRAAL4374 putative
FT                   succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78640"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB0"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADP78640.1"
FT                   /translation="MSAQVWDEVFDVVVVGSGAGALTSALLAADGGASVCVVEKSEYIG
FT                   GTTAASGGDMWIPCNRHIADQDTREEAIDYVTRLSDGRAYDPHLIEVYVDTAAEALDYL
FT                   ETHTGLVTRAHKGLPDYYAVVPGRIPGTKDVPRSVSCQPYPAVAELGAEWAARVNPSPW
FT                   VKPPEVAYAEAIEVVPREELLRRRAEGYRAKGGGLVAPLLKALLDRGVSVRWSTPGRDL
FT                   VTNEAGGVIGVVAGEDGALQRLGARKGVVLATGGFEWNEDMVKTFLGYDVKPCTPWTNT
FT                   GDGHRMAMRAGAKLGLMTSFFSYGVMHDPWEIGRDGNPLPQMEMGLGAGTIIVNQQGKR
FT                   FMHGGYTYNDFSHPFNFFDQRNPGFTNKAPGWCVFGAAKWEGKGVFGGHVVDGVIVGPN
FT                   GQPAPSWLLVANSIRELAEKMGVDPDTLEETVARYNEFAEKGEDPDWGDPQQVRSATGP
FT                   DTTSLKPVLGPIYGAILQWPGTLGTSGGPKIDADARVLGTETPIIDGLYAAGNTAASVL
FT                   GGTYPGGGSCVGPSMVMGYRAGRHAAAQPTRDIN"
FT   gene            704872..705552
FT                   /locus_tag="FraEuI1c_0562"
FT   CDS_pept        704872..705552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0562"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: kra:Krad_4111 cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78641"
FT                   /db_xref="GOA:E3JBB1"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB1"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADP78641.1"
FT                   /translation="MALKTGTLISFVAMAAAATGGGLAGCPGPSGGSGSNPANPAGCAD
FT                   VEVVFARGSGELPGLGITGTPFVSSLTSDLAGKSVTSYAVNYAADLAQTSAGAGATDMS
FT                   NHVVSVAAKCPNTEFVLGGYSQGASVTDIAIGIPTLLGSGTTIPASLAPRVAAVVVFGN
FT                   PLALYGQHIPTASSLYGSKAQEFCAAGDPVCANGANGVAHLSYPTNGMTTQGAAFAAAK
FT                   VKSS"
FT   sig_peptide     704872..704934
FT                   /locus_tag="FraEuI1c_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.392 at
FT                   residue 21"
FT   gene            705637..706077
FT                   /locus_tag="FraEuI1c_0563"
FT   CDS_pept        705637..706077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: art:Arth_3902 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78642"
FT                   /db_xref="GOA:E3JBB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADP78642.1"
FT                   /translation="MTPEDLANLAHLRRARDLMDREYASPLDVAALARAALMSTAHFSR
FT                   QFRAAYGETPYSYLMTRRIERAKALLRRGDLSVTDVCMAVGCTSLGSFSARFTELVGET
FT                   PTAYRARDHGALAGVPGCVAKDLTRPSRRPSRIGEARGPAVP"
FT   gene            706088..706495
FT                   /locus_tag="FraEuI1c_0564"
FT   CDS_pept        706088..706495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0564"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: art:Arth_3903
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78643"
FT                   /db_xref="GOA:E3JBB3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADP78643.1"
FT                   /translation="MELTFARCFVQINDADLALAFYRDALGLEVRKDVANEGFRWITVG
FT                   AASQPGVEIVLTNFVQGSPSDVDVIAALVAKGAMGGVHFHTDDLDGTFEKVRATGAEVV
FT                   QEPTEQFWGTKDCAVRDPSGNLVRIDQLPAA"
FT   gene            706546..708945
FT                   /locus_tag="FraEuI1c_0565"
FT   CDS_pept        706546..708945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0565"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sma:SAV_2097 UvrA-like protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78644"
FT                   /db_xref="GOA:E3JBB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78644.1"
FT                   /translation="MSMATRTGTQSPAPHVADSQDLIRVHGARVNNLKDVTVEIPKRRL
FT                   TVFTGVSGSGKSSLVFGTIAAESQRLINETYSAFVQGFMPTLARPEVDVLEGLTTAIIV
FT                   DQQRMGADSRSTVGTATDANAMLRILFSRLGQPHIGSPNAFSFNVPSVRASGAITVERG
FT                   GHSQAVKKTFTRLGGMCPRCEGRGTVSDIDLAELYDDSKSLADGALTIPGYHAGGWNGR
FT                   LYTESGFVDPDKPIRDYTKKELNDFLYKEPVRMKIAGINMTYEGLVLRVQKSMLSKDPD
FT                   ALQPHIRTFVDRAVTFMVCPECAGTRLAESARSSRIEDLNIADVCALQISDLAGWVRGL
FT                   TEPSVAPLLASLLRTLESFVEIGLGYLSLDRPSGTLSGGEAQRVKMIRQLGSSLTDVTY
FT                   VFDEPTTGLHPHDIQRMNELLLRLRDKGNTVLIVEHKPEMIAIADHVVDLGPGAGSGGG
FT                   TVCFEGTVEGLRAGDTVTGRHLDDRASIKASVRQPTGKLEIRGATTHNLRDVDVDIPLG
FT                   VLVVVTGVAGSGKSSLVHGSIPAGAGVVSVDQGAIRGSRRSNPATYTGLLEPIRKAFAK
FT                   ANGVKPALFSANSEGACPTCNGAGVIYTDLGMMAGVATTCEDCEGKRFDASVLEYRFGG
FT                   RDISEVLAMSVTEAAEFFGAGEARTPAAHAIVDRLADVGLGYLTLGQPLTTLSGGERQR
FT                   LKLATHLAEKGGVYVLDEPTAGLHLADVEQLLGLLDRIVDSGKSVIVVEHHQAVMAHAD
FT                   WLIDLGPGAGHDGGRIVFEGTPADLVAARSTLTGQHLADYVTPRAA"
FT   gene            709122..711761
FT                   /pseudo
FT                   /locus_tag="FraEuI1c_0566"
FT   gene            709567..710763
FT                   /locus_tag="FraEuI1c_0567"
FT   CDS_pept        709567..710763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0567"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: scb:SCAB_77071 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78645"
FT                   /db_xref="GOA:E3J3M4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3M4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADP78645.1"
FT                   /translation="MERVWAGVDIGKEHHHVVVIDADGARMLSRRVANDEPTLLDLLGQ
FT                   VTALAERVHWAVDLSTGGAALLLGLLVAHGQQVFYLSGNQVSRAAGGYRGEGKTDAKDA
FT                   AIIADQVRMRRDLAPMRVDDELIVELRMLVARRRDLAGDRVRLVNRLHEHLLGISPALE
FT                   RVLNLTNRGPLVLLTHVQTPAAIRQLGPAGLEQWLRSQKVRGAAALAATVTAAANSQRT
FT                   TLPGEQLAAQLVADMAKGVMSLDEQIAQTDTLIEGRFHRHRHAAALLSMPGIGVLLGAE
FT                   FLAATGGDMAAFTSADHLAGYAGLAPAPRDSGRISGNLHRPRRYHRGLQRVFYTSALVS
FT                   IRYNDQSRTFYDRKRSEGKRHTQAVLALARRRVNVIWALLRDNRCYQPAPPPLIAAAA"
FT   gene            complement(711829..713016)
FT                   /locus_tag="FraEuI1c_0568"
FT   CDS_pept        complement(711829..713016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0568"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mav:MAV_2138 cytochrome
FT                   P450 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78646"
FT                   /db_xref="GOA:E3JBB6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB6"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADP78646.1"
FT                   /translation="MTELYWDPFDKDIDADPHPVWSRLRDEAPVYRNDKFDFYALSRYA
FT                   DVDGAHLDPATFSSAHGTVLEIMSPEPMDVGQMIFMDPPVHTTMRVLVSRAFTPRRVGG
FT                   MEGAIRAIAAELLDPLVGSGGFDYVQDFAALLPSMVISELIGVDPEDREEIRLTIDESL
FT                   HIDDDKGMINDISFAAQIKMHTYLSEQIEARRKKPRDDMMTALTEAEIKTPDGGTRRLS
FT                   TSEAADFTNLLISAGTETVARLLGWTGALLAEHPAARAELVGDPSLIRNALEETLRYEA
FT                   PSPVQGRFTKSDVELHGTTIPAGSKVLLLTGSAGRDERKYADADRYDIHRVVDSHVSFG
FT                   HGIHFCLGAGLARMESRVAVEETLLRFPNWDVDQANAVRVHTSTVRGYAKLPITF"
FT   gene            complement(713120..713716)
FT                   /locus_tag="FraEuI1c_0569"
FT   CDS_pept        complement(713120..713716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0569"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mva:Mvan_4140
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78647"
FT                   /db_xref="GOA:E3JBB7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78647.1"
FT                   /translation="MAEPRRRRAATEEKVTRVLDAAEEIMLREGYAAVTSRNVAERIGL
FT                   KAPLLHYYFPTIDDLFVALLRRRSERTVERMEAALASPRPLQAWWDLASDPRGTALLIE
FT                   FLAAANHRPALRAEVGEVARVVRQMQMAVLDKIQTEYGLDPDVFPPALLATTMQGLALG
FT                   LVADEVAGRETAHEQARAAMSRLVANLEQRRSRRT"
FT   gene            713853..715046
FT                   /locus_tag="FraEuI1c_0570"
FT   CDS_pept        713853..715046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0570"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmi:MMAR_4753
FT                   cytochrome P450 189A7 Cyp189A7"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78648"
FT                   /db_xref="GOA:E3JBB8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB8"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADP78648.1"
FT                   /translation="MSNPSPVYWDPFDREIAEDPYPTYRRLRAEAPLYYNDRHDFYVLS
FT                   HWDDVNRSLVDWATFSSARGPILEVIKANIKIPPGTLLMEDPPIHDLHRRLLARVFTPR
FT                   RVMSLESEIRDFCVRCLDRLAGSASFDLMAEFANEVPMRVIGMLLGIPEADQAAVRERA
FT                   DAKLRTEPGKQMKVSAKALMDTDLFADYIDWRAAHPSDDLMTELLNAEFEDETGTTRTL
FT                   TREEILTYVTVLAGAGNETTARLIGWLVALLDRHPDQRADLVENPGLIPNTIEETLRFE
FT                   PTGHAIARYVTKDVELYGQTVPAGSAMMLLLASANRDERRWDGGECFDVRRKIDQHITF
FT                   GIGTHYCLGAALARLEGRIALEEILARFPTWDVDWDNSALSSTSTMRGWEHLPISVG"
FT   gene            715143..715961
FT                   /locus_tag="FraEuI1c_0571"
FT   CDS_pept        715143..715961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0571"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mab:MAB_3081 short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78649"
FT                   /db_xref="GOA:E3JBB9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP78649.1"
FT                   /translation="MGKLDGKVAFITGAARGQGRSHAVRLAEEGADIIGIDICAQMESV
FT                   QYPMGTQAELDQTVKEVEALGRRIVALKADVRDVAGLQAAFDEGVAALGPVDIVVANAG
FT                   IGAGGKAIAPETEWDEVVAVNMTGVWNTGRVAIPSMLQRGKGGSIILTSSTGGLVGVGI
FT                   PTSGFLAYTAAKHGVIGLMRSWANFLAPHMIRVNSVAPTAVRTPMAGDGDLKAIMERNP
FT                   ALANALTNAMPVDLVEPLDVSNAVLWLASDEARYITGTVVPVDAGLINKR"
FT   gene            716232..716633
FT                   /locus_tag="FraEuI1c_0572"
FT   CDS_pept        716232..716633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_31870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78650"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC0"
FT                   /inference="similar to AA sequence:KEGG:Bfae_31870"
FT                   /protein_id="ADP78650.1"
FT                   /translation="MLALALVAGCGRVDPNEGFPGFQDTLAPSGQAAGGADAASSDSGA
FT                   GQPTDAADQGAPRPVATPGPGSAPSAGSNGAAGAAATASAKVSPSGTAANHGPTAAVTT
FT                   SSIKLPVETTTPAAKPTTAKPTGGIVLPH"
FT   gene            716798..717358
FT                   /locus_tag="FraEuI1c_0573"
FT   CDS_pept        716798..717358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0573"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mva:Mvan_4942
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78651"
FT                   /db_xref="GOA:E3JBC1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC1"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADP78651.1"
FT                   /translation="MTTLADRPNTALLVVDVQTEVVAAAYDRDAVVANIRELVDEARRA
FT                   GVPVVWVRHSDESLVRGSAGWQIVAELVPDGGEPLVEKSYGDAFEATTLEDVLAGLGVG
FT                   RLVVAGAETDACIRSTLHGAFTRGYDAVLVSDAHTTGDRSAWGAPPPEQVIGHTNLYWT
FT                   YQTAPGRTAGTVATKDVGFGAAH"
FT   gene            717419..718033
FT                   /locus_tag="FraEuI1c_0574"
FT   CDS_pept        717419..718033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_2854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78652"
FT                   /db_xref="GOA:E3JBC2"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC2"
FT                   /inference="similar to AA sequence:KEGG:Tcur_2854"
FT                   /protein_id="ADP78652.1"
FT                   /translation="MSDDATGATRRRAREPRRVKRLLVVGAAVGLLAVGGGFGFLGGRL
FT                   SAPAGRSADRAVRPQEKVQHAAAVRYGNLTFRPTGLTCGMRWAFGTHAELEAKGQYCRL
FT                   GVVVENIDSTFHDLVTGRQRLVDSAGKAYAPSFDVMRAKRQPDSITLGARDAVEIDLWF
FT                   DVPAGGRIDAARLVGDDDPSGIDVVVNTPRPSGGARVPLTM"
FT   gene            718195..719292
FT                   /locus_tag="FraEuI1c_0575"
FT   CDS_pept        718195..719292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0575"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: sen:SACE_3888 CorA-like putative magnesium transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78653"
FT                   /db_xref="GOA:E3JBC3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC3"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADP78653.1"
FT                   /translation="MGDATAGNPGRPGGTVGWNGSSNLACRVDPDADPTNRVGREPPRT
FT                   RVYRAGKLEAEGFPVARVSDYLEEPDTVVWLDLCAPRPDELHVISEELNLSSLAVEDAV
FT                   SPRERPKLDRYDSHLFLNAYSVSFDRDSGEVATHEVAAFITQKALVTVRQDEGFDVDGL
FT                   LAHWGEVGQELGQYGVSYLVHGLLDFIVDQHFAAVQSLDTEIETLEDLLFDDAPHDGAV
FT                   QRRSYELRKSLVLLRRVVLPMREVVNTIMRRDLHLVSPEIAPYYQDVYDHVLRATEWTE
FT                   SLRDLVTTILETNLTIQGNRMNLIMKRLSAWAAVIAVPTAITGFYGQNVPYPGFGKEWG
FT                   FAVSVGVLLGCAGFLYVAFKRRDWL"
FT   gene            719441..720592
FT                   /locus_tag="FraEuI1c_0576"
FT   CDS_pept        719441..720592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0576"
FT                   /product="Peptidase M75, Imelysin"
FT                   /note="PFAM: Peptidase M75, Imelysin; KEGG: cai:Caci_7481
FT                   iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78654"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC4"
FT                   /inference="protein motif:PFAM:PF09375"
FT                   /protein_id="ADP78654.1"
FT                   /translation="MVIAAVGVTLGLTLGRGGSGASAEQPVRSPRISIGLSGCGTGWTK
FT                   PAAGQQDFLLVNTDLRNGDAQLIDPASGAVYAEVEPLGSGASAHLRIMLGHGSYAFRCV
FT                   MEDDTAITGPTVTIGGTLRTPVAPVLPVTRNDLVPVARAYETYVNNALPGLIGLTRTLS
FT                   ADIGRGDLAAARRDWLPAHLAYERLGAAYGAFDTADSAINGRPDGLPDGLQDSGFTGFH
FT                   RLEYGLWHGESAASLGPAADALVTAETDLQSAFPQAQIDPLDIAIRAHEITENTLQFTL
FT                   TGHDDLGSGSELATARANLDGTRTVLGLLRPLLTSRYPALPALDPLIATTDRDLAAFQH
FT                   PDGTYPALADLSVPDRERVDSDFSELSEQLAPIASICEPRRTQ"
FT   gene            720589..721911
FT                   /locus_tag="FraEuI1c_0577"
FT   CDS_pept        720589..721911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0577"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="KEGG: cai:Caci_1778 Dyp-type peroxidase family;
FT                   TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78655"
FT                   /db_xref="GOA:E3JBC5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC5"
FT                   /inference="protein motif:TFAM:TIGR01413"
FT                   /protein_id="ADP78655.1"
FT                   /translation="MSDLTGDGTAGVDGGGARGWGSPERGRRLDRRSLLRGSALAAAAA
FT                   TAGGGATAAAGTAVAQAPAAAVPTGATVRPARFVAFHGTHQAGILLPAQAYSVTAAFDV
FT                   TARSRGELTDLLRALTDRTRLLATGGVPPNDGISAPPADSGVLGPTLTGTGLTVTVGVG
FT                   ASLFDGRFGLGPARPRRLTTMPTFPNDSLDRAQCDGDLVVQICADAPDSPLHAIRDLTR
FT                   HTRGGMQARWRVDGFLSPPRPDGAPRNLMGFKDGTANPAVATPAVADRLLWAARDEPAW
FT                   ATGGSYLVVRLIRMLVEFWDRVTISEQERMIGRRRDSGAPLSGTVEADTPSYSDDATGG
FT                   KIPLDAHIRLANPRTPETAASVPLRRGYNYDRGLDSNGNLDMGLVFTAFQQDLERQFAA
FT                   VQGRLADEPLTDYIVPFGGGYFFALPGVRDGADWFGRALLA"
FT   gene            722204..723826
FT                   /locus_tag="FraEuI1c_0578"
FT   CDS_pept        722204..723826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0578"
FT                   /product="phosphoesterase"
FT                   /note="PFAM: phosphoesterase; KEGG: cai:Caci_7483
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78656"
FT                   /db_xref="GOA:E3JBC6"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC6"
FT                   /inference="protein motif:PFAM:PF04185"
FT                   /protein_id="ADP78656.1"
FT                   /translation="MTLSTRLRRGGIAAAAAVATAAGIAIFQMQPSSATQPVDRSASTT
FT                   TPIKHVVVIFDENVSYDHYFGTYPFATNTDGTKFTPRPFSPYDNNLLFSGALFKNPNTY
FT                   SPARLTSAQALTCDQNHGYGAEQKAVDGGKMDLFPQSVSVDTCSGNLYGTPGLAMDYYD
FT                   GNTVTGLWNYAQYFAMSDNSWDTTFGPSTPGALNLISGQTHGVTSHDPKTGAQTATPDA
FT                   YTVLSPNASGVGTVINDPDPLYDDCADKNHTATNALASMSGKNVGDLLNAKGVTWGWFQ
FT                   GGFKPTTAYAGSGTYAVCGATHTNIGGNSSVDYSPHHSPFEYYASTSNPHHLPPTSVAE
FT                   IGHTDQANHNYDLTDFDAALSANNLPAVSFLKAAEYQDGHAGYSDPADEQTFLTSTINK
FT                   IQQSKDWSSTAVVIAYDDSDGWYDHVAPTILNGSTDAASDSAVCATAKAKAAGGYLDRC
FT                   GPSQRLPLLVISPYSKANYVDHGYTDQTSALTFIENNWSLGRLGDASFDTRTSGLGSFF
FT                   NFGARPSRQLLLNANGSVKSVHL"
FT   sig_peptide     722204..722308
FT                   /locus_tag="FraEuI1c_0578"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.862 at
FT                   residue 35"
FT   gene            complement(723941..725371)
FT                   /locus_tag="FraEuI1c_0579"
FT   CDS_pept        complement(723941..725371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0579"
FT                   /product="(R)-6-hydroxynicotine oxidase"
FT                   /EC_number="1.5.3.6"
FT                   /note="KEGG: nml:Namu_0061 FAD linked oxidase domain
FT                   protein; PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78657"
FT                   /db_xref="GOA:E3JBC7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC7"
FT                   /inference="protein motif:PRIAM:1.5.3.6"
FT                   /protein_id="ADP78657.1"
FT                   /translation="MSSTVSDSDAELFAGLTLTGEPEVAALRAAVRGVVLEPGDPGWDA
FT                   ARGAFNLVIDQRPRLIAIPADAADVAAVLRFADLSGLRVAPQRTGHNAAPLGSLDRTIL
FT                   LRTDALREVRIDASRRRALVGAGAKWADVVPRASELGLAALHGSTPDVSVVGYTLGGGL
FT                   GWYARALGLACNSVTGIQVVTPGAEPRWVDPDVEPELFWALRGGGGNFGVVTAIEFVLY
FT                   PVAEVYAGVLFFPWERSSEVLHAWERWTRTVPDEMTSVGRILQFPPFEEIPEPLRGKSF
FT                   VLVEGVFLGDEEAGARLIEPLRALGPVLDTFAMVAPAGIAELHMDPPTPSPYQGESQVL
FT                   ADLTPEAVDRFVAATGPGSGSPLVSAEIRHLGGELDRVRPGSGALSRMPGSYIFFGVGM
FT                   TPVPESVPPVHRALAAAKESLAELASGQYLNFVETAVDAAELFPADAYARLRAVRAGVD
FT                   PRGVVKANHEIRVAEAGN"
FT   gene            726005..727447
FT                   /locus_tag="FraEuI1c_0580"
FT   CDS_pept        726005..727447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0580"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: fal:FRAAL1479
FT                   putative O-acetyl-transferase; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78658"
FT                   /db_xref="GOA:E3JBC8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC8"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADP78658.1"
FT                   /translation="MGLGLAARPLSTAFNRSGNSLNMIRLLLAATVVISHSRTIAGHGD
FT                   GISIGHGEIAKFAVDAFFVISGFLITGSRLGLPTGRYLWNRILRIFPAFWAALLGTAFL
FT                   AAPIAWYHDHNSLGGLFTDAHGPVQYVLRNCLLDIGFWDVAGTPAHVPFPAVWDGSIWT
FT                   LRWEVACYLGIAALGAVGLLARRGVVLGIFGVMWAAYAFHDVAPSVAGGAFAHQQTVTR
FT                   FALLFLSGTLMCLFQDKIPFSDALGALALVEVAVAYVALDHAYIWAGPPLAYACLWVAT
FT                   RVPMPKLLRNDFSYGLYIFTMPVQQLLAVFGLAKGSLTVYTVLSLSGGLALAALSWFGL
FT                   EKRVLKLKNFTPGFLKDKGAAAGAHRRLRRPPGMRASTMVIPMPEEIRSAMTGSGRAEP
FT                   SRRGASRPAQAPAPAQAESGRSRSRRRSGSDRPVPPAPPPPPGRVDETMLLLPASGVEE
FT                   TMRLPPQPSVDDTVRLRRGRQR"
FT   gene            complement(727510..730242)
FT                   /locus_tag="FraEuI1c_0581"
FT   CDS_pept        complement(727510..730242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0581"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /note="KEGG: fal:FRAAL0280 serine/threonine protein
FT                   phosphatase; PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78659"
FT                   /db_xref="GOA:E3JBC9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC9"
FT                   /inference="protein motif:PRIAM:3.6.1.17"
FT                   /protein_id="ADP78659.1"
FT                   /translation="MTLEEPEKMTEGPEPATPVALDIPETCLVVLVGVSGSGKSTFART
FT                   HFAPTQVLSSDFCRGLVADDENDQAATGDAFEVLHYIAGKRLAAGRLTVVDATNVQSRA
FT                   RQPLVELARRHDVLPVAIVLDLPEQVCLARNSARPDRDFGAAVIRRQRSELRRSMKGLA
FT                   REGFRRVHVLRSEAEVAAATISYTRLFTDLRHETGPFDVIGDVHGCRAELEGLLVKLGY
FT                   ELSRDDAGRPVGASHPEGRRVIYVGDLVDRGPDTPGVLRLAMGMVADGTAFAVRGNHED
FT                   KLVRALAGKKVTIGHGLAESLEQLGAQSAEFRAQATEFCDGLIAHYVLDGGRLVVAHAG
FT                   LKEVYHGRASARVRSFALYGDTTGETDAYGLPVRYPWANEYRGKATVLYGHTPVPEPEW
FT                   INNTLCLDTGCVFGGALTALRYPERELVSLPAARVYFEPARPLADQPPPTDSPGLSEAA
FT                   PSVDVDPASAEALLAPLGPALPAAARPAGHRADDLLDITDVLGRRIVETRHGGRVQVQP
FT                   ENALAALEVMSRFAVDPRWLVYLPPTMSPPPTSSLPGYLEHPLEAFETYRADGVDDLLC
FT                   EEKHMGSRAAVVVCRDQGVATARFGAGDGTTGAIVTRTGRPFFAPELTEQVLARLRAAA
FT                   TVAGLWEQLDAGWLVLDAEIMPWSAKATELISRQYAAAGAAARGALPAAVAALAATAER
FT                   GIDVADLLAKTRDRLDNAVAFTHAYRRYCWPVDGLDGLKIAPFQLLAAGPASGAGATQV
FT                   DHPHSWQLALADRLVAADPELVVTTRRYAVRASDPASVAAAVTWWEDLTDPRAGGEGMV
FT                   VKPAAGLARGSRGLALPGIKVRGREYLRIIYGPDYTRPENLDRLRVRGLGRKRSLAFRE
FT                   FALGLEALERAAAGEPLWRVHECVFAILALESEAVDPRL"
FT   gene            complement(730250..731866)
FT                   /locus_tag="FraEuI1c_0582"
FT   CDS_pept        complement(730250..731866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0582"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: tcu:Tcur_1722
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78660"
FT                   /db_xref="GOA:E3JBD0"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBD0"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADP78660.1"
FT                   /translation="MLLTLTTTAPAATGPPSGGPSATGHPVTAAPATDLGFLLHKHPDR
FT                   AQRFDTAAGGAYVFYPEATAARCTAALLLDVDPVGLVRGKGNSRATTAAQYVDDRPYAA
FT                   SSLLAVAMAAVFSTAMAGICKSRPELAATPLPLEIRVPALPCRRGGAALAERLFAPLGW
FT                   RVDAVTAPLDPAFPEWGDAPHHDVTFTGTVRLADALTQLYVLLPVLDDGKHYYVGRDEI
FT                   DKLVREGASWLPGHPERHLIARRYLAHRAGLASAALAQLGTVEDVPVDAVSAGFEPGLV
FT                   AVDQDPDADLTPDDPAAPGAAATGDQAAPEPGPDAPAEAASPVAERAAETPEPSRPPSL
FT                   AVQRRRAIMDVLRAADARRVADLGCGDGKLVGELLADARFTEVVAVDVSHRALETAARR
FT                   LRIDRMPERVQARLRLVASSLTYRDARIAGLDAAVLCEVIEHVDPPRLPALAAAVLGEA
FT                   RPRLVVITTPNVEFNVRYEGLAPGAPRHRDHRFEWTRAEFAAWVEDLLTRYPYTARLGG
FT                   IGTADPALGTPTQLAVLERVA"
FT   gene            732224..733921
FT                   /locus_tag="FraEuI1c_0583"
FT   CDS_pept        732224..733921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0583"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   fal:FRAAL2998 amino acid/polyamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78661"
FT                   /db_xref="GOA:E3JCG5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E3JCG5"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADP78661.1"
FT                   /translation="MYGSQPAARHRAVAVPSPSTPGRETGSAGPGQAPPGSPDPTRGPG
FT                   SGMAPRLGLVGLTFVSLGSIIGSGWLLGALTAARVAGPASLVAWALAGVLILGLALVHA
FT                   ELGASYPVAGGSARYTHLALGPLSGFVAGWLAWIQAVALAPIEAEAALSYLNNVWPGLI
FT                   SPQGTLTGKGLALGAAALGVCTVVNVLGVQRLADTNSVAVIWKFLVPVLTVITLMAVAF
FT                   HPGNFHAGGGFAPFGAHGVFAALPAGVVFALQGFEQAVQMGAEARDPGRDVPRAVILAT
FT                   VLGTAVYLLLAIAFLGALSPAGIAGGWSHPVGNGDYGPYATIATGLGLGWLAVLLYIDA
FT                   VVSPGGTALIYVGTSARLAYSMGQTGYLPRALRRLDRRGTPVVSILLAYAIGLVMFLPF
FT                   PSWQQLVTLISSATFLTYAFAPVALMVLRKVDPDRPRPFRLPLAPLLARVAFTTSNLIV
FT                   YWAGWENDQKLAVAIFAGLVCFTGYRATQPPGRWPPLEWRSALWIVPWLGGLTIISWLG
FT                   QFGSGRGVIPFWVDLGVIVVFSLAVFELAIRVTPPAARSRALLETELA"
FT   gene            733950..734306
FT                   /locus_tag="FraEuI1c_0584"
FT   CDS_pept        733950..734306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78662"
FT                   /db_xref="GOA:E3JCG6"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="UniProtKB/TrEMBL:E3JCG6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6492"
FT                   /protein_id="ADP78662.1"
FT                   /translation="MTSETSALARLTAERADAAAALAALRERFASLLDDSYVNTDDEHD
FT                   IEGTSIPFEREQVRATLREATTRLAEIDAALARLAAGRFGSCETCGGPIEPGRLDARPW
FT                   VRSCIGCASRPGRR"
FT   gene            734418..736232
FT                   /locus_tag="FraEuI1c_0585"
FT   CDS_pept        734418..736232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0585"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: nca:Noca_3235 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78663"
FT                   /db_xref="GOA:E3JCG7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR022506"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3JCG7"
FT                   /inference="similar to AA sequence:KEGG:Noca_3235"
FT                   /protein_id="ADP78663.1"
FT                   /translation="MTTKPWAEPGPPASTGQAEPVTTAQRRLVRGEARAGGYRPLVAGP
FT                   GEPVLVRTDLLAEAPGATPAGERRTLLAFAHLSDLHVVDHQSPARAEFLERVGDPDSPF
FT                   WEKVQE