(data stored in ACNUC29543 zone)

EMBL: CP002305

ID   CP002305; SV 1; circular; genomic DNA; STD; PRO; 4059653 BP.
XX
AC   CP002305;
XX
PR   Project:PRJNA38283;
XX
DT   19-NOV-2010 (Rel. 106, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Leadbetterella byssophila DSM 17132, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Leadbetterella byssophila DSM 17132
OC   Bacteria; Bacteroidetes; Cytophagia; Cytophagales; Cytophagaceae;
OC   Leadbetterella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4059653
RX   PUBMED; 21475582.
RA   Abt B., Teshima H., Lucas S., Lapidus A., Del Rio T.G., Nolan M., Tice H.,
RA   Cheng J.F., Pitluck S., Liolios K., Pagani I., Ivanova N., Mavromatis K.,
RA   Pati A., Tapia R., Han C., Goodwin L., Chen A., Palaniappan K., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Rohde M., Goker M., Tindall B.J.,
RA   Detter J.C., Woyke T., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Leadbetterella byssophila type strain (4M15)";
RL   Stand Genomic Sci 4(1):2-12(2011).
XX
RN   [2]
RP   1-4059653
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Teshima H., Brettin T., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Tindall B.,
RA   Pomrenke H.G., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Leadbetterella byssophila DSM 17132";
RL   Unpublished.
XX
RN   [3]
RP   1-4059653
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Teshima H., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Tindall B.,
RA   Pomrenke H.G., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (05-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3d27bc597f25fdeb04aad3b2a3774e9e.
DR   BioSample; SAMN00191237.
DR   CABRI; DSM 17132.
DR   EnsemblGenomes-Gn; EBG00001240490.
DR   EnsemblGenomes-Gn; EBG00001240491.
DR   EnsemblGenomes-Gn; EBG00001240492.
DR   EnsemblGenomes-Gn; EBG00001240493.
DR   EnsemblGenomes-Gn; EBG00001240494.
DR   EnsemblGenomes-Gn; EBG00001240495.
DR   EnsemblGenomes-Gn; EBG00001240496.
DR   EnsemblGenomes-Gn; EBG00001240497.
DR   EnsemblGenomes-Gn; EBG00001240498.
DR   EnsemblGenomes-Gn; EBG00001240499.
DR   EnsemblGenomes-Gn; EBG00001240500.
DR   EnsemblGenomes-Gn; EBG00001240501.
DR   EnsemblGenomes-Gn; EBG00001240502.
DR   EnsemblGenomes-Gn; EBG00001240503.
DR   EnsemblGenomes-Gn; EBG00001240504.
DR   EnsemblGenomes-Gn; EBG00001240505.
DR   EnsemblGenomes-Gn; EBG00001240506.
DR   EnsemblGenomes-Gn; EBG00001240507.
DR   EnsemblGenomes-Gn; EBG00001240508.
DR   EnsemblGenomes-Gn; EBG00001240509.
DR   EnsemblGenomes-Gn; EBG00001240510.
DR   EnsemblGenomes-Gn; EBG00001240511.
DR   EnsemblGenomes-Gn; EBG00001240512.
DR   EnsemblGenomes-Gn; EBG00001240513.
DR   EnsemblGenomes-Gn; EBG00001240514.
DR   EnsemblGenomes-Gn; EBG00001240515.
DR   EnsemblGenomes-Gn; EBG00001240516.
DR   EnsemblGenomes-Gn; EBG00001240517.
DR   EnsemblGenomes-Gn; EBG00001240518.
DR   EnsemblGenomes-Gn; EBG00001240519.
DR   EnsemblGenomes-Gn; EBG00001240520.
DR   EnsemblGenomes-Gn; EBG00001240521.
DR   EnsemblGenomes-Gn; EBG00001240523.
DR   EnsemblGenomes-Gn; EBG00001240524.
DR   EnsemblGenomes-Gn; EBG00001240525.
DR   EnsemblGenomes-Gn; EBG00001240526.
DR   EnsemblGenomes-Gn; EBG00001240527.
DR   EnsemblGenomes-Gn; EBG00001240528.
DR   EnsemblGenomes-Gn; EBG00001240529.
DR   EnsemblGenomes-Gn; EBG00001240530.
DR   EnsemblGenomes-Gn; EBG00001240531.
DR   EnsemblGenomes-Gn; EBG00001240532.
DR   EnsemblGenomes-Gn; EBG00001240533.
DR   EnsemblGenomes-Gn; EBG00001240534.
DR   EnsemblGenomes-Gn; EBG00001240535.
DR   EnsemblGenomes-Gn; EBG00001240536.
DR   EnsemblGenomes-Gn; EBG00001240537.
DR   EnsemblGenomes-Gn; EBG00001240539.
DR   EnsemblGenomes-Gn; EBG00001240540.
DR   EnsemblGenomes-Gn; EBG00001240541.
DR   EnsemblGenomes-Gn; EBG00001240542.
DR   EnsemblGenomes-Gn; EBG00001240544.
DR   EnsemblGenomes-Gn; EBG00001240545.
DR   EnsemblGenomes-Gn; EBG00001240546.
DR   EnsemblGenomes-Gn; EBG00001240547.
DR   EnsemblGenomes-Gn; EBG00001240548.
DR   EnsemblGenomes-Gn; EBG00001240549.
DR   EnsemblGenomes-Gn; EBG00001240550.
DR   EnsemblGenomes-Gn; EBG00001240551.
DR   EnsemblGenomes-Gn; EBG00001240552.
DR   EnsemblGenomes-Gn; EBG00001240553.
DR   EnsemblGenomes-Gn; EBG00001240554.
DR   EnsemblGenomes-Gn; EBG00001240555.
DR   EnsemblGenomes-Gn; EBG00001240556.
DR   EnsemblGenomes-Gn; EBG00001240557.
DR   EnsemblGenomes-Gn; EBG00001240558.
DR   EnsemblGenomes-Gn; EBG00001240559.
DR   EnsemblGenomes-Gn; Lbys_R0001.
DR   EnsemblGenomes-Gn; Lbys_R0002.
DR   EnsemblGenomes-Gn; Lbys_R0003.
DR   EnsemblGenomes-Gn; Lbys_R0004.
DR   EnsemblGenomes-Gn; Lbys_R0005.
DR   EnsemblGenomes-Gn; Lbys_R0006.
DR   EnsemblGenomes-Gn; Lbys_R0007.
DR   EnsemblGenomes-Gn; Lbys_R0008.
DR   EnsemblGenomes-Gn; Lbys_R0009.
DR   EnsemblGenomes-Gn; Lbys_R0010.
DR   EnsemblGenomes-Gn; Lbys_R0011.
DR   EnsemblGenomes-Gn; Lbys_R0012.
DR   EnsemblGenomes-Gn; Lbys_R0013.
DR   EnsemblGenomes-Gn; Lbys_R0015.
DR   EnsemblGenomes-Gn; Lbys_R0016.
DR   EnsemblGenomes-Gn; Lbys_R0017.
DR   EnsemblGenomes-Gn; Lbys_R0018.
DR   EnsemblGenomes-Gn; Lbys_R0019.
DR   EnsemblGenomes-Gn; Lbys_R0020.
DR   EnsemblGenomes-Gn; Lbys_R0021.
DR   EnsemblGenomes-Gn; Lbys_R0022.
DR   EnsemblGenomes-Gn; Lbys_R0023.
DR   EnsemblGenomes-Gn; Lbys_R0024.
DR   EnsemblGenomes-Gn; Lbys_R0025.
DR   EnsemblGenomes-Gn; Lbys_R0026.
DR   EnsemblGenomes-Gn; Lbys_R0027.
DR   EnsemblGenomes-Gn; Lbys_R0028.
DR   EnsemblGenomes-Gn; Lbys_R0029.
DR   EnsemblGenomes-Gn; Lbys_R0030.
DR   EnsemblGenomes-Gn; Lbys_R0031.
DR   EnsemblGenomes-Gn; Lbys_R0032.
DR   EnsemblGenomes-Gn; Lbys_R0033.
DR   EnsemblGenomes-Gn; Lbys_R0034.
DR   EnsemblGenomes-Gn; Lbys_R0035.
DR   EnsemblGenomes-Gn; Lbys_R0036.
DR   EnsemblGenomes-Gn; Lbys_R0037.
DR   EnsemblGenomes-Gn; Lbys_R0038.
DR   EnsemblGenomes-Gn; Lbys_R0039.
DR   EnsemblGenomes-Gn; Lbys_R0040.
DR   EnsemblGenomes-Gn; Lbys_R0041.
DR   EnsemblGenomes-Gn; Lbys_R0042.
DR   EnsemblGenomes-Gn; Lbys_R0043.
DR   EnsemblGenomes-Gn; Lbys_R0044.
DR   EnsemblGenomes-Gn; Lbys_R0045.
DR   EnsemblGenomes-Gn; Lbys_R0046.
DR   EnsemblGenomes-Gn; Lbys_R0047.
DR   EnsemblGenomes-Gn; Lbys_R0048.
DR   EnsemblGenomes-Gn; Lbys_R0049.
DR   EnsemblGenomes-Gn; Lbys_R0050.
DR   EnsemblGenomes-Gn; Lbys_R0051.
DR   EnsemblGenomes-Gn; Lbys_R0052.
DR   EnsemblGenomes-Gn; Lbys_R0053.
DR   EnsemblGenomes-Gn; Lbys_R0054.
DR   EnsemblGenomes-Tr; EBT00001585904.
DR   EnsemblGenomes-Tr; EBT00001585905.
DR   EnsemblGenomes-Tr; EBT00001585906.
DR   EnsemblGenomes-Tr; EBT00001585907.
DR   EnsemblGenomes-Tr; EBT00001585908.
DR   EnsemblGenomes-Tr; EBT00001585909.
DR   EnsemblGenomes-Tr; EBT00001585910.
DR   EnsemblGenomes-Tr; EBT00001585911.
DR   EnsemblGenomes-Tr; EBT00001585912.
DR   EnsemblGenomes-Tr; EBT00001585913.
DR   EnsemblGenomes-Tr; EBT00001585914.
DR   EnsemblGenomes-Tr; EBT00001585915.
DR   EnsemblGenomes-Tr; EBT00001585916.
DR   EnsemblGenomes-Tr; EBT00001585917.
DR   EnsemblGenomes-Tr; EBT00001585918.
DR   EnsemblGenomes-Tr; EBT00001585919.
DR   EnsemblGenomes-Tr; EBT00001585920.
DR   EnsemblGenomes-Tr; EBT00001585921.
DR   EnsemblGenomes-Tr; EBT00001585922.
DR   EnsemblGenomes-Tr; EBT00001585923.
DR   EnsemblGenomes-Tr; EBT00001585924.
DR   EnsemblGenomes-Tr; EBT00001585925.
DR   EnsemblGenomes-Tr; EBT00001585926.
DR   EnsemblGenomes-Tr; EBT00001585927.
DR   EnsemblGenomes-Tr; EBT00001585928.
DR   EnsemblGenomes-Tr; EBT00001585929.
DR   EnsemblGenomes-Tr; EBT00001585931.
DR   EnsemblGenomes-Tr; EBT00001585932.
DR   EnsemblGenomes-Tr; EBT00001585933.
DR   EnsemblGenomes-Tr; EBT00001585934.
DR   EnsemblGenomes-Tr; EBT00001585936.
DR   EnsemblGenomes-Tr; EBT00001585937.
DR   EnsemblGenomes-Tr; EBT00001585938.
DR   EnsemblGenomes-Tr; EBT00001585939.
DR   EnsemblGenomes-Tr; EBT00001585940.
DR   EnsemblGenomes-Tr; EBT00001585941.
DR   EnsemblGenomes-Tr; EBT00001585942.
DR   EnsemblGenomes-Tr; EBT00001585943.
DR   EnsemblGenomes-Tr; EBT00001585944.
DR   EnsemblGenomes-Tr; EBT00001585945.
DR   EnsemblGenomes-Tr; EBT00001585946.
DR   EnsemblGenomes-Tr; EBT00001585947.
DR   EnsemblGenomes-Tr; EBT00001585948.
DR   EnsemblGenomes-Tr; EBT00001585949.
DR   EnsemblGenomes-Tr; EBT00001585950.
DR   EnsemblGenomes-Tr; EBT00001585951.
DR   EnsemblGenomes-Tr; EBT00001585952.
DR   EnsemblGenomes-Tr; EBT00001585953.
DR   EnsemblGenomes-Tr; EBT00001585954.
DR   EnsemblGenomes-Tr; EBT00001585955.
DR   EnsemblGenomes-Tr; EBT00001585956.
DR   EnsemblGenomes-Tr; EBT00001585957.
DR   EnsemblGenomes-Tr; EBT00001585958.
DR   EnsemblGenomes-Tr; EBT00001585959.
DR   EnsemblGenomes-Tr; EBT00001585960.
DR   EnsemblGenomes-Tr; EBT00001585961.
DR   EnsemblGenomes-Tr; EBT00001585962.
DR   EnsemblGenomes-Tr; EBT00001585963.
DR   EnsemblGenomes-Tr; EBT00001585964.
DR   EnsemblGenomes-Tr; EBT00001585965.
DR   EnsemblGenomes-Tr; EBT00001585966.
DR   EnsemblGenomes-Tr; EBT00001585967.
DR   EnsemblGenomes-Tr; EBT00001585968.
DR   EnsemblGenomes-Tr; EBT00001585969.
DR   EnsemblGenomes-Tr; EBT00001585970.
DR   EnsemblGenomes-Tr; EBT00001585972.
DR   EnsemblGenomes-Tr; EBT00001585973.
DR   EnsemblGenomes-Tr; Lbys_R0001-1.
DR   EnsemblGenomes-Tr; Lbys_R0002-1.
DR   EnsemblGenomes-Tr; Lbys_R0003-1.
DR   EnsemblGenomes-Tr; Lbys_R0004-1.
DR   EnsemblGenomes-Tr; Lbys_R0005-1.
DR   EnsemblGenomes-Tr; Lbys_R0006-1.
DR   EnsemblGenomes-Tr; Lbys_R0007-1.
DR   EnsemblGenomes-Tr; Lbys_R0008-1.
DR   EnsemblGenomes-Tr; Lbys_R0009-1.
DR   EnsemblGenomes-Tr; Lbys_R0010-1.
DR   EnsemblGenomes-Tr; Lbys_R0011-1.
DR   EnsemblGenomes-Tr; Lbys_R0012-1.
DR   EnsemblGenomes-Tr; Lbys_R0013-1.
DR   EnsemblGenomes-Tr; Lbys_R0015-1.
DR   EnsemblGenomes-Tr; Lbys_R0016-1.
DR   EnsemblGenomes-Tr; Lbys_R0017-1.
DR   EnsemblGenomes-Tr; Lbys_R0018-1.
DR   EnsemblGenomes-Tr; Lbys_R0019-1.
DR   EnsemblGenomes-Tr; Lbys_R0020-1.
DR   EnsemblGenomes-Tr; Lbys_R0021-1.
DR   EnsemblGenomes-Tr; Lbys_R0022-1.
DR   EnsemblGenomes-Tr; Lbys_R0023-1.
DR   EnsemblGenomes-Tr; Lbys_R0024-1.
DR   EnsemblGenomes-Tr; Lbys_R0025-1.
DR   EnsemblGenomes-Tr; Lbys_R0026-1.
DR   EnsemblGenomes-Tr; Lbys_R0027-1.
DR   EnsemblGenomes-Tr; Lbys_R0028-1.
DR   EnsemblGenomes-Tr; Lbys_R0029-1.
DR   EnsemblGenomes-Tr; Lbys_R0030-1.
DR   EnsemblGenomes-Tr; Lbys_R0031-1.
DR   EnsemblGenomes-Tr; Lbys_R0032-1.
DR   EnsemblGenomes-Tr; Lbys_R0033-1.
DR   EnsemblGenomes-Tr; Lbys_R0034-1.
DR   EnsemblGenomes-Tr; Lbys_R0035-1.
DR   EnsemblGenomes-Tr; Lbys_R0036-1.
DR   EnsemblGenomes-Tr; Lbys_R0037-1.
DR   EnsemblGenomes-Tr; Lbys_R0038-1.
DR   EnsemblGenomes-Tr; Lbys_R0039-1.
DR   EnsemblGenomes-Tr; Lbys_R0040-1.
DR   EnsemblGenomes-Tr; Lbys_R0041-1.
DR   EnsemblGenomes-Tr; Lbys_R0042-1.
DR   EnsemblGenomes-Tr; Lbys_R0043-1.
DR   EnsemblGenomes-Tr; Lbys_R0044-1.
DR   EnsemblGenomes-Tr; Lbys_R0045-1.
DR   EnsemblGenomes-Tr; Lbys_R0046-1.
DR   EnsemblGenomes-Tr; Lbys_R0047-1.
DR   EnsemblGenomes-Tr; Lbys_R0048-1.
DR   EnsemblGenomes-Tr; Lbys_R0049-1.
DR   EnsemblGenomes-Tr; Lbys_R0050-1.
DR   EnsemblGenomes-Tr; Lbys_R0051-1.
DR   EnsemblGenomes-Tr; Lbys_R0052-1.
DR   EnsemblGenomes-Tr; Lbys_R0053-1.
DR   EnsemblGenomes-Tr; Lbys_R0054-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01705; Flavo-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP002305.
DR   SILVA-SSU; CP002305.
DR   StrainInfo; 662089; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083304
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Leadbetterella byssophila 4M15, DSM 17132
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: South Korea
CC   environment         :: Missing
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 17132, KACC 11308
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02316
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 115032
CC   Funding Program     :: DOE-GEBA 2007
CC   Isolation Site      :: Cotton-waste composts used as mushroom
CC                          cultivation in South Korea
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Nonmotile
CC   Temperature Range   :: Mesophile
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Sanger
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4059653
FT                   /organism="Leadbetterella byssophila DSM 17132"
FT                   /strain="DSM 17132"
FT                   /mol_type="genomic DNA"
FT                   /country="South Korea"
FT                   /isolation_source="cotton waste composts used for mushroom
FT                   cultivation"
FT                   /db_xref="taxon:649349"
FT   gene            93..1490
FT                   /locus_tag="Lbys_0001"
FT   CDS_pept        93..1490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR018312:IPR001957:IPR013317:IPR013159:IPR
FT                   020591:IPR003593; KEGG: dfe:Dfer_0001 chromosomal
FT                   replication initiator protein DnaA; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15797"
FT                   /db_xref="GOA:E4RRG8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRG8"
FT                   /protein_id="ADQ15797.1"
FT                   /translation="METAVKNDVAQVWKDCLMVIREHVTEQSFKTWFEPIIPYKLINKR
FT                   LIIQVPSQFFYEWLENNYVKILRKALDYAIGKDGQLEYTIIIDSGGQKAAQKKVETPKE
FT                   DSRVIPKNPFEIKTSSDIIFDSQLNKNYRFENYVEGSCNRLARAASVAVAQKPSVTAFN
FT                   PLMIYGDVGLGKTHLVQAIGNYIEDQPGNNKLVLYVSSEKFTSQFINAIRDNSLQDFMN
FT                   FYMMVDVLIIDDIQFLAGKEKTQETFFHIFNHLHQSGKQIVMTSDRPPRELSGMEDRLL
FT                   SRFKWGLTTDIQIPDLETRMAIIQNKLATEKAEMDMEVVEYLANCVDSNVRELEGVLNS
FT                   LIVDSALLQRKIDIELAKYRIKSLVEESQKAISIDKIIDVVTSHFNIKVADIKGKTRLR
FT                   EVVLPRQIAMFLTKEYTELSLKAIGYHFGGRDHSTVIHAIQTINDLQNQDRELQMHIKE
FT                   IKEKLKK"
FT   gene            1490..2488
FT                   /locus_tag="Lbys_0002"
FT   CDS_pept        1490..2488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0002"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro IPR013154:IPR013149;
FT                   KEGG: bvu:BVU_0222 sorbitol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: Sorbitol dehydrogenase;
FT                   PFAM: Alcohol dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15798"
FT                   /db_xref="GOA:E4RRG9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRG9"
FT                   /protein_id="ADQ15798.1"
FT                   /translation="MALTISSPGTISLIPDEYVSVGAGEVLLQLNYVGFCGSDLSTFLG
FT                   KNPLVKYPVIPGHEISAVIHAVGADVPSHLLPGTPCTVHPYTSCGKCTACQKGKTNACQ
FT                   FNQTLGVQRDGAMRGFIAVPWQKVILAPGLNAQELAMVEPLSVGYHAVSRGQVSEKDTV
FT                   LIIGLGMIGVGVLFGVLSRGAKAIVVDQDQRKLDQALQWGASEAYLSANVKDVSPDVII
FT                   EAVGSPVTYRNAIDWAPFGGRVVYIGYALPEVAFETRWFVQKELDIKGSRNALAEDFEA
FT                   VVNYLRAGSFDLQPLISKIIQPEDAAQTIQEWIKSPGDIYRILVQWNGRLS"
FT   gene            complement(2459..3472)
FT                   /locus_tag="Lbys_0003"
FT   CDS_pept        complement(2459..3472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0003"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843:IPR001761; KEGG: phe:Phep_0779 periplasmic
FT                   binding protein/LacI transcriptional regulator; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI;
FT                   SPTR: Putative LacI-family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, lacI family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15799"
FT                   /db_xref="GOA:E4RRH0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH0"
FT                   /protein_id="ADQ15799.1"
FT                   /translation="MEKPATIIDIAKALNISPSTVSRALNNHPSISSQTKEQVNELANK
FT                   LNYHPNLTARNLLKKKSGIIGVVVPEITSYFFSTVITGIQDVVSSVGYKLIISQTNENF
FT                   DEEKKLIHEMAQMRVEGLLVSPSFNTQGFEHLEDARKAGIPVVLFDRDIPGFESSKVFV
FT                   DVYDGAYQAVKYLIEAGCQRIAHIAGPEHIPTFQERMSAYQNALKDYNRELYPELIIKS
FT                   TGFSAEDGVEACEHLLSQSFDALFCVNDAVAIGAMHVLREKGYKIPEDISVIGYDDEPY
FT                   SCYFSPGLTTIWQPVYDMGMLSSKILLDTITKEKQTIRKEILKPELVLRQSSVPLN"
FT   sig_peptide     complement(3404..3472)
FT                   /locus_tag="Lbys_0003"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            3818..6790
FT                   /locus_tag="Lbys_0004"
FT   CDS_pept        3818..6790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0004"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   pru:PRU_2610 outer membrane receptor (OMR) family
FT                   transporter; PFAM: TonB-dependent receptor plug;
FT                   TonB-dependent receptor; SPTR: Putative uncharacterized
FT                   protein; PFAM: TonB dependent receptor; TonB-dependent
FT                   Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15800"
FT                   /db_xref="GOA:E4RRH1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH1"
FT                   /protein_id="ADQ15800.1"
FT                   /translation="MNVCKLFQRALSLVLLLFVYAGVMAQSDVKGTVTDVAGEALPGVT
FT                   VSVKGGTVGTMTDVDGNFTIRAQRGETLVFSYVGYVTKEALVSGTAVNVQLEEDRKTLD
FT                   EVIVVGYGSMAKKDITSSITSIKQEDFNQGVYTDPAQLLQGKVPGLTISNNNSDPNASP
FT                   SVTLRGSSTLRSGAAMEPYYVIDGVPGASLSLVSPDDIVSIDVLRDASATAIYGSKAAN
FT                   GVIIVTTKRGKSGQASVTYSGYVSVDKIRKRLEMMNAQQYKDFVLNNGFSLDPYDDTGA
FT                   DTDWQKEVSRTGFSQNHNISINGGNEKTRYSTSVNYLRNLGVIKGSGRERYVARAFVET
FT                   QAMQDKLTVSFNVNASTSTRNNVPAQGQGLSVYDAMYYYLPMSSVKRPDGSWFEYPQRS
FT                   QYANPVSLLEESTILSKDKVIQAHARGSYQIFKDLRYNLDLSYQNSQFNYANYYTSKSM
FT                   VAAGMNGKSTRSAVEGQRKVMEMNLAYDKILNNRHKVGLLGGYSWEENNDNDGFQLTTY
FT                   NYYSDDLSYHNPGMANNIDLNGFGGYNLSTLRMISFYGRANYSLDGKYLFQATVRRDGS
FT                   SAFGANNRWATFPSVSFAWRISDEEFAKGTFDDLKFRIGYGVSGNSLGFDVFTATQVYG
FT                   ATGWFTNSEGNLVRTLGAVRNSNPDLRWEKTDMLNIGLDFAILKNRLSGTIEVYNKNTS
FT                   DLIYDYPVSTTKYLYSYLTTNVGEINNKGIEFTLSAVPVKKKSFSWNTGLTLSHNKNVV
FT                   KKISNQEFSVNYLNLSNLDGAGQSGMTQQRVMEGYPIGTFYTWEWAGYNDQGVSVYYVH
FT                   DPATGERTGELTTTPQDKDRAYTGSAQPKLVLGWNNNFNYKRFGLTATFQGLFGNKIMN
FT                   GTRARHSNVVGNAGNKNLLADVLKTEKVTDYNAHFLSDRYLEKGDYLRLAQLSGSYSIG
FT                   KIGSGIKNARVFMTVNNAFVLTKYKGLDPEVFLGGITPGIDNRQTYPRTRTVMFGLNLN
FT                   L"
FT   sig_peptide     3818..3898
FT                   /locus_tag="Lbys_0004"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            6796..8421
FT                   /locus_tag="Lbys_0005"
FT   CDS_pept        6796..8421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0005"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: pru:PRU_2611 putative
FT                   lipoprotein; PFAM: RagB/SusD domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH2"
FT                   /protein_id="ADQ15801.1"
FT                   /translation="MKFKTILATALVVGGCTDLDVKIKSQYTSFPDSETAAEAVSADIY
FT                   NAYRGAMGVAHWMVNTLSSDEAVSVAMGSDYYDGGIYRQYVVHDWNRDNGYLNTIWNSA
FT                   MTGVTSCNKVLALLGNDESEVAAPVRAMRAYYFYILLEHFGAVPLITSMGDEQPDRAPR
FT                   AEVVRFVESELLAVKDKLTTDVNASTYGKATKYMAEALLAKIYLNWAVYTASDVASYTP
FT                   SAPNEKLNEVVKMCDAIIASGKFNLSDRYLLKFRPDNGPHIKDFIFVMPFDRERQQGMT
FT                   YARYWIHRSAQKQFGDLPQSVGGTHRVLPEFLAKFNLPGDQRNDQFIGGKQYYWENYAP
FT                   TSRPFLINTSKRGIDQDYNGPDADDKFDWQVEFSKEITLRPDGGPTLNVGNDQKGRSMG
FT                   YRSIKFYMDVNVTAAQNRSQSNDVPIFRLADIYLMKAEAILRGATATNGDSPASLINKI
FT                   RAYVGAPAITGTPTLEDLLDERAREFADESWRRNDLIRFGKFEDNWGFKSLYPAGFTEK
FT                   FRRIFPVPRDVMNVNTNWSQNPGY"
FT   sig_peptide     6796..6846
FT                   /locus_tag="Lbys_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            8641..11721
FT                   /locus_tag="Lbys_0006"
FT   CDS_pept        8641..11721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0006"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="InterPro IPR002105:IPR012910:IPR000531; KEGG:
FT                   zpr:ZPR_1016 TonB-dependent receptor Plug domain protein;
FT                   PFAM: TonB-dependent receptor plug; TonB-dependent
FT                   receptor; SPTR: TonB-dependent Receptor Plug domain
FT                   protein; PFAM: TonB dependent receptor; TonB-dependent
FT                   Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15802"
FT                   /db_xref="GOA:E4RRH3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH3"
FT                   /protein_id="ADQ15802.1"
FT                   /translation="MKMISKLQAFCLQGKGWLAIAFFVGLTLPLHAQKVISGKVSSGGE
FT                   VLVGVTVNEKGTANSHFTDANGQFKITVANENAILVFSFVGFNTVEERVGNRSDLNIQM
FT                   AEANKDLDEVVIIGYGQAKKSDLTGSVSSLNAESIQRANKTNAFQAMQGQVAGVNLQLT
FT                   DNKPGGAFNVRIRGSNTINSGESIENAGYSAGQNPLYIVDGIFVNDISFLNPADIDKMD
FT                   ILKDASATAIYGSRGTNGVVIIKTKGGAKGRLSVSYDNYFGTKESYRRPEMLQGEDFVD
FT                   YFKDAVVGLQWAGGNRNFTRADVDLSKYMRPNELENIKAGTYTDWINLVDTKGFQTNHT
FT                   LGLSGGNENTTFGMGVAYTKDEGTFRGEAFERYTMRANLNSNILPNVTLGYTNYIALST
FT                   RDEGSKEGLRSAYRLRPTGSAYDSEGKLQFFPLQGESFITNPLFEPDNWTLQTRSLNYL
FT                   GNLSLEIRPIKNLKISTNFSPNVEFTRAGEYIGRYSKATSGNQQNTRAIVNNRNRMSYT
FT                   WDNIINYDLKWSDKHQVLATLVYSQFYDRNERYYGERRNFTTDQYLFYNQAAGSVVQGL
FT                   TSGMSKQTLESYTARLNYNFNSKYLFTLTGRYDGSSILAENNKWAFFPSAAFAWRIIEE
FT                   DFMSSVPSLSDLKLRLSYGQTGNNGTGGGLGPLASLSLIGSNFVNIGDQVIQTAFVSGL
FT                   ANQDLTWERTKEWNIGADFGFLKNRITGTLDLYNRNNTDIIFFRPVPSATGYSGVFDNV
FT                   GEATNRGIELGITSKNLVKKDFTWSTTLNFAANRNKITKLYGGVDEILFSVQGGSYAHK
FT                   VGHPIGSIYTYEFDGIWQLNEVEEAKKYGQLPGQVKVKDIDGNGIINADDRTVIGSAMP
FT                   KWTGGLTNTFDYKNIDFSFFLHTSQGAISNSYFHLSHGGRFDSTPARFNSAKLNFWTPE
FT                   NPSNEWYQPSNQGPYVEAIQYMDVSYVKVGYITLGYTINPRFLERYKVKSARLYLTGQN
FT                   PFTFSKYHGFDPETAVRNSYASAHMTRTWMGGLNIKF"
FT   sig_peptide     8641..8703
FT                   /locus_tag="Lbys_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            11724..13316
FT                   /locus_tag="Lbys_0007"
FT   CDS_pept        11724..13316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0007"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: zpr:ZPR_1015 hypothetical
FT                   protein; PFAM: RagB/SusD domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15803"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH4"
FT                   /protein_id="ADQ15803.1"
FT                   /translation="MKKNILTLIIAALSLSSCSNFLEEENRQSLTSNEIFQDPSSFDGL
FT                   VGQIYYLARNATSLYNINHLGTDIYTRGAIVAGIDELNDYVNLRPFNGSVSSAWTTNYR
FT                   LIAAANVAIDRSNEISGLTETAKSKGLGQAKFFRAFAYFNLVEQFGPVPLILNEVRSAQ
FT                   VDLKRVEEVEVYAQILKDLDEALAAVDETPALYGTVSKDAVRHLKAQVLLTRGYKSFKG
FT                   ANDFSEAASLAETVISRHPLASDFAQFFTKAGQRNNEVVFALLYGSNPVTRREGNDRHL
FT                   LFKFSYDVYPGMTRSTLYHRGLGPAPTPYFFSLFEEGDKREAATLRRTLLAEIADAERG
FT                   VKVGDTVIHFPKTPWSQALIGSKSYTVVNPENYFIPNGTTQIQYPMFRKFDDPGVPYTN
FT                   GGIDPEGERDAVIMRSGEAYLFAAEAYLQMGDKVKAATFINALRTRAGWNKPVTADQMT
FT                   IDVILEESARELAGETSRWMELKRTGKLMERALKYNPHVALNNALRDFHLLRPIPNSEI
FT                   DASGGSLTQNNGY"
FT   sig_peptide     11724..11810
FT                   /locus_tag="Lbys_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            13361..15112
FT                   /locus_tag="Lbys_0008"
FT   CDS_pept        13361..15112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_1222 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15804"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH5"
FT                   /protein_id="ADQ15804.1"
FT                   /translation="MNRKQFIKDTLGYSAALFLAPQFLSSAQPIPASDLMKRLIVGNDN
FT                   FVEKFLSLGKEGPKQGGRAYGYNFAKLSAAYVNPQSRFHKSDKIVTALEEIAVHFNNVL
FT                   APDGTMNAGNIESPPDTAFVMEPLCSGIHILNQSKEKALDKAKALIKIPVERVGAALTV
FT                   GGVHTPNHRWEISSALAWINKVYPNQKYVNRIDEWLSEGIYIDQDGHYPERSMNYADVE
FT                   NRGFITMGHLLNRPELYAAPLKSLEMAWYYTDVNGELITFDSRRQDQYGSKEIMVQYLH
FT                   YRFLAIEKNNGLFSAICRFMESLPEFEKDVIQNELYRFMAVPLLAKELPTPAALPTNYE
FT                   KLFTTSHLARIRRGDTSMTIFGGNDFPLIIASGRSVSPNFFGYRKGKAALKHVRMSSRF
FT                   FSMGFFRGDGLEKEGDRYKLHEVKKAPYYQPLKPEDRKKDGDYELTPSVDDRFWSKMSF
FT                   DKRKPDFKVQESTVWVREENGEVFLDFEVNGPEGVAITIDLCFGAEGTLKNVQNSNGQV
FT                   NFLPEGYGEYTVGNDKITFGPGIKKHEWTRGLEGEKYSVFNGNLNTPGHHVYLTGVTPF
FT                   KHSLKIS"
FT   sig_peptide     13361..13441
FT                   /locus_tag="Lbys_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            15109..16365
FT                   /locus_tag="Lbys_0009"
FT   CDS_pept        15109..16365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_4229 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15805"
FT                   /db_xref="InterPro:IPR032342"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH6"
FT                   /protein_id="ADQ15805.1"
FT                   /translation="MKRVLIALAFAVLGCNPKTQLTIENESTIDLQDKPVILSKSEIPG
FT                   GIQDGLFPTVLSPNGELVPSQIEDVDGDGIWDQLVFVADFQAGEAKKFDIAWVNHLPEF
FT                   TKRTSVRFGVRDSLNDVVKPKITDVFFPHELPGVNGYQPYQTDGPSWENDKVGFRHYLD
FT                   GRNSKDVFGKKVEYMSPENVGINKDGVTEDNYHVMEEWGRDIMNVGNSLGLGGISLEIG
FT                   GERLRRLGIIEGDPKGNVDSTVFTILQEGPVHSQMLFDYKSWRPLDEDRTYNLTETVEI
FT                   WPGVHGYKNTVHLKDPKGDEVVLVGLVNSRTNKPLSTIYENEEWMVLGTHDKQTYEKEW
FT                   YLGLALVLPKSAFINTIKAPDEGRISKTYLARMKADQPFSYYAMACWELRDSGFVDEEY
FT                   YQKYLQNFVDQLTVKLKVR"
FT   sig_peptide     15109..15159
FT                   /locus_tag="Lbys_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            16362..17681
FT                   /locus_tag="Lbys_0010"
FT   CDS_pept        16362..17681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0010"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="COGs: COG4225 unsaturated glucuronyl hydrolase
FT                   involved in regulation of surface properties and related
FT                   protein; InterPro IPR010905; KEGG: sli:Slin_0456 glycosyl
FT                   hydrolase family 88; PFAM: glycosyl hydrolase family 88;
FT                   SPTR: Glycosyl hydrolase family 88; PFAM: Glycosyl
FT                   Hydrolase Family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15806"
FT                   /db_xref="GOA:E4RRH7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH7"
FT                   /protein_id="ADQ15806.1"
FT                   /translation="MIKRILALCLGTWQVFGQVTDGNTPLHLIPPAYPHAYGKATPASI
FT                   KEDLDKIYTYLNAVTPMELVDKNTGRSLKSPTTNAMFKKGDYRLFSYEWGVTYSAMLTA
FT                   AEVSGDSRYKEYALQRMQYLSQLAAYYKSNSSLEEQKSSPVASILHPHALDDAGALGMA
FT                   MIKGLNTQNKGQLTPVIEHFLDFIMNKEYRLPDGTFARNRPLKNTVWLDDMFMSVPAIA
FT                   YMGKLTGEKKYFDEATKQVKQFSQRMFDTQKNIFIHGWLEESAVQPKFHWGRANGWAIM
FT                   AITELLTVLPKEHPDRSVIMDLYLKHVQGLAALQSGSGFWHQLLDKSDTYLETSATAIF
FT                   TYSICKGINEGWLDYEAFGPMVLLAWEALSTQITPDGKVTGTCVGTGMGFDPAFYYYRP
FT                   VNPYAAHSYGPMLLAGSEVMKLLKNRSYGINETAVQFLQR"
FT   sig_peptide     16362..16412
FT                   /locus_tag="Lbys_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            17641..18714
FT                   /locus_tag="Lbys_0011"
FT   CDS_pept        17641..18714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2685 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15807"
FT                   /db_xref="GOA:E4RRH8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR032075"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH8"
FT                   /protein_id="ADQ15807.1"
FT                   /translation="MESMKLLFSSFSVKALVLLSVQTVNAQEKLNHVQVIGTHNSYKTA
FT                   IDKPVMDTLMSFNPKWGVRFDYSHEPIDVQLNLGLANLEIDIAVDRNGGKFSKPALYEL
FT                   FKDQVPPYNQDGEMDKPGLKVLHMQDLDFRSHCGTLSTCLQILRKWSDEHPQHHPVFIT
FT                   MNAKTGPVNHLPTVADEFEKEDYQELNSLIWKELGPGKLLIPKDVQGNFPTLEAAILKK
FT                   GWPTINSVRGKFIFVLDETGAKRSTYLNSGSEVQVMFTDSPEGDPNAAILIKNDPKKQK
FT                   EEIKSLVKKGYIIRTRADADTFEARNEDYSRFQAACESGAQIITTDYYRESTHFPSSYK
FT                   IIFPEGKYVRVNPLLKK"
FT   sig_peptide     17641..17718
FT                   /locus_tag="Lbys_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            18812..19750
FT                   /locus_tag="Lbys_0012"
FT   CDS_pept        18812..19750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0012"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771; KEGG: dfe:Dfer_5696
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; PRIAM: Fructose-bisphosphate aldolase;
FT                   SPTR: Ketose-bisphosphate aldolase; TIGRFAM:
FT                   ketose-bisphosphate aldolase; manually curated; PFAM:
FT                   Fructose-bisphosphate aldolase class-II; TIGRFAM:
FT                   ketose-bisphosphate aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15808"
FT                   /db_xref="GOA:E4RRH9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRH9"
FT                   /protein_id="ADQ15808.1"
FT                   /translation="MLISPKEMFGKCYGQYAIAAINVFHMEQVLAVFSAASKAKSPVII
FT                   QTTPVARNYAGHGMLLAMITAASEKYPEVVYAIHLDHGFEEHIDDALSRGGYTSVMIDA
FT                   SHDDFQINIERTRAIVSKAHAKGVVVEAELGILSGVEDDMEVGAEHARFTQPDEAVTFV
FT                   EATGCDSLAIAVGTSHGAYKFSGKQGIQFPILKEIQSRMPGFPLVLHGGSSVSQEEVLR
FT                   VNAAGGQMKEGSRGVSDEEITEAIKYGICKINVATDLRVLWARVHREYFRDQPELFDSV
FT                   PPGQIYMRELEAFCLEKFEKLGSAGRAQEYL"
FT   gene            19762..20616
FT                   /locus_tag="Lbys_0013"
FT   CDS_pept        19762..20616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0013"
FT                   /product="5-deoxyglucuronate isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="COGs: COG3718 Uncharacterized protein involved in
FT                   inositol metabolism; KEGG: dfe:Dfer_5701 myo-inositol
FT                   catabolism IolB domain protein; SPTR: Myo-inositol
FT                   catabolism IolB domain protein; PFAM: KduI/IolB family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15809"
FT                   /db_xref="GOA:E4RRI0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI0"
FT                   /protein_id="ADQ15809.1"
FT                   /translation="MRDTLIVKPNYKEEEYIHITPSSAGWEHLSFAARNMKKGEVWKHQ
FT                   TGNHEYAIILLGGDFSVKSNRGEWVTENGRKDVFSGIAHTLYLPANTDFELVAESEILD
FT                   IAYGWCRTDKQLDPVFKLPSEAEIEIRGGDNATRQINSLVQPGFPCDRLVAVEVYTPSG
FT                   NWSSFPAHKHDERKVDENGVLLEACLEETYFYKIDKPQGYAIQQVYTDDRSLDVVNVVK
FT                   HNEVVLVPKGYHPVVAGHGYNVYYLNFLAGSDQSLANTPDPDHAWIFGTWKGIDERIPM
FT                   VKS"
FT   gene            20613..21617
FT                   /locus_tag="Lbys_0014"
FT   CDS_pept        20613..21617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0014"
FT                   /product="5-dehydro-2-deoxygluconokinase"
FT                   /EC_number="2.7.1.92"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002173:IPR011611; KEGG: dfe:Dfer_5700 PfkB
FT                   domain protein; PFAM: PfkB domain protein; SPTR: PfkB
FT                   domain protein; PFAM: pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15810"
FT                   /db_xref="GOA:E4RRI1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI1"
FT                   /protein_id="ADQ15810.1"
FT                   /translation="MKYDIVAMGRSSIDLYSQNIGADFVDIKGFDAFVGGSPLNIVTGC
FT                   QRLGLNTALLTGVGADKVGDFILNFLKNEGIETKFIPTIPHARSSAVILGIQPPDTFPL
FT                   VYYRHNAADTHVNIDHVNAVNMEEVRLFEVSGTALSLEPSRSAVFHAMERANAAGVTTV
FT                   LDIDFRADQWSDLRSFGIMVRALLPKVKIAIGTEEEILAAMLKDSRQVEITHQQISAPT
FT                   IHGDVEEAIQGLMDLGVEILLVKRGSKGVSVYQKGQETFNVPGFPVEPLNVLGAGDAFA
FT                   SGFIYGYLQGWDLYKSCRMGNASGAQVVLQPGCANFMPTLEESMKFIEEHGGF"
FT   gene            21628..23478
FT                   /locus_tag="Lbys_0015"
FT   CDS_pept        21628..23478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0015"
FT                   /product="3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
FT                   hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /note="COGs: COG3962 Acetolactate synthase; InterPro
FT                   IPR000399:IPR012001:IPR012000:IPR011766; KEGG:
FT                   dfe:Dfer_5695 thiamine pyrophosphate protein central
FT                   region; PFAM: thiamine pyrophosphate central
FT                   domain-containing protein; thiamine pyrophosphate
FT                   TPP-binding domain-containing protein; SPTR: Thiamine
FT                   pyrophosphate protein central region; PFAM: Thiamine
FT                   pyrophosphate enzyme, central domain; Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15811"
FT                   /db_xref="GOA:E4RRI2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI2"
FT                   /protein_id="ADQ15811.1"
FT                   /translation="MKLTVAQALIRFLDQQYVERDGVEHKFFAGCFGIFGHGNVGGIGQ
FT                   ALFENPEFRYYQARNEQAMVHTAVAYSKMKNRLETFACTSSIGPGATNMVTGAALATIN
FT                   RIPVLLLPGDIFATRHIGPVLQQLEDPSNADASVNDTFKPVSRFWDRVNRPEQLISSLL
FT                   QAMRVLTSPAETGAVTICLPQDVQAEAYDYPEEFFKKRVWYMGRPLPDAQLLQRAAQII
FT                   KEAKKPMIIAGGGVIYSEACSTLAEFSKNTGIAVAETFAGKGSLNFDHPLNLGAAGATG
FT                   TEGANAYAAEADVVIGVGTRYSDFTMASHTAFQNPDVKFININIAEFDAYKQSALPLTG
FT                   DAKTTLEALGRLLGGYKTSKEYQEQAAAYNVSWDQKVAEAYAVVAEDSMSQAEVIGAVN
FT                   SFAGPKDVMVCAAGSMPGDLHKLWRCTDPKNFHMEYGYSTMGYEIAGGLGVKMADPSRE
FT                   VYVMVGDGSYLMLSSEIVTAVQEGVKLTIVLINNHGYASIGGLSKSLGSEGFGTQYRYR
FT                   GEKHFDGDALPYDLATNAESLGATVLRTSNESSFKAALEQAKKNANTTVIYIETPPERK
FT                   MAGYGHAWWEVPVSEVSNTASIQEAYEKLTLNKKRQRWHL"
FT   gene            23485..25068
FT                   /locus_tag="Lbys_0016"
FT   CDS_pept        23485..25068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0016"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="COGs: COG4146 symporter; InterPro
FT                   IPR019900:IPR001734; KEGG: plu:plu1803 putative symporter
FT                   YidK; PFAM: Na+/solute symporter; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: SSS sodium solute
FT                   transporter superfamily; PFAM: Sodium:solute symporter
FT                   family; TIGRFAM: transporter, SSS family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15812"
FT                   /db_xref="GOA:E4RRI3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI3"
FT                   /protein_id="ADQ15812.1"
FT                   /translation="MNTLTIITFVGFTLLTGAYAYFKTRKENLETQEGYFLGGRSLTGI
FT                   VIAASMIMTNISTEHLVGMNGSAYKNGFIIVAWEVTSALALIVAAVYFVPRYLRMGLTT
FT                   IPEYLEKRFDTVTRSMISLFLLVSFAVTLLPIVLYTGAINIESIFDISEVLQISKETGL
FT                   WMTIVIVGVIGSLYAVFGGLKAVSFSDVIYGYGLFLGGLMIPVLALWHIGDGNMLTGFV
FT                   KVFENSPEKFSVIGSEDSVMPFSTLFTGLIINQLYFWCMNQTIVQRVLGAKNLEEAQKG
FT                   LLFTGLAKILIPFVIVLPGVIAFYYFGEQYYEEQDSVYPALVKKVMPVAFLGFFAAVIM
FT                   GAVLSTFNAVLNSASTIFSIDVYKRMIDVNASDKKLVVMGKLTAAILAITSIIAAPFVA
FT                   NAPEGLFQLLQQLNGIFFIPIASIILAGFFFPQISAAGAKVSLLTGFLFYVTCIYIYPV
FT                   DIHFIHLWGIEFLLNLAVMFAVSKFYPQPVMELQPSREVVELKAWKYTKPFAIFLVIIT
FT                   IGIYIFLGNI"
FT   sig_peptide     23485..23544
FT                   /locus_tag="Lbys_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            25079..26554
FT                   /locus_tag="Lbys_0017"
FT   CDS_pept        25079..26554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0017"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016160:IPR010061:IPR015590; KEGG: dfe:Dfer_5699
FT                   methylmalonate-semialdehyde dehydrogenase; PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: Methylmalonate-semialdehyde
FT                   dehydrogenase; TIGRFAM: methylmalonate-semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde dehydrogenase family;
FT                   TIGRFAM: methylmalonic acid semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15813"
FT                   /db_xref="GOA:E4RRI4"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI4"
FT                   /protein_id="ADQ15813.1"
FT                   /translation="MELLKNYIGGKWLDSREAAFSSVVNPATQEILGRVPVGPGTSTDV
FT                   DEAVKAAQVAFKEWSQIPVMQRVQPLYKLKQLIEDNLDDLANTITLECGKTKVESLGEL
FT                   QRAIENIEAACATPLLIQSEFSENIARGVDEFMIRQPLGVCACIAPFNFPGMIPFWFLP
FT                   YAIACGNTFVLKPSEKVPLTMMKVFSLIEKIGLPAGVVSLVHGGKETVDALLDHPDIKA
FT                   ISFVGSTAIAKYVYSRGAANGKRVQAQGGAKNPVVILPDADLEVTSKVIADSVYGCAGQ
FT                   RCLAASTIISVGDEKGEIKDALYETAKQRTTGFGLLPDVEMGPVISRESKKRIESLIQQ
FT                   GIQEGGQVLLDGRNTQISGFEKGNFLRPTILENIPLNGELIKTEIFGPVMTLLSMKTVE
FT                   DALAFINGNRYGNMACIFTTSGASARKFRSEANAGNIGVNIGVAAPMAQFPFSGWNESF
FT                   FGDLHGQGRHAIEFFTQTKIVIERWPKEWSRKF"
FT   gene            26559..27458
FT                   /locus_tag="Lbys_0018"
FT   CDS_pept        26559..27458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0018"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307; KEGG: sus:Acid_1484 xylose isomerase
FT                   domain-containing protein; PFAM: Xylose isomerase
FT                   domain-containing protein TIM barrel; PRIAM: Myo-inosose-2
FT                   dehydratase; SPTR: Xylose isomerase domain protein TIM
FT                   barrel; PFAM: Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15814"
FT                   /db_xref="GOA:E4RRI5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI5"
FT                   /protein_id="ADQ15814.1"
FT                   /translation="MIKIANAPCSWGALEFDLEAEAPGFEQVLDEMKDTGYLGTELGDW
FT                   GFMPTEPSALRKEIAGRELDLLGAFVPVNFVDASAHEEGIASALRVAGLMHDAGYSHAF
FT                   IVLADENGSVPTRTKNAGRISAEMGLSGEQWDTFAKGVEAVAKAVKDKYGMRCVFHHHC
FT                   AGYVETPQELEQLLQRTDPSLLGLCFDTGHYAFGGGDPLEGLQKWKDRIWHVHFKDYSE
FT                   VVGAQGREKEWDYFEAVKNGVFCELGKGSVDFSGAKKILENMQYEGWIVVEQDVLPGMG
FT                   SPKICADNNRQFLKTIGL"
FT   gene            27455..28435
FT                   /locus_tag="Lbys_0019"
FT   CDS_pept        27455..28435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0019"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683:IPR004104; KEGG: dfe:Dfer_5698 inositol
FT                   2-dehydrogenase; PFAM: oxidoreductase domain protein;
FT                   Oxidoreductase domain; PRIAM: Inositol 2-dehydrogenase;
FT                   SPTR: Inositol 2-dehydrogenase; PFAM: Oxidoreductase
FT                   family, NAD-binding Rossmann fold; Oxidoreductase family,
FT                   C-terminal alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15815"
FT                   /db_xref="GOA:E4RRI6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI6"
FT                   /protein_id="ADQ15815.1"
FT                   /translation="MKLGLIGFGRIGKIHYYNILQRIPEAEIVMVSDPMADLSAIGTAI
FT                   GTPDDILNHEEIEAVIICSPTDTHADLVEACAKKGKHIFCEKPLDLSLERISAAIKLVE
FT                   EHGVKLMMGFNRRFDANFLKIRELVLNGSVGEPQIVKITSRDPGPPPLTYLRESGGMFL
FT                   DMSIHDFDMARYIMGKEVTGVFAHAAVFCGEDIEAAGDIDTAIITLTFEDQSMAVIDNS
FT                   RKAVYGYDQRLEVFGSKGMVNVDNNTPDKHHFYNEQGVHSALPLHFFLERYTESYLLEM
FT                   RQFINALKNGGKVPVGGEDARQATRIALAAKKSVKEKRWVSLEEI"
FT   gene            28882..30330
FT                   /locus_tag="Lbys_0020"
FT   CDS_pept        28882..30330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0020"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="COGs: COG3344 Retron-type reverse transcriptase;
FT                   InterPro IPR000477:IPR013597:IPR000123; KEGG:
FT                   tpd:Teth39_1868 RNA-directed DNA polymerase (reverse
FT                   transcriptase); PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; SPTR: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); PFAM: Reverse transcriptase (RNA-dependent
FT                   DNA polymerase); Group II intron, maturase-specific domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15816"
FT                   /db_xref="GOA:E4RRI7"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI7"
FT                   /protein_id="ADQ15816.1"
FT                   /translation="MLEWQRNHEVYDEVLKAEPHKRTACMRVGRKPIVKCKRSLAESCN
FT                   EVDTMPEVFFSNTMLEEILHIRNVKHAVDRVISNGGASGVDGMQIDNLRDYLNTHWQSL
FT                   RSDILSGTYRPQAVRKVEIPKASGGKRMLGIPTVIDRVIQQSISQWLGLKYEGDFHDNS
FT                   YGFRPNRNAHQAVSKAQEYLNLGYTWVVELDLEQFFDQVNHDILMHLLSKKITDHRVLA
FT                   LIGKYLRCGIMDHGLEQKRTKGTPQGSPLSPLLSNIILNELDRELSSRGHRFVRYADDC
FT                   SIYTRSNKSATRIMGNITSYIESTLKLKVNREKSKVSRPSQSSLLGFSFFKTQGDWQIR
FT                   ISAKSIERVREKLRQNTRRNTVTPMHERLTKLRQIIHGWVDYFRIATNKKVMVALDELV
FT                   RRRLRVLLWKQWKTAGNRIRNLMKLGAKRWLAYQHANTRKSYTRTGTSPILQTTLTNSY
FT                   FTKLGYEGFADYYYWRTTHQTTLF"
FT   gene            30896..32270
FT                   /locus_tag="Lbys_0021"
FT   CDS_pept        join(30896..30982,30984..32270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Lbys_0021"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; PFAM: Reverse transcriptase
FT                   (RNA-dependent DNA polymerase); Group II intron,
FT                   maturase-specific domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15817"
FT                   /db_xref="GOA:E4RRI8"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI8"
FT                   /protein_id="ADQ15817.1"
FT                   /translation="MRVGRKLIVKCKRSLAESCNEVDTMPEVFFSNTMLEEILHIRNVK
FT                   HAVDRVISNGGASGVDGMQIDNLRDYLNTHWQSLRSDILSGTYRPQAVRKVEIPKASGG
FT                   KRMLGIPTVIDRVIQQSISQWLGLKYEGDFHDNSYGFRPNRNAHQAVIKAQEYLNLGYT
FT                   WVVELDLEQFFDQVNHDILMHLLSKKITDRRVLALIGKYLRCGIMDHGLEQKRTKGTPQ
FT                   GSPLSPLLSNIILNELDTELSSRGHRFVRYADDCSIYAKSNKSATRIMRNITSYIESTL
FT                   KLKVNREKSKVSKPSQSSLLGFSFFKTQGDWQIRISAKSIERIREKLRQNTRRNTATPM
FT                   HERLTKLRQIIHGWVDYFRIATNKKVMVTLDELVRRRLRVLLWKQWKTAGNRIRNLMKL
FT                   GAKRWLAYQHANTRKSYTRTGTSPIVQTTLTNSYFTKLGYEGFADYYYWRTTHQTTLF"
FT   gene            32408..32878
FT                   /locus_tag="Lbys_0022"
FT   CDS_pept        32408..32878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0022"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182; KEGG: cpi:Cpin_2927 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15818"
FT                   /db_xref="GOA:E4RRI9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI9"
FT                   /protein_id="ADQ15818.1"
FT                   /translation="MIQTYRPQWKGDFERLNRAWIEKLFVMEPQDYQLFNDPENEVIQG
FT                   DGMIFFILEEGSPVATAGVKPYGEHGFELVKMAVDEKARGKGYARQLCMHAIDFAKQKG
FT                   KEFIVLYTHSSLTPALALYKSLGFENVEVENGKYARADVKMQLNIWKVTKNP"
FT   gene            32854..33399
FT                   /locus_tag="Lbys_0023"
FT   CDS_pept        32854..33399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2482 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1572)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15819"
FT                   /db_xref="InterPro:IPR011466"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ0"
FT                   /protein_id="ADQ15819.1"
FT                   /translation="MEGYKESVRKQFLYYKGLAEKAMSQVSDEQLVWTPDAETNSIAVI
FT                   VQHVGGNMLSRFTDFLTSDGEKPWRNRDAEFEPSLSSRAELLDLWERGWKEVFNALDQV
FT                   EDLQQIVYIRNEGHTVLEAFNRQLAHYSYHIGQIVFLAKLLKREEWQTLSIARNKSGEY
FT                   NEKKFSAPKEIRHYTDRV"
FT   gene            complement(33374..33970)
FT                   /locus_tag="Lbys_0024"
FT   CDS_pept        complement(33374..33970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0024"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: sli:Slin_6325 dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; PRIAM: Dephospho-CoA kinase; SPTR:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15820"
FT                   /db_xref="GOA:E4RRJ1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ1"
FT                   /protein_id="ADQ15820.1"
FT                   /translation="MLKVGITGGIGSGKSTVARIFSHLGIPVYDSDQRAKDLVSSDTQL
FT                   ITQIKQLMGVEAYLPDGTYHRKYISEQVFKNPEKLKALNHLIHPAVRKDFEAWVNQQVD
FT                   APYVLKEAAIMNRDSGLDAIIVVHTPVKERIERVIKRDGRTEDQVKNIMENQKTEEEFI
FT                   SVADYVINNGNGHSILRQVLEIDKKLRSTLDQYNV"
FT   gene            complement(33958..34962)
FT                   /locus_tag="Lbys_0025"
FT   CDS_pept        complement(33958..34962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0025"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173; KEGG: fps:FP1055 glycosyl transferase, group 2
FT                   family protein; PFAM: glycosyl transferase family 2; SPTR:
FT                   B-glycosyltransferase, glycosyltransferase family 2
FT                   protein; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15821"
FT                   /db_xref="GOA:E4RRJ2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ2"
FT                   /protein_id="ADQ15821.1"
FT                   /translation="MKDIAVVILNFNGKQFLERFLQKNLDCSAEADVIVVDNASTDHSV
FT                   PFLHASFPDVQVVSLKQNYGFAKGYNEGLKHLNYKYYILLNSDVEVSEGWIPPLISTLE
FT                   KQEKVVAVQPKIKSFAHPEAFEYAGAAGGHLDLFGYAFCRGRVFDTVEKDHGQYEDASE
FT                   IFWTSGACMAVKASAFKEENGFDERFFAHMEEIDLCWRWLNKGYSILYVPQSQVYHIGG
FT                   GTLQTGSSFKTYLNFRNNLAMMFKNLPGKYLIPVLFARLSLDGISGIRFLLQGSPSLLW
FT                   AVLKSHFMFYYWLPYLIKKRNGSYLGYQRLFKGSIVKAYFWDGKKTYKEICSK"
FT   gene            complement(34964..35293)
FT                   /locus_tag="Lbys_0026"
FT   CDS_pept        complement(34964..35293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0026"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: sli:Slin_6386 hypothetical
FT                   protein; PFAM: Uncharacterised protein family UPF0133;
FT                   SPTR: UPF0133 protein Slin_6386; PFAM: Uncharacterised BCR,
FT                   YbaB family COG0718; TIGRFAM: DNA-binding protein,
FT                   YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15822"
FT                   /db_xref="GOA:E4RRJ3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ3"
FT                   /protein_id="ADQ15822.1"
FT                   /translation="MFDMMNKMRDMQNKMQEAQEKLGEITAEGESGGGMVKAKVNGKKE
FT                   LLSVVLEPELLKPEDAKITQDLIVAAVNNALRNVEEEAKAEMAKVTDGLLPKIPGFDLD
FT                   SLFKK"
FT   gene            35358..36512
FT                   /locus_tag="Lbys_0027"
FT   CDS_pept        35358..36512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0027"
FT                   /product="peptidase M28"
FT                   /note="COGs: COG2234 aminopeptidase; InterPro
FT                   IPR007484:IPR001478; KEGG: fba:FIC_01278 WD40-like beta
FT                   propeller; PFAM: peptidase M28; SMART: PDZ/DHR/GLGF domain
FT                   protein; SPTR: WD40-like beta Propeller; PFAM: Peptidase
FT                   family M28"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15823"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ4"
FT                   /protein_id="ADQ15823.1"
FT                   /translation="MFRIILLFLLIPFFAKAQIIEEARLVKHVEFLASDKLEGRAPGTK
FT                   GDKRASEYIVSQFKKIGLKPYPSYKDSFVIQRGKDIKTNNILGYLDNGKEHTVIIGAHY
FT                   DHLGTKKGQVYNGADDNASGVAAMLELARYYSTNKAVENYNYLFVAFSGEEWGLLGSKH
FT                   LADRLSPENINLMINLDMIGRYREDKGLTIGGVGTSTVLEKWGPELGMCMELNFQIDSS
FT                   GVGPSDHTSFYHKGIPVLFLFTGAHEDYHKPSDDTDKLNFRGIKLISNYVIQLMSHLDE
FT                   LPKIDFKKTREPAPTGRTQFKVSLGVLPNYEYNGTGLKIELVSQGKPASQAGIKAGDVL
FT                   LKLDDTELQDINTYVDVLGRLEKGQRVQVVLDRKGEKISKEITL"
FT   sig_peptide     35358..35408
FT                   /locus_tag="Lbys_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            36514..36879
FT                   /locus_tag="Lbys_0028"
FT   CDS_pept        36514..36879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zpr:ZPR_1231 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15824"
FT                   /db_xref="GOA:E4RRJ5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ5"
FT                   /protein_id="ADQ15824.1"
FT                   /translation="MSKKTLVIGASTNPTRYSNMATHKLLEHKHEVELLGKQSGEVAGH
FT                   TIKQSTEELSADFHTVTLYINSERQIEYFDYLVALHPQRVIFNPGTENPSLKLLLEKNG
FT                   IQTLEACTLVLLATGQF"
FT   gene            37014..37559
FT                   /locus_tag="Lbys_0029"
FT   CDS_pept        37014..37559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1477 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15825"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRJ6"
FT                   /protein_id="ADQ15825.1"
FT                   /translation="MRTKFFLFFALISAGAFAQSNTDQHTLTITVPSVALLDLEPSSGK
FT                   NLSVSFNAPTDPGLALVLDPAAVLNSVYLNYTSVLASATKRNITVSMTGSLTGVQIKVT
FT                   AGAATATGAGEKGTPTSEVTLSDTEQIIIQDVGSAYTGTGSGNGHQLTYVVDLPSSTFG
FT                   TLVSGNKVATIKYTLSGD"
FT   sig_peptide     37014..37067
FT                   /locus_tag="Lbys_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            37571..38290
FT                   /locus_tag="Lbys_0030"
FT   CDS_pept        37571..38290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1478 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15826"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS10"
FT                   /protein_id="ADQ15826.1"
FT                   /translation="MCIILFASFTCKGGISVVNGLSHEHQNAQLTGSIKVKNEGTKTER
FT                   VSLYLQDLVPNCDGSVVYQEPSGQQWIFLDKDFIELGAGEEVEVKYSLVPFKERETSQW
FT                   QVVMVEAEDPIATDHQGGVQINSKVRYAIQIVLHAGAYQAPEVGFHEVKLNSKETISVT
FT                   LKNHGSYMTFVNLKLEVLTEEGKIVKVFEGNNRRIYPGYCTTFTIPVDDIPAGKYAGVL
FT                   VADNGKDLYGSHLLLEL"
FT   gene            38326..40836
FT                   /locus_tag="Lbys_0031"
FT   CDS_pept        38326..40836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1479 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15827"
FT                   /db_xref="GOA:E4RS11"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS11"
FT                   /protein_id="ADQ15827.1"
FT                   /translation="MDVFLGAFLPEIIMQSPASLVKPGESFTLTVQVKGTSKNGALLLP
FT                   EGWKQINSFLMENKEGYTRFFTLSTDAQISAGKYTLRYQLSDLSAADSLQLEVQAFSKI
FT                   EIAQIDLPDIARENDSLSVSYFIENKGNTPEVIFYSSCAGPGDSLLLLPGQSRMLSWKE
FT                   IVPSGVESYLHQMEVLLDGKYERYYKNMSVFLSKPPILNKEDSWPLEVGLRWLGSIPGG
FT                   SSYQFFAVGSGNMGVHSFDINLRGPNRLNFPMFGFYDQYYLGYSYNKRWGAELGDFSLS
FT                   FSPLLELGRFGRGAQIWAKTGASQFKIFYHQPRFFSNQKNSWGAEWAWRKNNTAFSFLS
FT                   YNKSMAFKEGWNDVNIASGNINFNFKFIELEQDVAVSNSVRGLGLGLHSRLSLSVQKWD
FT                   LHYQGIYSDQHFYGFYNHSKLSNAQLSYKIYKGYQIGVQHYYSLLNAQPDIHQFYISPK
FT                   HQYWTGYVSAFLNSKQNLYLYFQQGERSDTLSPYHYKERFLGLNYQYNGRKFRLSALGR
FT                   QGSTLNLLLDDQNYENLSVLNLQPSVQLFPGFWLGVLGEYQNTKRFTDQKENLYFWGGS
FT                   VQYFPNRKWQFYINYRSSLAQDEIFKQQSLLQVLASTNWSNHTFSVQGGKSYFPTPDGK
FT                   GVESLFFNLSYSYKIGMPTKKRPPMGRVSGQVQGKGVPVNGVLLYLGDRRFMTDASGKF
FT                   DFGKVKAGEYELLVKSTQTGINHPEKLNVNVASKSKNNYIIPVFKGAVIRGKVSYPEGL
FT                   RRVWVYLEHQGEVSTLLTKPDGSFSFSGLKKGDYTVYLQLENYQLPDPVTVQLEEGDEV
FT                   QIPLQVKTKQRTIQFQSSPLQIKR"
FT   gene            40833..41363
FT                   /locus_tag="Lbys_0032"
FT   CDS_pept        40833..41363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1480 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15828"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS12"
FT                   /protein_id="ADQ15828.1"
FT                   /translation="MRWWLVIFSLFTLSSFAQTNSNSHSVSFTLQSVAILSIVSSSSSN
FT                   IEMKFQVPNNAGLNIVAPGTNTQNWLNFTSALATGSRIIYVNSSASIPSKYKLMLEVTG
FT                   PFGSGGGSRGTSNGTVEIGNLPKAIISGIGGAYTGVGPGNGFQLKYTASIQQFSGLIAG
FT                   NTDIHVVYTLSDL"
FT   sig_peptide     40833..40901
FT                   /locus_tag="Lbys_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            41335..41868
FT                   /locus_tag="Lbys_0033"
FT   CDS_pept        41335..41868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1481 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15829"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS13"
FT                   /protein_id="ADQ15829.1"
FT                   /translation="MLFTPYLTYKMKILLGLLFLSLGLQAQTLNISGNWNITIAKPTVP
FT                   GSNYLNSYESSTNAVILSGSDNSILTIGAKYTFSVSMTGALPSGVKLYARRTADGTIIS
FT                   SFLGLNVGNYSDGLSYLELTNFVQALFYINITLAVSVGTTLFQNIPIQYKLEGLSVTQP
FT                   TGTYTVTVTYTVSK"
FT   sig_peptide     41335..41412
FT                   /locus_tag="Lbys_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(41875..42555)
FT                   /locus_tag="Lbys_0034"
FT   CDS_pept        complement(41875..42555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0034"
FT                   /product="membrane or secreted protein"
FT                   /note="KEGG: phe:Phep_0201 membrane or secreted protein;
FT                   SPTR: Possible membrane or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15830"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS14"
FT                   /protein_id="ADQ15830.1"
FT                   /translation="MKMFLSLLLSLSCVLGYAQGISGAWHAIDNGVTTQILATEQYISV
FT                   TEYTPTSFNKTWGGKYEVQKGGSIQIKLEFHSESPSLVGTEQTYNIKTKKKSLEFNNKN
FT                   FQRLSPDRKDALSGLWVITGRANPEGNISKMTPGARRTYKMMVEGHFQWLAINIQSGEF
FT                   SGTGGGKYSLKDGKYIEKIEFFSRDNSRVGAELDFNAEVNDKEWIHSGKSSKGDPIKEV
FT                   WTKQ"
FT   sig_peptide     complement(42484..42555)
FT                   /locus_tag="Lbys_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            42605..43729
FT                   /locus_tag="Lbys_0035"
FT   CDS_pept        42605..43729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0035"
FT                   /product="imidazoleglycerol-phosphate dehydratase;
FT                   histidinol-phosphate phosphatase"
FT                   /EC_number="4.2.1.19"
FT                   /EC_number="3.1.3.15"
FT                   /note="COGs: COG0131 Imidazoleglycerol-phosphate
FT                   dehydratase; InterPro
FT                   IPR020565:IPR005954:IPR006543:IPR000807; KEGG:
FT                   dfe:Dfer_2927 imidazole glycerol-phosphate
FT                   dehydratase/histidinol phosphatase; PFAM:
FT                   imidazoleglycerol-phosphate dehydratase; PRIAM:
FT                   Histidinol-phosphatase; SPTR: Histidinol-phosphatase;
FT                   TIGRFAM: histidinol-phosphatase; histidinol-phosphate
FT                   phosphatase family protein; PFAM:
FT                   Imidazoleglycerol-phosphate dehydratase; TIGRFAM:
FT                   histidinol-phosphate phosphatase family domain;
FT                   histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15831"
FT                   /db_xref="GOA:E4RS15"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR005954"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020566"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS15"
FT                   /protein_id="ADQ15831.1"
FT                   /translation="MPKVLFIDRDGTIIIEPPVDFQVDSLEKLEFLPKAISNLRKISEE
FT                   NQFELAMVTNQDGLGTSSFPEDTFWPAHLKMMRTLENENVHFHEVFIDKTFPHENAPTR
FT                   KPGTGLLGKYINNPEYDLPGSFVLGDRLTDVQLAINLGAKAIFIGKSLQEDVSDEIKNA
FT                   IALVTDDWDEIYAFLKMPERTAEVRRTTKETDIHIKLNLDGQGKSDIHTGIGFFDHMLD
FT                   QLARHSGADLYISVNGDLHIDEHHTIEDTALALGEAYLNALGDKRGISRYGFLLPMDEC
FT                   LAQVAIDFSGRPWLVWDAEFKREKIGEMPTEMFMHFFKSFSDTSKCNLNIKVEGENEHH
FT                   KIESIFKAWAKAIKMAVKRDIKEIDRLPSTKGVL"
FT   gene            complement(43737..44738)
FT                   /locus_tag="Lbys_0036"
FT   CDS_pept        complement(43737..44738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_3546 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15832"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS16"
FT                   /protein_id="ADQ15832.1"
FT                   /translation="MKKWLTVLCMGIVFSLSAEDKTWVEKTKTLVFTYDSKDVDRIDVT
FT                   NKFGNVKVVHWNKNSVKVNVNIRANAVSNTLTEKYLDNIQIKKEVKNKVLILQTHMSEF
FT                   AQNLDKKNSYCTVDYLIYMPENTQLRIENFFGDISLPESFAPLTISLQHGKLDVPVVNN
FT                   AESQLNIKFGKAVISELVGASINSANSTVDIQLLKDADIKFERGVLTAQDVENIKGQIK
FT                   YAKSYFNNLNQMIELDVAYTTDLRLGNLNKNLKQLKINTTYSDIQLADFNGLLNVITTN
FT                   GQVYLGQGVQAKKLTSTPSPAKNVQVYKALIGKESDKVVIINANHSNVKVKN"
FT   sig_peptide     complement(44685..44738)
FT                   /locus_tag="Lbys_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(44735..45211)
FT                   /locus_tag="Lbys_0037"
FT   CDS_pept        complement(44735..45211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_4231 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15833"
FT                   /db_xref="GOA:E4RS17"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS17"
FT                   /protein_id="ADQ15833.1"
FT                   /translation="MKLEELIQKNVGAFDEEVPAGAWMKIQTRLPRRMKFPIMRYAALL
FT                   LVCMGMAYYLGKTKAQSEIRDLEKYDAKLVTYASKVQEKKSKLEQLVSSQPDLGETFNK
FT                   DLTELQNDFNALKAELTTNPNTETIISAMIQNLEWQIELLNQQTQIAEKKVYML"
FT   sig_peptide     complement(45146..45211)
FT                   /locus_tag="Lbys_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(45208..45756)
FT                   /locus_tag="Lbys_0038"
FT   CDS_pept        complement(45208..45756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0038"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR000838:IPR014284:IPR007627:IPR013249; KEGG:
FT                   sli:Slin_5603 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; SPTR: RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   manually curated; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15834"
FT                   /db_xref="GOA:E4RS18"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS18"
FT                   /protein_id="ADQ15834.1"
FT                   /translation="MRFFSTKDDTTRLVELCRNGNSRAQYELYQRYSKAMFNTALRIVG
FT                   NREEAEDVLQDSFLDGFLKIENFRGESTFGAWLKSIVVNKSIARLRNQRIHWEDLDGKE
FT                   NFEEGEDVDFEETEETIERIKVILTELPSGYRVVLNLYLFEGYDHREIGNILGISEVTS
FT                   RSQFIRAKQKLVELYKKRR"
FT   gene            45859..46728
FT                   /locus_tag="Lbys_0039"
FT   CDS_pept        45859..46728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0039"
FT                   /product="cysteine synthase"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro
FT                   IPR001216:IPR005856:IPR001926; KEGG: phe:Phep_2362 cysteine
FT                   synthase B; PFAM: Pyridoxal-5'-phosphate-dependent protein
FT                   beta subunit; SPTR: Cysteine synthase; TIGRFAM: cysteine
FT                   synthase; PFAM: Pyridoxal-phosphate dependent enzyme;
FT                   TIGRFAM: cysteine synthases; cysteine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15835"
FT                   /db_xref="GOA:E4RS19"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS19"
FT                   /protein_id="ADQ15835.1"
FT                   /translation="MPSLVELIGNTPLVEVKSPNPNVKIFGKLEGNNPGGSVKDRAALN
FT                   MIRSAMERGEIKEGSQLIEATSGNTGIALAMLASQYRLPIELVMPENSTRERVVTMEAF
FT                   GAKVTLLDSIEACRDYADEKGKQEGYFQFNQFANPDNYLAHYKSTGPEIWRDTEGKITH
FT                   FVASMGTTGTIMGTSMYLKEQKSEVQIVGCQPTENSSIPGIRRWPIEYLPKIFDPKRVD
FT                   RVVDVSQEDAENKAVALAREEGIFVGVSSGGQAHVAYELAKELNSGLIVFICCDRGDRY
FT                   LSSGLFGL"
FT   gene            46725..47912
FT                   /locus_tag="Lbys_0040"
FT   CDS_pept        46725..47912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0040"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="InterPro IPR010905; KEGG: phe:Phep_4097 glycosyl
FT                   hydrolase family 88; PFAM: glycosyl hydrolase family 88;
FT                   SPTR: Glycosyl Hydrolase Family 88; PFAM: Glycosyl
FT                   Hydrolase Family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15836"
FT                   /db_xref="GOA:E4RS20"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS20"
FT                   /protein_id="ADQ15836.1"
FT                   /translation="MKKFLVFLILGCHSLSAQKVMENLIQENFAFAEKQYLYMMTENPT
FT                   PNKMPQSYANGKFDARDIKWWCSGFYPGILWYIWEQTGNSEIKKEAERALQVILPNQHF
FT                   TDNHDLGFMVYCSFGNAFRLTGKAEYKEAIFNGSAALASRYRPSIKSIQSWNKNAYFEC
FT                   PVIIDNLMNLEMLIWTSDQGGDQKYKDIAITHANTALKEHFRPDFSSYHVIDYDLATGK
FT                   PLRKTTWQGAANTSAWSRGQAWALYGYTMLYRMTKNPEYLQQAQGIAGFILDHPNLPED
FT                   GIPYWDFDAPYQPKCPRDASAGAIIASALLELGQFSPVKERNKYVEASKKMLISLSSEK
FT                   YRSKPNENGGFILLHSVGALPLNSEVDVPLIYADYYFLEALKRYKDWYLTSSNKP"
FT   sig_peptide     46725..46820
FT                   /locus_tag="Lbys_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(47890..49014)
FT                   /locus_tag="Lbys_0041"
FT   CDS_pept        complement(47890..49014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2151 hypothetical protein; SPTR:
FT                   Hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15837"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS21"
FT                   /protein_id="ADQ15837.1"
FT                   /translation="MWKTIIFLTAFTIWGCASVQKELNRGNYSNAVNLALSKLKGKKKS
FT                   EKDIIGLRDAYQYYIAEQLRKVEQLKLQSNKDSQILSIYEAADNINSSIKPLLPLQDQN
FT                   GFVTDIPLIDVKAEVAKYKSRVADQLYFNAIGNLEKGGKMEARKAYDQFQQMINLTGAT
FT                   SHLQSLRDEAKKKGTTYILALGEIDSKISVSKAVKERFMSLSSSTLSKNWQRVDITADK
FT                   RTPYDYELIFVLEDFVLSPEKESSREYIDKKEIEESAGTSSRDNEKIKRKIEVSAQVVE
FT                   LYQFKEAQVKGKVILYDVVKKKNIYSEPVTAAQVFENYASTFKGDKRALSDVSLKRIGG
FT                   KPIAFPSNDKILGDAVATLKKNMEQQALKAYSNL"
FT   sig_peptide     complement(48952..49014)
FT                   /locus_tag="Lbys_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(49022..49645)
FT                   /locus_tag="Lbys_0042"
FT   CDS_pept        complement(49022..49645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0042"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="COGs: COG0461 Orotate phosphoribosyltransferase;
FT                   InterPro IPR004467:IPR000836; KEGG: dfe:Dfer_0239 orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   PRIAM: Orotate phosphoribosyltransferase; SPTR: Orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15838"
FT                   /db_xref="GOA:E4RS22"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS22"
FT                   /protein_id="ADQ15838.1"
FT                   /translation="MNTARKIASFLLETQAVKLSPQKPFKWSSGWNSPIYCDNRITLSH
FT                   TEARTFIKKALAKAIKKHFPEATMIAGVATAGIAQGALVADYLQMPFAYVRPKPKDHGM
FT                   GNQIEGRIPEGSKVVVLEDLISTGGSSIKAAEALQAQGVEVLGMAAIFTYGFKTADKNF
FT                   EVKNLKLVTLSNYSYLIDEALKQNYISAEDIDLLKKWRRQPDKF"
FT   gene            complement(49642..50928)
FT                   /locus_tag="Lbys_0043"
FT   CDS_pept        complement(49642..50928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0043"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro
FT                   IPR002550:IPR000644:IPR005170; KEGG: sli:Slin_1467 protein
FT                   of unknown function DUF21; PFAM: protein of unknown
FT                   function DUF21; CBS domain containing protein;
FT                   transporter-associated region; SMART: CBS domain containing
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: CBS
FT                   domain; Domain of unknown function DUF21; Transporter
FT                   associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15839"
FT                   /db_xref="GOA:E4RS23"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS23"
FT                   /protein_id="ADQ15839.1"
FT                   /translation="MEIFIILFLILLNGIFSMSEIALVSSRKTKLEIAAKNGKKSAAEA
FT                   LELASSPGRFLSTVQIGITLIGILTGIYSGDTFKGYIAPLLVDIGVPINYSDNVAVALI
FT                   TMVVTFLTLIFGELVPKRIGMAIPEEIATVVVRPMNILSKIASPFIWCLSKSSDLIFKV
FT                   IGLKEHDNSVTEEEIKTMVQEGASGGTIEEIEHEIVQNVFQLGDRKITSLMTSVNDISY
FT                   LDLDDSPEENREKIIEKKHSIYPVCKDGINDIRGLLYIKDLLGKSLDDELQNLEPILRP
FT                   ALYIAENNHAYQVLEKFQEERIHFGVIVDEYGSVVGIVTMNDILDALVGDISETNEFQY
FT                   EIVEREDGSFLIDAALPFDDFLSEFDIELPNRKEYSGFDTMGGFALHILKEIPTEGERF
FT                   YWEDFVFEIMDMDKNRVDKILVSKKPSEE"
FT   sig_peptide     complement(50827..50928)
FT                   /locus_tag="Lbys_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            51044..51703
FT                   /locus_tag="Lbys_0044"
FT   CDS_pept        51044..51703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0044"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR020084:IPR000086; KEGG: chu:CHU_2668
FT                   hypothetical protein; PFAM: NUDIX hydrolase; SPTR: Orotate
FT                   phosphoribosyltransferase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15840"
FT                   /db_xref="GOA:E4RS24"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS24"
FT                   /protein_id="ADQ15840.1"
FT                   /translation="MVIFVNNIPVHILDQPEDFAFTEWKSDFEKLEELKGKPIFFGVKY
FT                   KRILLLIEYLTSKALDGLEEIAFVVKDVSDFKQYIKSHVSFVKAAGGVVKNKDGKILMM
FT                   KRLGLWDLPKGKAEKGEKSEITALREVEEECNVTVFSDGRLVTTWHTYMAKGRLHLKRT
FT                   KWYRMGLVSDSKMKPQKEEGIEELVWMTDDEVIEAEKNSYKSISYVLEAYRKNWSE"
FT   gene            51878..52945
FT                   /locus_tag="Lbys_0045"
FT   CDS_pept        51878..52945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0045"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: dfe:Dfer_4270 oxidoreductase
FT                   domain protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Oxidoreductase domain protein; manually curated; PFAM:
FT                   Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15841"
FT                   /db_xref="GOA:E4RS25"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS25"
FT                   /protein_id="ADQ15841.1"
FT                   /translation="MKIKVLVVGCGNMGVSHALAYHNLDAFKICGLVSTGKSKEALNDK
FT                   LGGGYPLFNDYFEALKVTQPDAVCISTYPDTHEEYAIAALEAGCHVFLEKPIADTVEGA
FT                   ERVAATAARVNKKLVVGYILRVHPSWIKFIEVAQGLGKPLVMRMNLNQQSHGYMWDVHR
FT                   NLMKSLSPIVDCGVHYIDVMCQMTRSKPVWVSAIGARLTDDIPEGNYNYGQLQIRFEDG
FT                   SVGWYEAGWGPMMSETAYFVKDVIGPKGCVSIAGRNAGSEGHSDNVDAHSKAESLKVHS
FT                   AKIDEKNAFVEEDRWIDLSDEPDHNELCKREQEYFLKAIQKDLDLTDHWNDAVYSLKVA
FT                   FACDESVKTGEVVRL"
FT   sig_peptide     51878..51937
FT                   /locus_tag="Lbys_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(52953..55382)
FT                   /locus_tag="Lbys_0046"
FT   CDS_pept        complement(52953..55382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0046"
FT                   /product="conserved hypothetical protein, membrane"
FT                   /note="KEGG: dfe:Dfer_3101 conserved hypothetical protein,
FT                   membrane; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial membrane protein YfhO"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15842"
FT                   /db_xref="GOA:E4RS26"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS26"
FT                   /protein_id="ADQ15842.1"
FT                   /translation="MNVKKYLPYFLAILFFLVLTFLYFSPVLSGKTVIMHDDLMSAGNA
FT                   KEAMDFYKKTGEYTWWTNSVFGGMPANMIWGSYPFSLSSKLGSWIYAFLPAPVSVIFLL
FT                   MAGFFVFMVSFRKSIWVAVIASVAYAFGTYNLLYTEAGHLSKILALAYAPGILGGFALI
FT                   FRGKYGLGTFVTALFLSMEIYANHLQITYYFIFILFAYFLYEIIKLWKAGEKKSLGKVV
FT                   SCLAVAVLIGVGMHTMRLWNNMVYSKESTRGVSELKNSTVGNSGLTKEYAFGWSYGIDE
FT                   TLTLIVPNIMGGGSMGALSTKSETYKTLTSNGVDPNMAGQFVQQLPLYFGNQSITSGPA
FT                   YSGIIIVFLFLLGLFLLPGKFKWVQLGLTLFFIVLAWGSNFASFNNFLFDTLPGYNKFR
FT                   AVTMTLVIVHFLLVWGAANTISYLLDQGGNTWEGIKKPVTYSAGILIVLMLVGYFSMDF
FT                   VGPRDAEFKSSIAQSTGPDFANKLAFALQADRKDMAWSDIIRGAVLLVLLSASVWAFYK
FT                   GKLQKRVFLYAIFLLCAYDLIGVGKRYFNNNDFTAEKHEAQSFTPTAADLEILKDTDPN
FT                   FKVLNVTTSFTSDSRDSYFHKSLGGYHGAKLKKTQELFDHQFVTEEGQLNKAVIDMLNT
FT                   KYLIVNGPNGPMAQRNPDALGNAWFVDSLKVVPDADAELATLGNFNPKTTAVTQQNQGL
FT                   VTKVYSNDSTAKLTLAEYAPNRLVYTSDNASNGFAVFSEIYYRGNQDWISYVDGKETPH
FT                   QKVNYLLRGMEIPAGKHEIVFEFKPAAVEKGKYVDLLASIALVMLGVGAVYKSKRS"
FT   sig_peptide     complement(55293..55382)
FT                   /locus_tag="Lbys_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            55494..56228
FT                   /locus_tag="Lbys_0047"
FT   CDS_pept        55494..56228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0047"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: sli:Slin_4274
FT                   glycosyl transferase family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase family 2; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15843"
FT                   /db_xref="GOA:E4RS27"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS27"
FT                   /protein_id="ADQ15843.1"
FT                   /translation="MLSIITITFNAEPYLERTIQSILAQTDQDFEYLIIDGGSKDGTLA
FT                   LANKYRDRVNVLVSEPDKGLYDAMNKGLHMAKGPYVWFMNAGDQIAEAEAVYKLKMLMS
FT                   EGADVIYSDTIMVDEQGQSLGLRSQVTPHRLPEVMHWSKFKYGMLICHQSFVVNKAICP
FT                   TYDIENLSADIDWEIICLKRAEKISLYPGILSKYLLGGISQKQHRRSLADRYKVLRKHF
FT                   GWLPNLWNHAFILFRALGDKIK"
FT   gene            complement(56208..56927)
FT                   /locus_tag="Lbys_0048"
FT   CDS_pept        complement(56208..56927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0048"
FT                   /product="LmbE family protein"
FT                   /note="COGs: COG2120 conserved hypothetical protein LmbE
FT                   homologs; InterPro IPR003737; KEGG: sli:Slin_0661 LmbE
FT                   family protein; PFAM: LmbE family protein; SPTR: GlcNAc-PI
FT                   de-N-acetylase family protein; PFAM: GlcNAc-PI
FT                   de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15844"
FT                   /db_xref="GOA:E4RS28"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR023842"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS28"
FT                   /protein_id="ADQ15844.1"
FT                   /translation="MIDLLVFAAHPDDAELGCAGTIAKETAKGKKVVIVDLTQGELGTR
FT                   GSGPLRLQEAQAAAKVLHLYARENMGFRDGFFRNDEEHQLALISVIRKYRPQMVLMNAP
FT                   EDRHPDHGRASDLCTQACFLSGLRRIETKDENGQIQEPWRPKNAFHYIQDRFLFPDVVV
FT                   DVSDFWEIKKQSIMAFRSQFFDPTSTEPNSYISSPEFLEFINSRGSEYGHQIGVKYGEG
FT                   FIRSKMLGVDSLFDFIS"
FT   gene            complement(56924..58126)
FT                   /locus_tag="Lbys_0049"
FT   CDS_pept        complement(56924..58126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0049"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro
FT                   IPR016047:IPR018392:IPR002482; KEGG: sli:Slin_1779
FT                   peptidase M23; PFAM: Peptidase M23; Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM; SPTR:
FT                   Peptidase M23; PFAM: Peptidase family M23; LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15845"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS29"
FT                   /protein_id="ADQ15845.1"
FT                   /translation="MNFKKYLFFVFVLLALPALAQKKEKGKIVNAPKIPQNTKNTKKET
FT                   PKKDEFDFIFEDEPKLRFSNQYEGSNTNKAATPAPAGNYKEGIKIEPLRDLSTTVHEDT
FT                   SSIDEGELLIVEIEEDAQFGGSESMVNIASYYSVWDTKSLNPYGISPKDFSEVVNITLF
FT                   NEKEGRNWAKMLDKFRLSSHFGWRNRRWHKGTDLALDTGDKVYAAFDGIVRIAGWYNGY
FT                   GRTVMVRHYNGLETLYGHLSKITYEPNTLVKAGDVIGLGGSTGRSSGPHLHYETRYEGN
FT                   QFDSENIYDYTNNEIKIRTQEFTVSSRLYDYLRGKPSVPAGYRNGSVPTGEALDETSDL
FT                   DEFEEEIPVKVETKAWYSVRKGDTLYSIARKFNMTAQQLAKLNKIPLNKKIYPGLRLRV
FT                   R"
FT   sig_peptide     complement(58049..58126)
FT                   /locus_tag="Lbys_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(58180..59289)
FT                   /locus_tag="Lbys_0050"
FT   CDS_pept        complement(58180..59289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0050"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: cyh:Cyan8802_0039 glycosyl transferase
FT                   group 1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15846"
FT                   /db_xref="GOA:E4RS30"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS30"
FT                   /protein_id="ADQ15846.1"
FT                   /translation="MKKNILFVSHDANRAGAQIFLYNMMSFLQDKGYGVTLLLVHEWGS
FT                   FKGELESKFKTYSLQEKPIRRWERMFHTPVLDEIKKKEKVDLIYINTIASVHVIPELKK
FT                   FWNVPVISHIHELSYSIAQYGVPNAEEILFEYSDKVVACSRAVAENLLSTRKSDKVEII
FT                   HSFVQNEKILEIHSQGKREEVLKSFDLDPQFTWVCACGNADWRKAPDIFLQIASKVRNE
FT                   NIKFAWIGISENDPLMGQLAYDAKKLNIAHKVKWITPTPRAVELINAMDVFLLSSREDP
FT                   FPLVMLEAALCKKPIFTFKNTGGGDEFVEEDAGVRIEYLQVEAMANAIDNCTPENLAAM
FT                   GKKAQEKVLAHYSFDTSMKKMEKLMELFF"
FT   gene            complement(59286..60368)
FT                   /locus_tag="Lbys_0051"
FT   CDS_pept        complement(59286..60368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0051"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653; KEGG: dfe:Dfer_2773
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; SPTR:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15847"
FT                   /db_xref="GOA:E4RS31"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS31"
FT                   /protein_id="ADQ15847.1"
FT                   /translation="MNRINVTKSFLPPKEEYEKMLERVWQSEWLTNNGPLLVELETTLQ
FT                   KKLDLPYFAITSNGTIAIQLAIKALNLSGEIITTPFSYCATTTSILWENLKPVFVDIRE
FT                   DDLNINADLVEAAITDKTSAILATHVYGNPCDVEKLESIGKKYGIKIIYDAAHAFGVEY
FT                   KGKPLLSYGDMSTCSFHATKVFHTVEGGCVVCHDKELFERVKLMRSFGHVQDDYYLAGV
FT                   NGKNSEFHAAMGLVNLGHLDSIIAGRKAIFGIYDQTLNWNKLYKPTEVATDLKYNYAYY
FT                   PIVLEDEDTTLRVIKALQAENIYPRRYFYPTLNTLQYVPETYYCPVSESVSPRVISLPL
FT                   YPDLDHGIVNKIAEIINAQL"
FT   gene            complement(60365..61606)
FT                   /locus_tag="Lbys_0052"
FT   CDS_pept        complement(60365..61606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0052"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003439:IPR003593; KEGG: dfe:Dfer_2772 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15848"
FT                   /db_xref="GOA:E4RS32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS32"
FT                   /protein_id="ADQ15848.1"
FT                   /translation="MTVLSIENISKKYVLNSKGKSNDDLRDTITGWSQKILRPSGPKDE
FT                   KTDFWALKDINFEVKQGDRLGLVGANGAGKSTLLKILSQITAPTTGSVKIHGRMASLLE
FT                   VGTGFHPELTGRENIFLNGAILGMRKAEIVKHFDAIVDFAGIEKFIDTPVKRYSSGMYV
FT                   RLGFAIAAHLEPEILVVDEVLAVGDADFQKKSIGKMRDVSNSGRTLLFVSHNLTAVQGL
FT                   CNKGAYLRGGELIKFGQIDDVITEYVKNVSKFNLAQAWESPNDAPGNDLVRIKSIKLVP
FT                   HESHTRPNLDTTTPLRLELEYWNFVDQAELNVSIFLYSMTGECVFNIGDEAQFYQKGTV
FT                   KSVCNIPGDFLNDGSYYMSIMIVRDRLAPVYFFEDALAFDIIDYREGTEWVGKWPGAVR
FT                   PKMIQVQSWQNELA"
FT   gene            complement(61612..62454)
FT                   /locus_tag="Lbys_0053"
FT   CDS_pept        complement(61612..62454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0053"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR013525:IPR000412; KEGG: dfe:Dfer_2771 ABC-2 type
FT                   transporter; PFAM: ABC-2 type transporter; SPTR: ABC-2 type
FT                   transporter; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15849"
FT                   /db_xref="GOA:E4RS33"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS33"
FT                   /protein_id="ADQ15849.1"
FT                   /translation="MDSRVRTITNKKSISEYIAEIWNYNELFWILAKRDIIVKYKQAIL
FT                   GVGWAAIRPLITTLVMALAFGRLGKLDVNSPIPYMLIVSAGVTIWLFFSQCLTTISTSL
FT                   VLNSNLITKVYFPRLIIPISSIFIGLVDVVVSLAVFAGICLYYQYLPDWKLILVPAILA
FT                   LTFLASFGIGLIAAVLNVKYRDIGQLISFVVQFGTFLSPVAYLTDAYKTGANGDILYKL
FT                   AMLNPVTGCIDAMRWAMLGDFAAFNWNSFIPLVVFILITFFYSIRFFRKHEDSFVDYI"
FT   gene            complement(62462..63520)
FT                   /locus_tag="Lbys_0054"
FT   CDS_pept        complement(62462..63520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2569 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15850"
FT                   /db_xref="GOA:E4RS34"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS34"
FT                   /protein_id="ADQ15850.1"
FT                   /translation="MERDQISTKEFLQSVFSYFKFLATNWRILLIMLVAGNLIDMIKNN
FT                   YFSSTKMYGGGIEFNIDLEGSTQSALGGLAGAFMGGAMPTTGGLTSIANFPQVIMSRTV
FT                   FENALMTEVELYGRKDLLVNHFIDSSDIKTKEWGGNLFKSPSPNVNFKFEKKPFDKFEP
FT                   RENEIMSDIITKLAGSTQLEKDEGSIYKLEAVLSNELLTKAWLETLLKATESFYTEIKT
FT                   VKTRKMIAIQQRRVDSLSVLLRGNDSRLAKVTFEQPDVVNPVAGSAQTRLTRDNTYLSN
FT                   LYFTNLTSLDNLNNLLVEQSQIFNVLNPVKLPLVATSRVGISVRLTGLILLFVTIVFIS
FT                   LRKTYLDVMSDH"
FT   sig_peptide     complement(63413..63520)
FT                   /locus_tag="Lbys_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(63524..66073)
FT                   /locus_tag="Lbys_0055"
FT   CDS_pept        complement(63524..66073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0055"
FT                   /product="Soluble ligand binding domain"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR003715:IPR019554; KEGG:
FT                   sli:Slin_2568 soluble ligand binding domain protein; PFAM:
FT                   Soluble ligand binding domain; polysaccharide export
FT                   protein; SPTR: Soluble ligand binding domain protein; PFAM:
FT                   Polysaccharide biosynthesis/export protein; SLBB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15851"
FT                   /db_xref="GOA:E4RS35"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS35"
FT                   /protein_id="ADQ15851.1"
FT                   /translation="MQSSNLFSFFSYFCTFLFTGKSHQMKLFKVRKTNLNLKAVLILLL
FT                   NLTFMSATMGQEKKETTSKATENPNKVVPQQNRTTTTPGRIPAPATTEARELVLTDEDA
FT                   DAIDREETYRLSREAEIAADEARASIIRRTYGSSLFANSKFDVTQAINIATPNNYVLGP
FT                   GDELEVVVYGYSQNVQKTLKVNPDGYIILEKSGIVSVSGLNMETATEKITAALSKTYTG
FT                   IKSGNTFVRVSLTGFRTIKVTVSGEVVAPGTFTLTSFSNLMAALYVSGGPNEIGTYRDI
FT                   VLIRGNREIAHFDVYEFLTKGYSSSDVLLKDQDRVHVGPFISRVAITGQTKRTGLFEIK
FT                   PGETLADLLKYAGGFNQYAFSDIVKIYRNTSSERKIVNVNKDSFAQEKVFMGDSLVIEK
FT                   VLDRIQNVVTISGAIFRPGEYSLDSNPTLTKLIESASGLKEESLQGRININRTNNDLSI
FT                   SNISVNYHDILEGRADDIKLQRLDQVMVPSVFELTEQSVIRIRGAVNHPEANEGIDLPY
FT                   VKDMTVQDVIVRVGGLTEAASLSRIEIVRRKRNIDPKQSDAQIADIIQFSMRPDLTLVE
FT                   SQESIVLLPYDEILVRTSPNYEKQNFVKISGEVLMPGIYGLEYKDEGISRLIQRAGGLT
FT                   DLAYPEGATLLRKTLLSERQRQKREETLNSLNISKVKTTKGLDDSTKTPGTLTTVTTEG
FT                   EVADSYINEDIGVELRKILANPNDKSLDIILQDGDEIVIPKKLQTVRIEGEVLYPTTVK
FT                   YNKANNFLDYISASGGFTKKSAKGSAYVRYPNGSVDRTRKFLFVRFHPQIVPGSEIVIP
FT                   AKTETTVAQLSQFSGLITMLGGTLGSIVAIITLMKLN"
FT   sig_peptide     complement(65909..66073)
FT                   /locus_tag="Lbys_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            66140..68023
FT                   /locus_tag="Lbys_0056"
FT   CDS_pept        66140..68023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0056"
FT                   /product="DNA topoisomerase type IIA subunit B region 2
FT                   domain protein"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit; InterPro
FT                   IPR018522:IPR003594:IPR013506:IPR001241; KEGG:
FT                   dfe:Dfer_2768 DNA topoisomerase IV subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; SMART: DNA
FT                   topoisomerase II; ATP-binding region ATPase domain protein;
FT                   SPTR: DNA topoisomerase type IIA subunit B region 2 domain
FT                   protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; DNA gyrase B; DNA gyrase B subunit,
FT                   carboxyl terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15852"
FT                   /db_xref="GOA:E4RS36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS36"
FT                   /protein_id="ADQ15852.1"
FT                   /translation="MAENNYDESSIRSLDWKEHIRLRPGMYIGKLGDGSAPDDGIYVLL
FT                   KEVIDNCIDEYAMGHGKAIEVSIDEGKVSVRDYGRGIPLGKVVDVVSKINTGAKYDSKA
FT                   FQKAVGLNGVGTKAVNALSSYFKVTAVREGEMKTAEFERGVLISESEIEKTDAKNGTHV
FT                   IFEPDNTVFKNYHFIGQYIENMIWNYCYLNSGLSIYLNRKKFYSANGLLDLLLRKTDES
FT                   SLRYPIIHLKGEDIEMALTHGNQYGEEYYSFVNGQNTTQGGTHLSAFKEAIVKTVRDHY
FT                   GKDYASEDVRQSIIGAIAVRIQEPVFESQTKTKLGSNNISLDENAPTVRTFVNDFVKEH
FT                   LDNYLHMHPDIKDALKRRIEQSERERKELAGVKKIANERAKKANLHNRKLRDCKYHLTD
FT                   EKFEGRLDTMLFITEGDSASGSITKARNPETQAVFSLRGKPLNCYGLSKKVVYENEEFN
FT                   LLQHALDIENGIETLRYNQIVIATDADVDGSHIRLLLLTFFLQFFPDLVREGHLFILQT
FT                   PLFRVRNKKETIYCYSDEEKQMAINKLGGKPEITRFKGLGEISPHEFEGFINKDIKLDP
FT                   VILEKESTIPKLLSYYMGKNTPERQGFIIDNLIIEQDILEDKEVEIVDEEI"
FT   gene            68026..69099
FT                   /locus_tag="Lbys_0057"
FT   CDS_pept        68026..69099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0057"
FT                   /product="chorismate mutase; prephenate dehydratase"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="4.2.1.51"
FT                   /note="COGs: COG0077 Prephenate dehydratase;
FT                   InterProIPR018528:IPR010957:IPR020822:IPR001086:IPR
FT                   008242:IPR002701; KEGG: sli:Slin_2566 chorismate mutase;
FT                   PFAM: prephenate dehydratase; Chorismate mutase, type II;
FT                   SPTR: Chorismate mutase; TIGRFAM: chorismate mutase; PFAM:
FT                   Prephenate dehydratase; Chorismate mutase type II; TIGRFAM:
FT                   chorismate mutase domain of proteobacterial P-protein,
FT                   clade 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15853"
FT                   /db_xref="GOA:E4RS37"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS37"
FT                   /protein_id="ADQ15853.1"
FT                   /translation="MKIEEVRKEIDQIDEQLIKLLNERMRWVQKVGEIKRETKGSIYRP
FT                   EREKWIVEKMISLSDGPLNASAIEAIFLEIFAAARNIELPERVAYLGPEGSFTHQAAES
FT                   RFGAVSEYMTLPTIRSVFEAVETERARFGVIPIENNQEGIVYETVDLLSATDVNIAAEL
FT                   KIPVHFTLATEAENPAKIKRIYSKDIAFRQCRGFLNKYFEQHNPEEIQVESTSKAARLA
FT                   AADPESAAICSEIAAKLFRLPVLFHNIEDNSNNRTRFIILSKDYENQPSGNDKTTIVAK
FT                   LPKTDEAGSLAKFLQDFRKGNINLTKIESRPYKGSEDFNFWFFIEFLGYYKDENFQKIL
FT                   KKHGDYIKVLGSYVRNA"
FT   gene            complement(69100..70662)
FT                   /locus_tag="Lbys_0058"
FT   CDS_pept        complement(69100..70662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2544 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15854"
FT                   /db_xref="GOA:E4RS38"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS38"
FT                   /protein_id="ADQ15854.1"
FT                   /translation="MSKKVFVIIAVCVIALLWWYQYSITVNVPWWDDFHGIILPVHDLF
FT                   TDLPLGEKLHSFFSLNNEHRVVNDRIFTLLVFLISGKFELKTVALLGFINLIGILWVVI
FT                   SVARRRAIKWEALLPMVFLIFHAQYYESLQSLMVPFQNFSVIFYFLVSIYLISIKRNYI
FT                   WGFVFATLAFFSHGNGILALLIGGALLFVHQDYKALGIWIGASVLTVALYFWGYTKPNW
FT                   THTDVISPWEHPLQAIAYSLEFLGAYALNIVEISSRLSNSPLKQKLPQFFGLVIVLFSL
FT                   LILFRKYALRRILSQLRTEPTDQFFLAMAAFFLGTGIMMGLTRTGFPVLSRYTINSSLL
FT                   LVAIWGYYATNYRGHGRKLWLGFTILIWLLSYYNATERAFYNRENALADAYNYQKTGTW
FT                   ANQYSDSAHVSRVNPLLIAPWQKGEYQFPKETDLSALAGSNGTRIDNWDEVNGHLMVHG
FT                   ESAEVPYFALRSEDYTFIFPGKRLRNSPLEIIKGKGYFSHQFSTAFPLEVIPSRNYQLF
FT                   RIK"
FT   sig_peptide     complement(70588..70662)
FT                   /locus_tag="Lbys_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(70659..71594)
FT                   /locus_tag="Lbys_0059"
FT   CDS_pept        complement(70659..71594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0059"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="COGs: COG0196 FAD synthase; InterPro
FT                   IPR004821:IPR002606:IPR015864:IPR015865; KEGG:
FT                   sli:Slin_0790 riboflavin biosynthesis protein RibF; PFAM:
FT                   Riboflavin kinase; FAD synthetase; SPTR: Riboflavin
FT                   biosynthesis protein RibF; TIGRFAM: riboflavin biosynthesis
FT                   protein RibF; cytidyltransferase-related domain protein;
FT                   PFAM: Riboflavin kinase; FAD synthetase; TIGRFAM:
FT                   riboflavin kinase/FMN adenylyltransferase;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15855"
FT                   /db_xref="GOA:E4RS39"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS39"
FT                   /protein_id="ADQ15855.1"
FT                   /translation="MKIYHNLKDFQPKGNAVVTTGTFDGVHLGHKKIIKRLIEKAKEIG
FT                   GESVLLTFWPHPKLVLSPDSHTRVTRILSTIEEKTELLETLGLDHLVILPFTREFSELS
FT                   CEKYIEEVLISGFGTKAMVIGYDHRFGKNREGGIDYLIQHSERFKIEIEEINRQEIDNI
FT                   TISSTKIRKAIEEGDIQTANELLGRNYDFCGTVVKGRQLGRQIGYPTANVQTQNEFKLI
FT                   PKNGVYAVYAWVRGQKFGGVMNIGVRPTVEGKGITQEVYIFDFSDDIYGESVKVEIVDF
FT                   IREEQKFDSIEALIQQIKQDVIASQRILQL"
FT   gene            complement(71591..72271)
FT                   /locus_tag="Lbys_0060"
FT   CDS_pept        complement(71591..72271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0060"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR014780:IPR002501; KEGG: zpr:ZPR_4442 tRNA pseudouridine
FT                   synthase B; PFAM: pseudouridylate synthase TruB domain
FT                   protein; SPTR: Putative tRNA pseudouridine synthase;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM: TruB family
FT                   pseudouridylate synthase (N terminal domain); TIGRFAM: tRNA
FT                   pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15856"
FT                   /db_xref="GOA:E4RS40"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS40"
FT                   /protein_id="ADQ15856.1"
FT                   /translation="MIEEYQAGQVLLIDKPLNWTSFDAVNKLKYAFKPHKIKIGHAGTL
FT                   DPLATGLLVICVGKKTKEIETYQGQKKVYTGKIMLGSTTPSFDLETEIDATYPTAHITK
FT                   EGLEEARKSFLGTIAQIPPVFSAIKVDGKRAYESARKGDSVELKAREITIENFELDDTN
FT                   FPELAFKVTCSKGTYIRSLARDLGTALGSGAHLTALRREKIGEFDVKDALQVQEAVDKI
FT                   KASL"
FT   gene            complement(72271..73065)
FT                   /locus_tag="Lbys_0061"
FT   CDS_pept        complement(72271..73065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0061"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="COGs: COG1968 Uncharacterized bacitracin resistance
FT                   protein; InterPro IPR003824; KEGG: fjo:Fjoh_0569 putative
FT                   undecaprenol kinase; PFAM: Bacitracin resistance protein
FT                   BacA; SPTR: Undecaprenyl-diphosphatase; TIGRFAM:
FT                   undecaprenol kinase; PFAM: Bacitracin resistance protein
FT                   BacA; TIGRFAM: undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15857"
FT                   /db_xref="GOA:E4RS41"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS41"
FT                   /protein_id="ADQ15857.1"
FT                   /translation="MEVFHAIILAIIEGLTEFLPVSSTGHMIIASALMGLESDAFVKLF
FT                   TIAIQLGTILSVLVLYYKRFFKSFDFYFKLVVAAVPASILGFLFSDLIDGLLESPLTVG
FT                   ITLVLGGIVLLFVDGWFNQPTIDDSDEISYAQALKIGLFQCLALIPGTSRSASTIVGGM
FT                   TQKLTRKAAAEFSFFLALPMMFGATVLKLKDYLDQGFQLTEKEWYLLGIGNFIGFIVAI
FT                   LAIKFFIGVVSKYGFKAFGWYRIIVGGIIIVMLLSGKSLEIL"
FT   sig_peptide     complement(72997..73065)
FT                   /locus_tag="Lbys_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(73066..73275)
FT                   /locus_tag="Lbys_0062"
FT   CDS_pept        complement(73066..73275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1244 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3098)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15858"
FT                   /db_xref="GOA:E4RS42"
FT                   /db_xref="InterPro:IPR021448"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS42"
FT                   /protein_id="ADQ15858.1"
FT                   /translation="MSNSTEKSGLPFKKDNYVHMLIGLTLIILGFIIMTLDKEEFGFGF
FT                   LGITLGPIIAFIGFIYEFYAILKK"
FT   gene            complement(73278..74156)
FT                   /locus_tag="Lbys_0063"
FT   CDS_pept        complement(73278..74156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0063"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG2177 Cell division protein; InterPro
FT                   IPR003838; KEGG: dfe:Dfer_1243 protein of unknown function
FT                   DUF214; PFAM: protein of unknown function DUF214; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15859"
FT                   /db_xref="GOA:E4RS43"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS43"
FT                   /protein_id="ADQ15859.1"
FT                   /translation="MSINRKLGNYPGILITVSLTVALFLIGFCGWIAITSKELIKYVRQ
FT                   NVEIQVYMDKGLDSVSIHQLRSKLEALNVAEIEKGKPAIALITKDQAADIFFKETKENY
FT                   KEVLGENPFSDAYTIKLQEENINEARLQELKTKIEKIEGVSDVDYPRDFLKGIITNVNK
FT                   IYKVVAIIVLIFFVATLLLINNTIKLALYSQRFIIRTMQLVGATDGFIQKPFLKTGFFQ
FT                   GLFAGILSIALVYFTQNAAATQVEGLNLLANQELTWILYLILLVLGPLVGVLSTYQSVA
FT                   RYHKMDLDKLY"
FT   sig_peptide     complement(74058..74156)
FT                   /locus_tag="Lbys_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74227..75087)
FT                   /locus_tag="Lbys_0064"
FT   CDS_pept        complement(74227..75087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0064"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="InterPro IPR002123; KEGG: dfe:Dfer_4159
FT                   phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR:
FT                   Phospholipid/glycerol acyltransferase; PFAM:
FT                   Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15860"
FT                   /db_xref="GOA:E4RS44"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS44"
FT                   /protein_id="ADQ15860.1"
FT                   /translation="MIKVLKNFLPRPAKTSNSLLKALSYLDILGIFQKDPFGNPMLLKR
FT                   FIIFIAGWPTFWRIAVANKLKVEGVEYLKELPDRNVFFISNHQTYFADVITFYHIFCNT
FT                   KWGFGKKLFPIYLFAPRAFVFYVAAKETMKKGLIPKIFSLAGAILVERSWRAEGQNVKR
FT                   NVDLSAGDNVSKALQEGWVVSFPQGTTSPYAPIRKGTAHIILDNKPIIVPVVINGFRRA
FT                   FNKTGLKYKRRNTTLTVKFKPPFQVDENSTLEGITKTIEEIIEQSMPEMIAEWNALKEM
FT                   AKRGE"
FT   gene            complement(75087..75650)
FT                   /locus_tag="Lbys_0065"
FT   CDS_pept        complement(75087..75650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0065"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729:IPR001943; KEGG: sli:Slin_0711 protein
FT                   of unknown function DUF151; PFAM: protein of unknown
FT                   function DUF151; UvrB/UvrC protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Uncharacterised ACR,
FT                   COG1259; UvrB/uvrC motif"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15861"
FT                   /db_xref="GOA:E4RS45"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS45"
FT                   /protein_id="ADQ15861.1"
FT                   /translation="MERIRLEILNLSPSQLQAGSFTLVLNEVSGDRRLPIIIGMFEAQA
FT                   IAIEMEKLAPTRPLTHDLFKSFAKAFDFSVEEIHISDIQEGVFFSKVICTDGIRQKYID
FT                   ARPSDAVAIALRFNAPIYTTEEVLTVAGISSDEVTDVEPEEPKSKNNLTTLSTEELQNM
FT                   LNEAIANEEYERAAQIRDEIEKRN"
FT   gene            complement(75680..76459)
FT                   /locus_tag="Lbys_0066"
FT   CDS_pept        complement(75680..76459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0066"
FT                   /product="Conserved hypothetical protein CHP02757"
FT                   /note="InterPro IPR014127; KEGG: chu:CHU_2841 hypothetical
FT                   protein; PFAM: Conserved hypothetical protein CHP02757;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF2400); TIGRFAM: conserved hypothetical
FT                   protein TIGR02757"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15862"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS46"
FT                   /protein_id="ADQ15862.1"
FT                   /translation="MWSASNQLIDLLEEKHKQFNSPEFIDTDPISIPHLFTQKQDIEIA
FT                   GLFASILAWGQRKTILKKCNELLERMDYAPYQFIQGAKDQDLKRLEGFVHRTFNDFDLL
FT                   YTVSFLQEHYAKHESLESAFAGNKEDEHVRSHLSNFRKKFTKGESVRTGKHISTPDKKS
FT                   ACKRLNMYLRWMVREDDKGVDFGIWKEIKPYQLVLPCDVHVERVAKHLGLTDRIKPDWD
FT                   MAIEITNRLKTIDPKDPARFDFALFGMGIEKYFTVSI"
FT   gene            complement(76443..77219)
FT                   /locus_tag="Lbys_0067"
FT   CDS_pept        complement(76443..77219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0067"
FT                   /product="Peptidoglycan-binding lysin domain"
FT                   /note="InterPro IPR018392:IPR002482; KEGG: dfe:Dfer_5051
FT                   peptidoglycan-binding LysM; PFAM: Peptidoglycan-binding
FT                   lysin domain; SMART: Peptidoglycan-binding LysM; SPTR:
FT                   Possible LysM domain; PFAM: LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15863"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS47"
FT                   /protein_id="ADQ15863.1"
FT                   /translation="MQFKLSKIMKKILTAISAMLIAFSAAAQSEGAFILHKVAPKETLY
FT                   SLVKRYNTNFATVETLNPTLANGNSDIKVGQTIKFPKNTAVSTPTKSSTVHVVKANETV
FT                   FSISKLYNVDISNLVEANKITDNTIKIGQKLIVDGATLVDLASKAPREEELRLKPVGKS
FT                   IKETGIAEVIKTPNKSTKYLALHRTAPIGTNIKVTNDATGHTIVAKVIGNLNEKGPDEN
FT                   IMIKLSPYAYYQLRPKDSRLRATVEFYLSNNDVVSQ"
FT   sig_peptide     complement(77133..77219)
FT                   /locus_tag="Lbys_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            77294..78043
FT                   /locus_tag="Lbys_0068"
FT   CDS_pept        77294..78043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0068"
FT                   /product="3-deoxy-D-manno-octulosonatecytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="COGs: COG1212 CMP-2-keto-3-deoxyoctulosonic acid
FT                   synthetase; InterPro IPR004528:IPR003329; KEGG:
FT                   dfe:Dfer_5048 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase; PRIAM: 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase; SPTR: 3-deoxy-manno-octulosonate
FT                   cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15864"
FT                   /db_xref="GOA:E4RS48"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS48"
FT                   /protein_id="ADQ15864.1"
FT                   /translation="MKILGIIPARYASSRLPAKLLLEVDGKSILQMVYERCLKAKSLSD
FT                   VVIATDSTIVEEHVKSFGGQVVLTSDKHPSGTDRCAEALRLMGGTINYDFVINIQGDEP
FT                   LMDPQNIDLLSSSFKITSEISSVFIKIKDTDTLLNPNVVKVVLNEQKEAMYFSRSPIPH
FT                   LREVPTENWVEEADFYKHIGMYGFRADILERIVKLPLAKLEAQEKLEQLRWLTNGYKVR
FT                   MVEVFSDGIGIDTEEDFQRLKQFLKKN"
FT   gene            78077..79642
FT                   /locus_tag="Lbys_0069"
FT   CDS_pept        78077..79642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0069"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR013973; KEGG: sli:Slin_3042 response
FT                   regulator receiver protein; PFAM: response regulator
FT                   receiver; PglZ domain protein; SMART: response regulator
FT                   receiver; SPTR: Response regulator receiver protein; PFAM:
FT                   PglZ domain; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15865"
FT                   /db_xref="GOA:E4RS49"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS49"
FT                   /protein_id="ADQ15865.1"
FT                   /translation="MQRSTILWADDEIELLKPYIVFLESKGYDVTPVPSGADALDRVEK
FT                   ENFDLIFLDEMMAGMTGLDTLNEIKKIKPNIPVVMITKSEEERIMEEAIGSKIADYLIK
FT                   PINPNQILLSAKKLLENKRLVAEKTNSSYMQDFRQLAMQYNEELDFQEWADIYRKLVFW
FT                   ELEIDGSTDKSMEEVFQMQKSEANTRFAEFIEDNYEDWMTSPNVKKPVLSHTLLKNKVF
FT                   PHLREGDPLFFVLIDNFRFDQWKILEEIISDFFVAEDEDAYYSILPTATGYARNAIFSG
FT                   LTPYDMAKQHPDLWVNDEGDNEEGLNKNEEEFLRRHLKKANINHTFGFYKILNNTQAKN
FT                   LVDGFNNLLKDDLVVVVFNFIDMLSHARTDMAVIKELAPDEAAYRSITRSWIQHSPLLD
FT                   FLKLIAAKNGRLIITTDHGMVKVKNPKRIVGDRNVNTNLRYKQGKNLNLDDKGDFVIEV
FT                   RKPENYKLPSPNLSTSYYFTTNDYFFAYPNNYNYYVSHYRDTFQHGGVSLEEMIIPVVK
FT                   LKTK"
FT   gene            complement(79658..80338)
FT                   /locus_tag="Lbys_0070"
FT   CDS_pept        complement(79658..80338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0070"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG2884 ATPase involved in cell division;
FT                   InterPro IPR017871:IPR003439:IPR003593; KEGG: sli:Slin_3028
FT                   ABC transporter related protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Cell division ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15866"
FT                   /db_xref="GOA:E4RS50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS50"
FT                   /protein_id="ADQ15866.1"
FT                   /translation="MANSVITLQNADIYQKDKLVLSDVNFSIEEGEFVYLIGKTGSGKS
FT                   SLLKTLYADLWLEKGTGTVAGFQLEKMRHKEVPYLRRKIGIIFQDFQLLTDRNVHQNLQ
FT                   FFMGAMGWKDKAEIEDRIAEVLELVGLPDVLQKMPHQLSGGEQQRIAIARALLNHPEIL
FT                   LADEPTGNLDPEKSIEILKLFFKINQVSKTAVLMATHGLDLIERYPKRTLYCEGGKVRD
FT                   LHQA"
FT   gene            complement(80342..80998)
FT                   /locus_tag="Lbys_0071"
FT   CDS_pept        complement(80342..80998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0071"
FT                   /product="transaldolase"
FT                   /note="COGs: COG0176 Transaldolase; InterPro
FT                   IPR018225:IPR004731:IPR001585; KEGG: cat:CA2559_10763
FT                   transaldolase; PFAM: Transaldolase; SPTR: Transaldolase;
FT                   TIGRFAM: transaldolase; PFAM: Transaldolase; TIGRFAM:
FT                   fructose-6-phosphate aldolase, TalC/MipB family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15867"
FT                   /db_xref="GOA:E4RS51"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS51"
FT                   /protein_id="ADQ15867.1"
FT                   /translation="MKFFIDTASLSEIKEAQDLGILDGVTTNPSLMAKEGITGEENIKN
FT                   HYKEICNIVSGDVSAEVISTDYEGMIREGQELVKLHEQIVVKIPMTKDGVKAIKYFSER
FT                   GIKTNCTLVFSAGQALLAAKAGATYVSPFIGRLDDISTEGLILIEDIRTIYDNYGFATE
FT                   ILAASVRTPMHILNCAKIGADVMTGPLSAILALLNHPLTDIGLAKFLADYAKGNK"
FT   gene            complement(81024..81104)
FT                   /locus_tag="Lbys_R0001"
FT   ncRNA           complement(81024..81104)
FT                   /locus_tag="Lbys_R0001"
FT                   /product="RNA component of signal recognition particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            81288..83096
FT                   /locus_tag="Lbys_0072"
FT   CDS_pept        81288..83096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0072"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="COGs: COG0322 Nuclease subunit of the excinuclease
FT                   complex; InterPro IPR004791:IPR000305:IPR001162; KEGG:
FT                   sli:Slin_3221 excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; SMART: Excinuclease ABC C subunit
FT                   domain protein; SPTR: UvrABC system protein C; TIGRFAM:
FT                   excinuclease ABC, C subunit; PFAM: UvrC Helix-hairpin-helix
FT                   N-terminal; GIY-YIG catalytic domain; TIGRFAM: excinuclease
FT                   ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15868"
FT                   /db_xref="GOA:E4RS52"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS52"
FT                   /protein_id="ADQ15868.1"
FT                   /translation="MIKFDYKNTLSHLPTEPGIYKYFNADGEIIYVGKAKNLKNRISSY
FT                   FHNYDRADRKTRKLVESIHHLEYTIVPTEWDALLLENNLIKEHQPKYNILLRDDKTYPY
FT                   ICVTHERFPRVIFTRRIEDRSRGRMYGPYVSAKPMYALLDMFSQLYTIRTCKYQLSKEN
FT                   VEAGKFKVCLEYHIGNCKGPCEGLQSEEEYMHEIEQVHDILKGNLGPAKSYFQERMEAA
FT                   AGRLAFEEAHKLKSKLEFLENYQAKATVVTPTIKDADVFTIQSDETAAYVNYLKIMNGS
FT                   IISTQTMEVKKRLNETDEEILSIIMLELRTKYESTAREIISNLDPDIDFKATITVPQTG
FT                   DKKKLVEMSLRNVVFYRHEKAEKEAITKSGNANKRDRVLIKMKQDLHLPSLPRHIECFD
FT                   NSNIQGTNPVSAMVCFINGQPSPKNYRHYIPRTVEGPDDFATMREVVGRRYTRLVESGS
FT                   PLPDLIIVDGGKGQLSAACEALKSIGIYGKVPIIGIAKRLEEIYFPEDSLPIYIDKKSE
FT                   TLQLIQRCRDEAHRFGITHHRNRRSKNFLISSLESAPGIGKTTATKVLSHFKTIGNIKA
FT                   ASEEELIQVLGKDKARRVREFLETES"
FT   gene            complement(83130..84281)
FT                   /locus_tag="Lbys_0073"
FT   CDS_pept        complement(83130..84281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0073"
FT                   /product="glucose/sorbosone dehydrogenase"
FT                   /note="COGs: COG2133 Glucose/sorbosone dehydrogenase; KEGG:
FT                   zpr:ZPR_1474 glucose/sorbosone dehydrogenase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Glucose / Sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15869"
FT                   /db_xref="GOA:E4RS53"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS53"
FT                   /protein_id="ADQ15869.1"
FT                   /translation="MKRIFSLLWCVLALASCSESTAKTEEEQEVVSDNFELSTELVLGD
FT                   RGAIWGFEFLPDGGIIFTERSGKIGIFKDGKVTELAGVPKVAYESQGGLLDIALHPDFA
FT                   NNGWIYTAYLENVGKAARMNLIRFKIENNALANVEKLLSTSATNEWKGHNGSRILFDKH
FT                   GYLFWSVGEGGKTSRGGKDSPNKNAQNVKELWGKVHRLHDDGKIPSDNPVLPGNTEPTS
FT                   IYSYGHRNPQGLAYNAEADEVWESEHGPRGGDELNLIKKGENYGWPFVSYGINYDEVDI
FT                   SGKKHEGYTEPTFQWTPSLGACGLTYLTSDKYGSWKGSLFAGALALNHVSRIYFENGVA
FT                   KEEKILQDVGRVRDVVQGPDGFLYLSLEGPGRIVKVVPSPKTK"
FT   sig_peptide     complement(84210..84281)
FT                   /locus_tag="Lbys_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            84995..86369
FT                   /locus_tag="Lbys_0074"
FT   CDS_pept        join(84995..85078,85080..86369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Lbys_0074"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; PFAM: Reverse transcriptase
FT                   (RNA-dependent DNA polymerase); Group II intron,
FT                   maturase-specific domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15870"
FT                   /db_xref="GOA:E4RRI8"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI8"
FT                   /protein_id="ADQ15870.1"
FT                   /translation="MRVGRKLIVKCKRSLAESCNEVDTMPEVFFSNTMLEEILHIRNVK
FT                   HAVDRVISNGGASGVDGMQIDNLRDYLNTHWQSLRSDILSGTYRPQAVRKVEIPKASGG
FT                   KRMLGIPTVIDRVIQQSISQWLGLKYEGDFHDNSYGFRPNRNAHQAVIKAQEYLNLGYT
FT                   WVVELDLEQFFDQVNHDILMHLLSKKITDRRVLALIGKYLRCGIMDHGLEQKRTKGTPQ
FT                   GSPLSPLLSNIILNELDTELSSRGHRFVRYADDCSIYAKSNKSATRIMRNITSYIESTL
FT                   KLKVNREKSKVSKPSQSSLLGFSFFKTQGDWQIRISAKSIERIREKLRQNTRRNTATPM
FT                   HERLTKLRQIIHGWVDYFRIATNKKVMVTLDELVRRRLRVLLWKQWKTAGNRIRNLMKL
FT                   GAKRWLAYQHANTRKSYTRTGTSPIVQTTLTNSYFTKLGYEGFADYYYWRTTHQTTLF"
FT   gene            complement(86463..88733)
FT                   /locus_tag="Lbys_0075"
FT   CDS_pept        complement(86463..88733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0075"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="COGs: COG1048 Aconitase A; InterPro
FT                   IPR018136:IPR006248:IPR001030:IPR000573; KEGG:
FT                   sli:Slin_2025 aconitate hydratase; PFAM: aconitate
FT                   hydratase domain-containing protein; SPTR: Aconitate
FT                   hydratase; TIGRFAM: aconitate hydratase; PFAM: Aconitase
FT                   C-terminal domain; Aconitase family (aconitate hydratase);
FT                   TIGRFAM: aconitate hydratase, mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15871"
FT                   /db_xref="GOA:E4RS55"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS55"
FT                   /protein_id="ADQ15871.1"
FT                   /translation="MKVFDLDMIKAVYARIPERVDAAKQLLGRPMTLSEKILYAHLWEN
FT                   LPGKPYTRGVDYVDFAPDRVAMQDATAQMALLQFMQAKREKVAVPSTVHCDHLIQAKVG
FT                   ATEDLKTATETNKEVYDFLSSVSNKYGIGFWKPGAGIIHQVVLENYAFPGGMMIGTDSH
FT                   TPNAGGLGMVAIGVGGADACDVMSGLAWELKMPKLIGVKLTGTLKGWASPKDIILEVAG
FT                   RLTVKGGTGAIVEYFGTGADKLSATGKGTICNMGAEIGATTSIFGYDKKMAKYLMATGR
FT                   RSVAIAANKIKNYLRPDQECIDNPQAYYDEVIEINLSKLEPRINGPFTPDLAWPLSKFA
FT                   AAVKKNKWPQELSVGLIGSCTNSSYEDLTRAASIAQQAADKHIKAKAQYTITPGSEMVR
FT                   FTAERDGLLDTFAKIGGVTLANACGPCIGQWARHGAEKGERNSIITSFNRNFAKRADGN
FT                   PNTHAFVASPEIVTAFAIAGDLTFNPAKDTITNEKGEQVKLDPPLGVELPPRGFDVIDA
FT                   GYQKPARSGKNVKVKVSPKSDRLQLLDPFKPWEGTDLTGLKLLIKAKGKCTTDHISMAG
FT                   PWLKYRGHLDNISNNLLIGAVNFANDATNKVKNQLTGEYGEVPATQRAYKAAGIGSIVV
FT                   GDENYGEGSSREHAAMEPRHLGVRAILVKSFARIHETNLKKQGMLALTFANAADYDKIQ
FT                   EDDTFDILGLTTFAPGKPLTVVAHHKDGSKDEIVVNHTYNEAQIKWFKAGAALNLIAQG
FT                   EVA"
FT   gene            88994..91462
FT                   /locus_tag="Lbys_0076"
FT   CDS_pept        88994..91462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0076"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="COGs: COG0550 Topoisomerase IA;
FT                   InterProIPR000380:IPR005733:IPR006171:IPR013497:IPR
FT                   006154:IPR003601:IPR003602; KEGG: sli:Slin_2030 DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain-containing protein; PRIAM:
FT                   DNA topoisomerase; SMART: DNA topoisomerase I DNA-binding;
FT                   DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain-containing protein; SPTR: DNA topoisomerase;
FT                   TIGRFAM: DNA topoisomerase I; PFAM: Toprim domain; DNA
FT                   topoisomerase; TIGRFAM: DNA topoisomerase I, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15872"
FT                   /db_xref="GOA:E4RS56"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS56"
FT                   /protein_id="ADQ15872.1"
FT                   /translation="MSKNLVIVESPAKAKTIEGYLGKDFIVKSSFGHIRDLPDKGMGID
FT                   IEKDFEPTYQISPDKVKVVNELKKEAKDKEVWLATDDDREGEAISWHLKEALGLKPDTK
FT                   RIVFREITKNAINKAIETPRTIDLDLVNAQQARRILDRLVGFQLSPVLWRKIKAGERKN
FT                   LSAGRVQSVTVRIVVEREREIEQFKSTSTYKIVADFHVSNGKVLSAELPKNLETREQAE
FT                   QFLNDCVQAIFSISSLEVKPTTKSPAPPFTTSTLQQEASRKLSFSVQQTMTLAQRLYES
FT                   GKITYMRTDSTNLSAEAVAAAKDQIAKAYGEEFSKSRVFKTKDKSAQEAHEAIRPTDFS
FT                   VMSAGEDRNEKRLYDLIWKRAIASQMAEAKIERTIAKIGISTRPEELTASGEVIKFEGF
FT                   LKVYMEGSDEEDEESKGMLPPLNVGQTLDMLQMKATERYSRPPARYTEASLVKKLEELG
FT                   IGRPSTYAPTISTVIKREYVVKEDRPGQTRDITELVLKEGQIQSAVKQETFGSEKAKLF
FT                   PTNLGMIVNDYLVENFENILDYKFTADMEADFDEIAEGKVSWQKMIKDFYKDFQVKVEQ
FT                   AAEGASASTQSHELGVDPDSGKKIFAKVGRFGPYLQIGEATDEEKPTFVSLKKGTLISS
FT                   LTYEEALDILRGPKLPLELGLHEGHPIVVNEGRYGPYVLYNGKFYNLDKGEDPLTVTKE
FT                   RAIALIAAKQSGAEGSLPREMSEYDGQAVTIGKGRFGPYIKWGSKYFNIPKTEDPLTMD
FT                   DAKVAELIQAGQKEAANKVIKEFPENDKVKVLNGRYGPYIQIGKRNVKIPKGVEPENLT
FT                   LEECLKLGSA"
FT   gene            complement(91459..92190)
FT                   /locus_tag="Lbys_0077"
FT   CDS_pept        complement(91459..92190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0077"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594; KEGG: bbe:BBR47_57910 two-component
FT                   hybrid sensor and regulator; PFAM: ATP-binding region
FT                   ATPase domain protein; SPTR: Response regulator receiver;
FT                   PFAM: Histidine kinase; Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15873"
FT                   /db_xref="GOA:E4RS57"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS57"
FT                   /protein_id="ADQ15873.1"
FT                   /translation="MITVLLVASCLSIGVLLLRRERLRTAEKIKSLEHLNQLYVQAAKQ
FT                   LSAYETRTEIGQKLHDDLSSTLAGIVQNMEVLQKQTLDEELRKKIHFLSQEAEKVYDKV
FT                   RGKSHELFIHHSEYDLFEDNVYRLVDLLCPDSSIHKEIEIEREIASQLDLSQRIELLRI
FT                   LQEVLTNTMKHGKDVSEIFIFLYENELGAPVFQVGDNGSSFNGNSDGIGIRSIRKRVAQ
FT                   LEGQLQLETKGGVAYTITLPS"
FT   sig_peptide     complement(92107..92190)
FT                   /locus_tag="Lbys_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            92518..92733
FT                   /locus_tag="Lbys_0078"
FT   CDS_pept        92518..92733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_6093 hypothetical protein; SPTR:
FT                   P47phox"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15874"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS58"
FT                   /protein_id="ADQ15874.1"
FT                   /translation="MFKSLQIRKTNPYFCSSGSNNNKLIDMEPVVKKRYTKPVLLKHGM
FT                   LRKLTLKSGSAVDFTEPSSSDWGGED"
FT   gene            92736..94508
FT                   /locus_tag="Lbys_0079"
FT   CDS_pept        92736..94508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0079"
FT                   /product="asparagine synthase"
FT                   /note="COGs: COG0367 Asparagine synthase
FT                   (glutamine-hydrolyzing); InterPro IPR001962; KEGG:
FT                   sli:Slin_0568 asparagine synthase (glutamine-hydrolyzing);
FT                   PFAM: asparagine synthase; SPTR: Asparagine synthase
FT                   (Glutamine-hydrolyzing); PFAM: Asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15875"
FT                   /db_xref="GOA:E4RS59"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS59"
FT                   /protein_id="ADQ15875.1"
FT                   /translation="MLLDLYFLDSISSFYSHLGINVWFKGDNSNLGSLNRYEGDSCEEK
FT                   IIHAFLAVNESCFKELKHEFLLVLQTEDCTYLVRDRFGVQSLYFCQESNKITVSDNLRI
FT                   LGKGKSPDSIEVYNYINFSISKESSINSGTFFSEVYQVPPSYYVKIDNDGNKLFRSYYS
FT                   AVPKPFFIHSSSDVFRDLLTKSIKRGLVNSQKIGSHLSGGLDSSVVTTLLRHVVSEDIS
FT                   CYYYDSGDTSHRDLDYARLVADNLDLPLHVVNTSGENIFTHQRWLCERTGFPEVFILPS
FT                   TTHIELSEELREKGISRMFTGIDGDSVVGHGLGYLQDLKSDGDWEKYLTLFVENFLARE
FT                   YTSITLDAYKKKLIVKEVLTLVRKNDWRSIAALLKSANLLWGYVPGSYLKVLLNKVISN
FT                   VFSKLDLVPDPSLLNYSIGELSAESYYDIYDINNRELLENFRAVINGSYPYSFNQFNEI
FT                   SRFYNFEYKHPFFDQELFEFCLGVPNEIRFGGGKTRWVMREAMNELLPQKLLNRTTKDD
FT                   FSYYLISSFISLWNSNSEFFLDHSSLWHWVNKKEFMRGISYVIKKGPHVKSNSLLARKL
FT                   IRVLYLGIWLDTIQ"
FT   gene            94727..98398
FT                   /locus_tag="Lbys_0080"
FT   CDS_pept        94727..98398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0080"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829; KEGG: cpi:Cpin_3623 outer
FT                   membrane adhesin like protein; SPTR: VCBS"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15876"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS60"
FT                   /protein_id="ADQ15876.1"
FT                   /translation="MKRASIHFKLRSWSYVLCLFLLSGYAVNAQVASLPLNEPVPYVNP
FT                   KSPEITHVDNPLLSTFWHNNASSMGNAYNSDLGDYAVLAAPVLGLVDQKMTIDIGESVV
FT                   ASQSNPYFVGFDILNIDGLSIGLGNATFEIKLFNGDNTTPVATYDVNKDKLLGLLGLGL
FT                   LTGTGNPARIGFTLAPSTPVTFTRAMIVVNEHSLLSIGGTRVYNLVLGKYAPANYTTLP
FT                   CNLNVTIGAPNYPVQFTDRTSNRGVINPMGALDSSSDTFTELGGLNATLQGPISYAVGD
FT                   VFGNSFNTTNNSMFVGFDIENAQLLGLLDLNLLQNFSIQLYNNGSPVGTARTGTSLLSL
FT                   GLRVVGESGRTTIGFITADEFDEVELKLNQLLSATTTKVHGVVVKKFCTSTLACNTITT
FT                   ATNPDHPLYINLKRTTTAGLVNVSSITNPDNIINGSSDPATVVAIANVGSALSVSVANA
FT                   LETYPAGSYAGYIVESSSLLNASLIASAGIKLEFYNRSSATPDNPVYETPGAVLAGVGV
FT                   ISGSHTEVLGAICPVPFDEVRLVLVRSLLSVDLGGTKIHGFKVQKSCAEDVDCLTEGTL
FT                   TSQYHGAVVNGANTGVRIGAQVGLLDEPLEHLDRVVDNHPNNYASMNAVVGVVSRSSLS
FT                   VASTSLTFPKGSFAGFEVSKDGGLLDLGLLGDNNIRIVTFKDGVAVDSADVVNGSLISL
FT                   GLLSSGSGRSVIGFHSKGAFDEIQIRLLRVVAIETGFSLNIYGAVASARYGYDPGNEVY
FT                   CAADLIRPDQNTGFINTEIPGNTSTNDELPAGATYSAAGSPTVPPGANFTFNINANGSY
FT                   TFITDKEGTYTFPIKVCIDAWEGDCPVQNLTIYVLNRTVTNPPIAFHDFVKVPEGGSNF
FT                   EIDVKLNDIPGNVDGTLGNPFIGANPTKGSATVSNGKIYYTPNAGSVGRDFLIYTICES
FT                   PSGLCSSPVYVLIDIIPTGGSNSTIANDDQILMGVNSAGTGNVLANDYDPENHAQTVLL
FT                   IDLNGDGIPETAPIGSPQTVLYDGQIRGTITMNATTGDFTFVPANNFKGSISCVIEIGD
FT                   ELGATSKSTLVLIVKDTPDLLPVQTFGSNGANFNGIEERDFIIRIWEMLGGTALADEKQ
FT                   IVIQITKSSAFEITVPGLVLTSSPQTGFNGVASLGNSNPSYSNGSWEFYETPFAIRIVS
FT                   KSGYSLNPASSATLGFHIKRRPGFARAAQNITYTVAPYSGGETKIDNNYAFSQVILN"
FT   sig_peptide     94727..94813
FT                   /locus_tag="Lbys_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            98407..99393
FT                   /locus_tag="Lbys_0081"
FT   CDS_pept        98407..99393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1853 lipoprotein; SPTR: Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15877"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:E4RS61"
FT                   /protein_id="ADQ15877.1"
FT                   /translation="MKKIFILSVLSTVLSFSKVLGQDLQLNLNYRGSDIFVAGKGNIEV
FT                   SIANTLSSGSWQANKVAVVLSTSGTTLKFTGNISDLPGGSVCTFEDNALVVTIPAGSEG
FT                   YIFNVEVEGVSPDVDIIVGGVIDFYNDINTCDLGGMPLVGDQPDNNSSYTTVTVVAATP
FT                   VTLISFTGRAEGSIAVLDWATAEETEFSHFEIESSADALSFQKVGEVFAKGSNNNYTFS
FT                   TAQNEDLVYYRLKMVDHDGSFAYSKIIPVSLDESTAPSFLVYPNPTVDYLQIKNKEAGV
FT                   VRIIDVTGKQIRNQKVDAGIQVIDVKNLREGVYYGWLNEQSFKFVKK"
FT   sig_peptide     98407..98469
FT                   /locus_tag="Lbys_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(99626..102823)
FT                   /locus_tag="Lbys_0082"
FT   CDS_pept        complement(99626..102823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_0566 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15878"
FT                   /db_xref="GOA:E4RSM8"
FT                   /db_xref="InterPro:IPR001769"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSM8"
FT                   /protein_id="ADQ15878.1"
FT                   /translation="MRDRFILIMALIFGYSAQAQYNNDWIQYDQMYLKMVYTTTGVYRI
FT                   YKKDIEKLPSGIINPHNIQIFKKGKEIPCYEFGLNDNTFDESDYLELYLEANYGEQDSL
FT                   VYLPHSDRPPVYSNIFSDETAIFITVGKNKGLRNNIEAFKDSRAKENIVIIHEIQHLKD
FT                   IWSFNNATGQVPILQQSYYEKGESWTGPQINSVSEQKKEFTLQGYSPLVNHNITFKVLL
FT                   NTRSNNAHEINAKINLKNIGAFKTIGFDHQLFISEIPNSELSEKKSFTFSTSSNLQSDA
FT                   YSWTQFELLYPQKLDFKNRTSPLTYLPSSSEAEANFIIENAPEGLLAYDNSNPFSSRKL
FT                   PVDNNSIYISNRKNTKKIFLDSKISVFTKSVVVRYSKPSIEANYLIVTHPTLRSSAEEY
FT                   KTYRTSILGGSYKVEIMETQEIYDQFNYGERSPIAIKEYLRYQLQKSQNGEKFLFLIGK
FT                   PNTYPSTLFSQPEIDLVPSFGYPGSDVLLSSGINGSHIDVSTYLTGRIEATNNAEVLNY
FT                   LEKVKEFEDPKNHGSWIKKVLHMNGGNNINEISNFKNFMYNLGQKSIGSISNTHVDFLT
FT                   KSTTESVENINIGKYLNEGVGVISYFGHGSSTILDFNLGFASDPKLGYANKGKYPFMLF
FT                   NGCGVGNIFHRYEPLSSDWLFTPNKGAIAVLANSYYAYSNTSMDFFEIFYNKLYNDEET
FT                   LGKPIAKVYLESVKTHILRPNYEKYAQSNSQQMILQGDPAVVVNPFHKPDYTWKKNSVQ
FT                   ISSTNAGSSIGTSSQIVVSAEIQNLGKIEENQAIPVKAVVQYLNGTSESIGLRKITRSF
FT                   ENSYSDTLHITQPIRNITLILNPDSNIPELTFENNTENIEVDWDQAKNVSIYPYRPELD
FT                   KTNPTLLAFINDQLTTEGKYTKAPKITFKIQDENPLPVQIAGIRIYIKTNNQFTEIPTG
FT                   QYTLTQNSANQITGTFVSPEQIGNYELLINASDAAGNLAGQDLYLKWEIVENLTPSIIV
FT                   APNPVQERIKLLINSVGQDQVALQLYDLKGKEVFKSTFLVNDGLNTIYLDFSPKQGTYT
FT                   YVGTLNLKKITGKIIVE"
FT   sig_peptide     complement(102767..102823)
FT                   /locus_tag="Lbys_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            102902..103579
FT                   /locus_tag="Lbys_0083"
FT   CDS_pept        102902..103579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0083"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="COGs: COG0846 NAD-dependent protein deacetylase SIR2
FT                   family; InterPro IPR003000; KEGG: dfe:Dfer_1211 silent
FT                   information regulator protein Sir2; PFAM: Silent
FT                   information regulator protein Sir2; SPTR: Silent
FT                   information regulator protein Sir2; PFAM: Sir2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15879"
FT                   /db_xref="GOA:E4RSM9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSM9"
FT                   /protein_id="ADQ15879.1"
FT                   /translation="MNIVVLSGAGMSAESGLKTFRDMGGLWESFKIEDVATPEAFRKDP
FT                   DTVLRFYNERRKQAYVAEPNPGHKLLAELELTHSVKIITQNVDGLHEKAGSRTVLHLHG
FT                   ELSKVRSTGNPELIYEIGGDSIKSGQLAEDGFPLRPHIVWFGEEVPLMPLAEEWVAEAE
FT                   LFIVVGTSLQVYPAAGLLQYAHCPVWVIDPHKSNFNFRSNVQFISLSASLGLRHLVQVL
FT                   DLM"
FT   gene            103858..104502
FT                   /locus_tag="Lbys_0084"
FT   CDS_pept        103858..104502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0084"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR000792:IPR001789; KEGG: sli:Slin_4823 two
FT                   component transcriptional regulator, LuxR family; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   SPTR: Two-component system response regulator; PFAM:
FT                   Response regulator receiver domain; Bacterial regulatory
FT                   proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15880"
FT                   /db_xref="GOA:E4RSN0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN0"
FT                   /protein_id="ADQ15880.1"
FT                   /translation="MNNANFKNVSAIILDDHKLFADSFAKLVEFTTLFKSVNVYYNDQD
FT                   LIHSLIRFRSKDPIFLFVDYYLGEKSLPLFINDLRRVSKGIKIIVVSSLANPYLLQDLQ
FT                   KYSPDGILSKTATADELFDCIHEIFSGSTFVSPSVKSIMDSAEDDAGVPFTNREIELLQ
FT                   YFAKGLSINGAAEELKLSKHTIAAHRRKMMLKTNTSSITALLAEAKRLGVI"
FT   gene            104523..105293
FT                   /locus_tag="Lbys_0085"
FT   CDS_pept        104523..105293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0085"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="COGs: COG4585 Signal transduction histidine kinase;
FT                   InterPro IPR003594; KEGG: fjo:Fjoh_1988 integral membrane
FT                   sensor signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: Integral
FT                   membrane sensor signal transduction histidine kinase; PFAM:
FT                   Histidine kinase; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15881"
FT                   /db_xref="GOA:E4RSN1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN1"
FT                   /protein_id="ADQ15881.1"
FT                   /translation="MNILFFVLLIATLVACFLWVKYQRLRTEKEIAALRKLAEIQLEEA
FT                   CRQSVREVKSLIGQNLHDEFCSSLAGIVNQLDLLSKQSNASEIKTRIQDLHLKANEIYH
FT                   SVRTHSHSLYHSIEDAEYFEDNVHRILDLICPKDMYNVELDIDKGLTQKLHLVQRIEVL
FT                   RILQEALTNIIKHAKSANEIYIFLYGDGNNVIFQIGDNGMGTGKFSEGVGLNSIKNRVK
FT                   TLEGNLEIKYDEGFQLMITFPLEVSMRKSMYSVI"
FT   sig_peptide     104523..104591
FT                   /locus_tag="Lbys_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            105812..107186
FT                   /locus_tag="Lbys_0086"
FT   CDS_pept        join(105812..105895,105897..107186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Lbys_0086"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; PFAM: Reverse transcriptase
FT                   (RNA-dependent DNA polymerase); Group II intron,
FT                   maturase-specific domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15882"
FT                   /db_xref="GOA:E4RRI8"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:E4RRI8"
FT                   /protein_id="ADQ15882.1"
FT                   /translation="MRVGRKLIVKCKRSLAESCNEVDTMPEVFFSNTMLEEILHIRNVK
FT                   HAVDRVISNGGASGVDGMQIDNLRDYLNTHWQSLRSDILSGTYRPQAVRKVEIPKASGG
FT                   KRMLGIPTVIDRVIQQSISQWLGLKYEGDFHDNSYGFRPNRNAHQAVIKAQEYLNLGYT
FT                   WVVELDLEQFFDQVNHDILMHLLSKKITDRRVLALIGKYLRCGIMDHGLEQKRTKGTPQ
FT                   GSPLSPLLSNIILNELDTELSSRGHRFVRYADDCSIYAKSNKSATRIMRNITSYIESTL
FT                   KLKVNREKSKVSKPSQSSLLGFSFFKTQGDWQIRISAKSIERIREKLRQNTRRNTATPM
FT                   HERLTKLRQIIHGWVDYFRIATNKKVMVTLDELVRRRLRVLLWKQWKTAGNRIRNLMKL
FT                   GAKRWLAYQHANTRKSYTRTGTSPIVQTTLTNSYFTKLGYEGFADYYYWRTTHQTTLF"
FT   gene            complement(107266..107838)
FT                   /locus_tag="Lbys_0087"
FT   CDS_pept        complement(107266..107838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0087"
FT                   /product="LSU ribosomal protein L25P"
FT                   /note="InterPro IPR001021:IPR020055; KEGG: dfe:Dfer_0420
FT                   50S ribosomal protein L25/general stress protein Ctc; PFAM:
FT                   Ribosomal protein L25-like; SPTR: 50S ribosomal protein
FT                   L25; TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: Ribosomal L25p family; TIGRFAM:
FT                   ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15883"
FT                   /db_xref="GOA:E4RSN3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN3"
FT                   /protein_id="ADQ15883.1"
FT                   /translation="MKVTEIVGFKRANLGRQSAQELRAEGYVPGILYGGEEQISFYAPA
FT                   YLFRPVVYSIDAYEIKLTIDGKEYRAILQDKQFHPVNDSLIHVDLLEINPDKVITTTIP
FT                   VRLTGTAKGAKQGGKLVQTLRKVRVKGPAKLIPEFVNLDVTELGLGKSIRVKSIELPEL
FT                   TIIDPAANPVATVTIPRALRGQLNAEK"
FT   gene            complement(107841..108791)
FT                   /locus_tag="Lbys_0088"
FT   CDS_pept        complement(107841..108791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0088"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR000842:IPR005946:IPR000836; KEGG:
FT                   dfe:Dfer_0421 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: Ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15884"
FT                   /db_xref="GOA:E4RSN4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN4"
FT                   /protein_id="ADQ15884.1"
FT                   /translation="MAEVKIFSGTNSQYLAGKVAYYYGKELGKVSIQRFADSEISVNYE
FT                   ESVRGCDLFLVQSTFPNADNLMELLLMIDAARRASAHYVVAVIPYYGYARQDRKDRPRV
FT                   AIGAKLVANMLTAAGADRVMTLDLHAGQIQGFFDIPVDHLEGTSVFVPYLKEKNIDNLI
FT                   FASPDVGGVSRVRRFASFFDADIVICDKQRKVANQIASMQLIGDVKDANVVLVDDMIDT
FT                   GGTICKAAELILEKGAKSVRAVATHPVFSYKAHEIISNSVFEEVIVSDSIPLRQDNPKV
FT                   KVISVAELFAHAIGRIRDNGSISTLFINYQQKLKF"
FT   gene            108910..109230
FT                   /locus_tag="Lbys_0089"
FT   CDS_pept        108910..109230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_4612 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15885"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN5"
FT                   /protein_id="ADQ15885.1"
FT                   /translation="MQLSLIDQVPEFTKSYFLDVFAEASFSSGRMRLKTIQGQQVPEDL
FT                   SISIPSKFISLYPEGTIYKLDTKLIQKDGRKPYFVALKGKGIQRAIEFFDYNLKVQKKN
FT                   TH"
FT   gene            complement(109227..109985)
FT                   /locus_tag="Lbys_0090"
FT   CDS_pept        complement(109227..109985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_0235 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15886"
FT                   /db_xref="InterPro:IPR024213"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN6"
FT                   /protein_id="ADQ15886.1"
FT                   /translation="MLVDDRFNPVRCDAYDLYIEIQFNRLRFIAKKDEEILCLEDHFLG
FT                   VCTDPTHTSVQVEKLMAIHPFLCRKDWKSVHLISQFQIHALVPTEAFGEAEKYLCLVFN
FT                   DINKDNFIFFSEVIEKQTLHIGTLESIYQAFQKYYERIELHSPMTAGLRLTLERKKHQI
FT                   IISDHFLDYYFYYPKKGSVSVRRIPLIDLEELDVENQPTTLWGEITPYGNLYNQIKEKI
FT                   KSIEMGSINRGIANIYSELPQHRYITLLNI"
FT   gene            complement(109979..110383)
FT                   /locus_tag="Lbys_0091"
FT   CDS_pept        complement(109979..110383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0091"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086:IPR020476; KEGG: sli:Slin_1463
FT                   NUDIX hydrolase; PFAM: NUDIX hydrolase; SPTR: NUDIX
FT                   hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15887"
FT                   /db_xref="GOA:E4RSN7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN7"
FT                   /protein_id="ADQ15887.1"
FT                   /translation="MYGGRIRLRVCGLLWREDKILLLRHSGIGEDGIFWNCPGGGVEEG
FT                   ESIVQALTREFKEETKLEIQVQELYHWDEVIYGKLHGVELYFKVSASNFAAQLGKDPEG
FT                   NILTELRWFTKEEIHQLPKGHCPPFLRGLC"
FT   gene            complement(110395..111711)
FT                   /locus_tag="Lbys_0092"
FT   CDS_pept        complement(110395..111711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0092"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterProIPR011545:IPR001650:IPR014001:IPR014021:IPR 014014;
FT                   KEGG: sli:Slin_3330 DEAD/DEAH box helicase domain protein;
FT                   PFAM: DEAD/DEAH box helicase domain protein; helicase
FT                   domain protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; SPTR: DEAD/DEAH box helicase domain protein; PFAM:
FT                   Helicase conserved C-terminal domain; DEAD/DEAH box
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15888"
FT                   /db_xref="GOA:E4RSN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN8"
FT                   /protein_id="ADQ15888.1"
FT                   /translation="MQFSELNLNKPLLRALEDLQFSSPTPIQEKVFSVLMSGRDLAGIA
FT                   RTGTGKTFAYLLPLLRMWTFSKDKLPQILVLVPTRELVMQVVESAKALSTYMSFDVVGV
FT                   YGGVNMKSQAAELMQGCDMVVATPGRFTDLAAAGVLKVKNIKKLVIDEFDMMLDLGFRP
FT                   QLDLIFNKIPERRQNLLFSATLSEEVGSLIGDIFKTPIIIEDDDIGTPIESILQKTYAV
FT                   PNFKTKINLLDLLLGNDPDMQKNLIFVAQKSAADLLFQELKSRGMESVEVIHSNKSQNY
FT                   RFRAIKSFSDGEIKTLISTDIGSRGLDIKGITHVVNMDVPTEKTDYVHRIGRTGRGGNS
FT                   GTAISFVSPKEEEDFAEIEEMYQLQLQRIPLPPYLEIEEGLLPFEMEHESIKVPTVKTD
FT                   ANIGAAFHEKLEKNKKVNKRRDIEAEKKLKYGKSYRKGM"
FT   gene            111787..112371
FT                   /locus_tag="Lbys_0093"
FT   CDS_pept        111787..112371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0093"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="InterPro IPR010496; KEGG: rbi:RB2501_07880 probable
FT                   secreted glycosyl hydrolase; PFAM: protein of unknown
FT                   function DUF1080; SPTR: Probable secreted glycosyl
FT                   hydrolase; PFAM: Domain of Unknown Function (DUF1080)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15889"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSN9"
FT                   /protein_id="ADQ15889.1"
FT                   /translation="MKKILLLLLIPCLTFAQKSVSLFNGKNLDGWIVYGTEKWYVENGL
FT                   LVCESGPDKGYGYLGTEKSYKDFELTLEFLPEANGNSGVFFHSSIEGTRVSGWQAEVAP
FT                   PGHFSGGIYESYKRGWLIKPDPSKDNVKMNAWNKMKIRVKGDEVTTWVNGVQMVYLKDQ
FT                   VFADSDGKIALQIHDGGGIKVKWKNLKLKNL"
FT   sig_peptide     111787..111834
FT                   /locus_tag="Lbys_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            112376..113416
FT                   /locus_tag="Lbys_0094"
FT   CDS_pept        112376..113416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0094"
FT                   /product="recA protein"
FT                   /note="COGs: COG0468 RecA/RadA recombinase;
FT                   InterProIPR020584:IPR013765:IPR001553:IPR003593:IPR
FT                   020588:IPR020587; KEGG: sli:Slin_5034 RecA protein; PFAM:
FT                   RecA domain protein; SMART: AAA ATPase; SPTR: Protein recA;
FT                   TIGRFAM: recA protein; PFAM: recA bacterial DNA
FT                   recombination protein; TIGRFAM: protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15890"
FT                   /db_xref="GOA:E4RSP0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP0"
FT                   /protein_id="ADQ15890.1"
FT                   /translation="MAAENADKLKILQSTLDKLDKSFGKGTVMRLSDTKVLDVPVISTG
FT                   SLGLDLALGVNGLPKGRVIEIYGPESSGKTTLAMHAIAEAQKQGGIAAFIDAEHAFDRV
FT                   YAEKLGIDTKNLLISQPDYGEQALEIAEHLIASGAIDICVIDSVAALVPKAELDGEMGD
FT                   SKMGLQARLMSQALRKLTGTINKTGCTCIFINQLRDKIGVMFGSPETTTGGNALKFYAS
FT                   IRIDIRRIGQIKDNEGNIIGNRTRVKVVKNKVAPPFKVIEFDIMYGEGVSKSGEVLDLA
FT                   VDLDIIKKSGSWFSYGADRLGQGRDAVKALIKDNPELMADIEEKIKATVAGNADALMDK
FT                   SGSIEE"
FT   gene            113520..114281
FT                   /locus_tag="Lbys_0095"
FT   CDS_pept        113520..114281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_0008 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3108)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15891"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP1"
FT                   /protein_id="ADQ15891.1"
FT                   /translation="MLRLSILLVPLLFLSFRSKNDTFQLGEEYGYRIKFGILTLGSANV
FT                   AVDNKTHTVNGLPCYRINVSGRTEGITDLYRVRNTYTSYMDTLQYFPQKFEYSARENNY
FT                   KRDQILYFDHRKNVVVKKEKESVDTYSVPTHIHDVISGYYSLRHIDFSTYYLGQTYTAP
FT                   LFFDDESYRFKVKYAGKGTVKTRFGKINVVKLHPILPENKLFKGEEAIRVWVSDDKNRV
FT                   PIKIEVDFSFGTIVMELRKYKKNLYPFNFFS"
FT   sig_peptide     113520..113597
FT                   /locus_tag="Lbys_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            114414..115724
FT                   /locus_tag="Lbys_0096"
FT   CDS_pept        114414..115724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0096"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR017476:IPR001732:IPR014026:IPR014027; KEGG:
FT                   sli:Slin_3526 nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: Nucleotide sugar dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase family, NAD binding
FT                   domain; UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, UDP binding domain; TIGRFAM: nucleotide sugar
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15892"
FT                   /db_xref="GOA:E4RSP2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP2"
FT                   /protein_id="ADQ15892.1"
FT                   /translation="MKIAVVGTGYVGLVTGTCFSETGNEVTCIDIDQAKVDSLKKGKIT
FT                   IYEPGLEPIFDRNRKDGRLKFTTDLAEGIKEAEVIFLALPTPPGEDGSADLKYILGVAD
FT                   QIGKVLDHYAVIVDKSTVPVGTAEKVHAKIAANAKVEFDVVSNPEFLREGVAVEDFMKP
FT                   DRVVVGTSSDRAKAIMERLYAPLVRQGNPIIFMDERSAEMTKYAANSFLAMKITFMNEM
FT                   ANLCELAGANVDNVRKGIGTDSRIGKRFLFPGIGYGGSCFPKDVQALGKTAQEFNYDFK
FT                   ILKSIMLVNEKQKVKLIPQVKEYFNGDLKGKTIALWGLAFKPYTDDIREAPSLYNIKAL
FT                   KRAGAKVVVFDPEAMNNVKKEVGKKVKYASNMYEALEGADALMIMTEWPEFRTPDFSKM
FT                   KDKLKNKVIFDGRNLYDLHEIKAQGFEYYSIGRETVK"
FT   sig_peptide     114414..114473
FT                   /locus_tag="Lbys_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            115721..116692
FT                   /locus_tag="Lbys_0097"
FT   CDS_pept        115721..116692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0097"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509:IPR008089; KEGG:
FT                   sli:Slin_3525 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; SPTR: NAD-dependent
FT                   epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15893"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP3"
FT                   /protein_id="ADQ15893.1"
FT                   /translation="MKRILITGGAGFLGSHLCDRFVKEGYHVMAMDNLITGDLRNIEHL
FT                   FKLPNFEFYQHDVSKFIHVPGELHYILHFASPASPIDYLKIPIQTLKVGSLGIHNCLGL
FT                   ARVKNARVLIASTSEVYGDPQVHPQTEDYWGHVNPVGPRGVYDEAKRFQEAMTMAYHTY
FT                   HGLETRIVRIFNTYGPRMRLNDGRVLPAFIGQALRGEDLTIFGDGSQTRSFCYVDDLVE
FT                   GIYRLLLSDYPNPVNIGNPSEITIKEFAEEIIKLTGTDQKVVYKDLPKDDPKQRQPDIT
FT                   KAKEILGWEPKVDRAEGLKKTYEYFKNLPQERWFEEAKHREF"
FT   gene            complement(116767..117189)
FT                   /locus_tag="Lbys_0098"
FT   CDS_pept        complement(116767..117189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0098"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: fba:FIC_01705 putative periplasmic protein;
FT                   SPTR: Putative periplasmic protein; PFAM: Protein of
FT                   unknown function (DUF2874)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15894"
FT                   /db_xref="InterPro:IPR021533"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP4"
FT                   /protein_id="ADQ15894.1"
FT                   /translation="MKNLVIIALLSVLFTACESNKVLAENEIPSAITNYLQTHFPNHKV
FT                   LQVEKEREGLSKSYDVILEGNIVLEFNKKHNIKSIEAKSALPQSVIPAKIWEYVQREYP
FT                   GVGILEYELDDNRQKVELDNRLELEFNKAGDFLRLD"
FT   sig_peptide     complement(117118..117189)
FT                   /locus_tag="Lbys_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(117210..117638)
FT                   /locus_tag="Lbys_0099"
FT   CDS_pept        complement(117210..117638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0107 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2874)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15895"
FT                   /db_xref="InterPro:IPR021533"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP5"
FT                   /protein_id="ADQ15895.1"
FT                   /translation="MKKIIVLLLFPMALFAQKDKKIDWDELPQKAQTFLKTNFTKEKAQ
FT                   QILKETEDYLETIYQVTFQGKLKIKFDKNGNWKEVDGHRKPIPTRFIPEKILTYIKKSF
FT                   PNNEVVKIEKEKKKYEVEISNGLELEFDREGNFLRIDS"
FT   sig_peptide     complement(117567..117638)
FT                   /locus_tag="Lbys_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(117678..118949)
FT                   /locus_tag="Lbys_0100"
FT   CDS_pept        complement(117678..118949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0100"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661:IPR003594:IPR005467; KEGG: coc:Coch_1450
FT                   histidine kinase; PFAM: histidine kinase A domain protein;
FT                   ATP-binding region ATPase domain protein; SMART: histidine
FT                   kinase A domain protein; SPTR: Histidine kinase; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15896"
FT                   /db_xref="GOA:E4RSP6"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP6"
FT                   /protein_id="ADQ15896.1"
FT                   /translation="MAKSLKNYTLKHLAYALPLVVAIWAALFYAFILDEVYDNVDDGLK
FT                   NQKINIIRQAYLDSTILNTREYGVNQFRIIPTDSIQKKNVFSREFIYMEYDAEMEPYRI
FT                   LRTGFYGPDGQAYSLEIRTSTVEEDDLIIDLSIALFVLYLLLLLTIFLINNGVLRRALK
FT                   PLSRLTEDLQNYQFGNKNQVRRIDEGVTEFQILSDKVQDMIDRNESLFHKQRTFIENAS
FT                   HELQTPLTITIGQLELLLAEGQLDEIQSQRIDQAKSALHRLVQLNRNLLMLSKIENRQF
FT                   PEKEEIPVSAVWSEIEEELQDLVIFKELHVHTKLNEEFHIKAHRGLIKILISNLYRNAI
FT                   KYNFKGGKIEVKIDSKGFTIGNTSELPPLNPEIIYDRFYKFPGDSQSTGLGLSIVQSIV
FT                   GTYPNLKIHYTYEKEFHLFSLKKI"
FT   gene            complement(118950..119621)
FT                   /locus_tag="Lbys_0101"
FT   CDS_pept        complement(118950..119621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0101"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR001867; KEGG: coc:Coch_1449
FT                   two component transcriptional regulator, winged helix
FT                   family; PFAM: response regulator receiver; transcriptional
FT                   regulator domain-containing protein; SMART: response
FT                   regulator receiver; SPTR: Putative uncharacterized protein;
FT                   PFAM: Response regulator receiver domain; Transcriptional
FT                   regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15897"
FT                   /db_xref="GOA:E4RSP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP7"
FT                   /protein_id="ADQ15897.1"
FT                   /translation="MKILIVEDETEISKLIQESLEEAQYLVESASTFKEGLLKIEDYQY
FT                   DAILLDLMLPDGNGLDLLSEIRSSQPNTSVIILSAKDAVEDKVKGLDLGADDYLAKPFH
FT                   LVELHSRLKSALRRRNQQGENKIEYKNLCLYPETRDFLVAGNHVALNRKEYDVLYYFMI
FT                   RPGRLIQRTTLAESVWGDHIDQADSLDFIYSQIKNLRKKLKESGADADLQAVYGVGYKL
FT                   V"
FT   gene            119776..122463
FT                   /locus_tag="Lbys_0102"
FT   CDS_pept        119776..122463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zpr:ZPR_1375 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15898"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP8"
FT                   /protein_id="ADQ15898.1"
FT                   /translation="MKSIFRSLILAALIGNSATAQSPWERIAKMPSTLGVEKGSKSFKT
FT                   SDFYLEILNSSHTAAAFSPVKDTIFDYTPDERLKLRDKDGFYHLGDINIRYKKISEKEW
FT                   TSFSSAKKRVDVLPLSGGKSVIAASDLGPALGENSSISVKRFWELEGKNIVLRFEISNL
FT                   SKEEVEIGSLGIPMIFNNILQDKKLDDAHMDNVFFDPYIGKDAGYIQVNRLHGKGQSLL
FT                   VLPHLNASFEAYNPLNDDPTPRSIVFEGFHEWMIHSKAHAENEWKGVEQWNEPTSAILK
FT                   AGEKRQYALKFVFAPSIREIESQLEKEKRPVAIGIPGYVLPFNEVGALHLKYGKKVQSI
FT                   EVHPAGSLAISPKSVNAKWQSYEVIGKVWGRSRVTVKYKDGTVQTIHYKVIKSQEEVVK
FT                   DLGNFLTTKQWFDDKDDPFGRAPSIITYDYEEQRQVTQEQRAWYAGLSDEAGAASWLAA
FT                   FMKQALIQDKGEIEKIKRFANETLWGKLQYSEGPKKYGVKKSMFYYEPDSLPKGTYRED
FT                   INWNVWSAWKKKEADSPGRSYNYPHVAAAHWVLYKLARNHEGLAENWKQHLENAFHTSI
FT                   AMVRLAPHYAQFGQMEGTVFLLILEDLKREGILDMANELEAAMKQRADHWKSLGYPFGS
FT                   EMPWDSTGQEEVYMWSKYFGNHDKADVTLNAILAYMPTLPHWGYNGSARRYWDFVYGGK
FT                   LSRIERQLHHYGSALNSIPVSDAYRENPNDFYLLRVGHAGAMGALANVTQDGFGPAAFH
FT                   SYPSTLANDGITGDYGSGFFGYAVNSGTYIVKHPEFGYVAFSGNAKKEGDWVITEVTTA
FT                   GKNRIFLAPEKVWITLEAGRVSTVKYNTKTKEVELVLEGANEHTKNALVQINREVKTSA
FT                   TKDERGFYKVELSEGENLFKLRLY"
FT   sig_peptide     119776..119835
FT                   /locus_tag="Lbys_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(122526..123203)
FT                   /locus_tag="Lbys_0103"
FT   CDS_pept        complement(122526..123203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0103"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR017937:IPR001763:IPR013766:IPR017936; KEGG:
FT                   fps:FP2000 thioredoxin family protein; PFAM: Rhodanese
FT                   domain protein; Thioredoxin domain-containing protein;
FT                   SMART: Rhodanese domain protein; SPTR: Thioredoxin family
FT                   protein; PFAM: Thioredoxin; Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15899"
FT                   /db_xref="GOA:E4RSP9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSP9"
FT                   /protein_id="ADQ15899.1"
FT                   /translation="MYKHLLLLLLGTGACAQKLSAEELSKKLEAEPQVQLVDVRTPSEF
FT                   KAGHIPNASNIDVRSPQFNSMVATLDKSKPVYIYCLSGGRSSSAANKLREMGFQEVIEM
FT                   PGGMMEWRNKSLPEEKLIVKSEGLSLEEYRHMIPTNLPVLIDFYADWCAPCKKMKPYIE
FT                   AIEKEGKVKVIRIDADQNPRLMKELNIVGLPVIKLQKGDKTWEHVGFVSEMDLRAQIAE
FT                   ITK"
FT   sig_peptide     complement(123141..123203)
FT                   /locus_tag="Lbys_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(123206..123619)
FT                   /locus_tag="Lbys_0104"
FT   CDS_pept        complement(123206..123619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0104"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: fjo:Fjoh_4883 protein of
FT                   unknown function DUF395, YeeE/YedE; PFAM: protein of
FT                   unknown function DUF395 YeeE/YedE; SPTR: Putative
FT                   uncharacterized protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15900"
FT                   /db_xref="GOA:E4RSQ0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ0"
FT                   /protein_id="ADQ15900.1"
FT                   /translation="MKNKWPYLFVGILFGFVFVKAEIISWFRIQEMFRMESFHMYGVIG
FT                   SAVVVGMSSLFIIRKFNIKTLDGEPVKVEPKTFQKGQIFGGLLFGFGWALTGACPGPLF
FT                   AQVGTGATVIIVSLLSAIAGTYFYGKIKDHLPH"
FT   sig_peptide     complement(123557..123619)
FT                   /locus_tag="Lbys_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(123616..124176)
FT                   /locus_tag="Lbys_0105"
FT   CDS_pept        complement(123616..124176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0105"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="InterPro IPR007272; KEGG: cpi:Cpin_3331 protein of
FT                   unknown function DUF395 YeeE/YedE; PFAM: protein of unknown
FT                   function DUF395 YeeE/YedE; SPTR: Putative uncharacterized
FT                   protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15901"
FT                   /db_xref="GOA:E4RSQ1"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ1"
FT                   /protein_id="ADQ15901.1"
FT                   /translation="MKILTQPWPWYVAGPLIGLTVPALLLIGNKAFGISSSLRHLCAAC
FT                   LPTKLPFFQYDWKKESWNLFFVLGIAIGGFIGGVIFGNPEPVQVAESLKADLSNYGITD
FT                   YSQLVPADLFNWPALVTPRGFILMIVGGFLVGFGTRYAGGCTSGHSIMGLSNLQWPSLV
FT                   ATICFMAGGLIMANLILPYILGL"
FT   sig_peptide     complement(124078..124176)
FT                   /locus_tag="Lbys_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(124244..125707)
FT                   /locus_tag="Lbys_0106"
FT   CDS_pept        complement(124244..125707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0106"
FT                   /product="peptidase M61 domain protein"
FT                   /note="COGs: COG3975 protease with the C-terminal PDZ
FT                   domain; InterPro IPR007963; KEGG: phe:Phep_3734 peptidase
FT                   M61 domain protein; PFAM: peptidase M61 domain protein;
FT                   SPTR: Peptidase M61 domain protein; PFAM: M61 glycyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15902"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ2"
FT                   /protein_id="ADQ15902.1"
FT                   /translation="MKKLITLLFLGGGLQAQELNFEVDLRSYQYDLTLTTSAPTEPYLD
FT                   LEIPAWSPGYYQVMDFGKNFHDFHAYNEYGDTLRWIKFGHNTWRIYTSNTKELKVKYKV
FT                   RAERNFVGTAFIDKERAFLKPSALFLHRKNEKDTPAQIHIHAPSEWTKVATGLDSLKAY
FT                   TYYAKDVDILYDSPLLIGELKELPPFEIGGKKHRFLGYAMGTFDGLRLMNDLKKIISTA
FT                   IELIGDIPYEHYTFIGLGPGNGGIEQLNSTAVAFTGQELEGPGRTRTLSFLTHEYFHHF
FT                   NAKRIRPIELGPFDYSQPNRTNMLWVAEGLTAYYENIIMNRAGLLSAEEMKKAWSASIA
FT                   NFQKNPGRLKQTLAESSAKTWEDGPFGKKGETISYYEKGPLVGMLLDIRIRTATQNTRS
FT                   LDDVMRYLYHEIYKKGNRGYTDAEFIKICEKYAGTPLDDIFQYVYSTKELDYAHYFRMI
FT                   GIDLDENYQMTLRKDQTALQKKIYQDLFR"
FT   sig_peptide     complement(125660..125707)
FT                   /locus_tag="Lbys_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(125768..127363)
FT                   /locus_tag="Lbys_0107"
FT   CDS_pept        complement(125768..127363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0107"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: dfe:Dfer_1439 RagB/SusD
FT                   domain protein; PFAM: RagB/SusD domain protein; SPTR:
FT                   RagB/SusD domain protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15903"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ3"
FT                   /protein_id="ADQ15903.1"
FT                   /translation="MKKISIYALTACLMISGGSCTNLDEEVYSEVLSTSFKPTERDLPN
FT                   ILAPVYASFRSLMFGWQGYFDLQEEPADAIITPVRPNGWDDGGTYRRMHQHAWTSQQWQ
FT                   PENTWQSSYASITRANRVIAQIEDNEIPLPEATAKAAIAELRAARALAYYLLLDNHGNV
FT                   PIVTNYRDVTLPQQSTRKEVYDFIVKEITEIEPLLSSDVSATYGRMNKWAAKALLAKIY
FT                   LNAEVYTGTANWDGVIKETNDIIASNNYILDPNYSDVFTYTNHNSKEIIFAVPYDEIYG
FT                   TGSQIHMKTLDPLSRLVYGMSAGPWGGNCAVPQFIDTYDKEDGRLADSWIMGPQYSATT
FT                   GEMVINYVKEVPGIGGDGTVAPSNSGYRIGKYKIKQGATNNLDNDYPMFRYADVLMMKA
FT                   EALLRKGDADAAAQLVTQVRQRAFKSNPAKATVSGAELLQGSAYQYGWQEKDGSVAVKN
FT                   GGADIKYGRFLDELGWEFAAEAHRRQDLIRFGVYQTKSWFNHNPHPQANTRIIFPIPNG
FT                   ELNKNPNLKQNAGY"
FT   sig_peptide     complement(127277..127363)
FT                   /locus_tag="Lbys_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(127390..130335)
FT                   /locus_tag="Lbys_0108"
FT   CDS_pept        complement(127390..130335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0108"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   dfe:Dfer_1438 TonB-dependent receptor plug; PFAM:
FT                   TonB-dependent receptor plug; TonB-dependent receptor;
FT                   SPTR: TonB-dependent receptor plug; PFAM: TonB dependent
FT                   receptor; TonB-dependent Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15904"
FT                   /db_xref="GOA:E4RSQ4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ4"
FT                   /protein_id="ADQ15904.1"
FT                   /translation="MKKQLTNFLFLLFMALPWVALAQDLTLTGTVKDQDGKPIEVAMVG
FT                   IKNTSTLAYTDAEGKFTLKYGPNSILVVSAIGYDKQEIALTNQRTLDIILTGGNASLDE
FT                   LVVVGYGTQRKGDVTSSVSSVKSEDFLKGTVRDAAQLIQGKVAGLRITTPSGDPNATTQ
FT                   INLRGLNSINGSQNPLVIVDGVPGSITTVAPEDIESIDVLKDGSAAAIYGTRATGGVIL
FT                   ITTRKNKNSENKTTVEYNAYVNQQRIYRKPEMMDASDYRRLISQGYAYEDLGSNTNWID
FT                   EVLQNPLSHNHNLAFFGGNYKTNFTGTLNYRDWDGIMLKTGQERVALRADLNHEMYDGK
FT                   VKTNLQLISTTTTSNQGGAGGWAWRQAMIRNPTDAIKNADGTWKESNAYMYDNPLGYIH
FT                   ETINDAKTKENRFSGSVEYRPMRDLNFKLLASRVQGDYLSGSATTFQHVNTTKNNMNGT
FT                   ASRYTSANTENLLELTGNYVKTFNDHRFTLLGGYSWQDNTSENFYAYNYDFPTDAYSYN
FT                   KLEAGTALQRGLASMTSYKSKWQLAGFFARLNYVFDNKYMVMASVRREGSSTFGENNQW
FT                   GTFPAFSLGWNIANEEFLKGTNTISQLKLRAGVGVTGTIASSPYQSQISYNFATGQGAF
FT                   IGGKWVPGFIPARNFNPDLRWEKKTEWNAGLDFGIYKNKLSGSIDFYTRTVNDLLYYFS
FT                   VPVPPYLTSSMMLNAGSMKNSGIEVMLNYAAIQKKDFSWNTTLTFSTNKNKLIDLSNDQ
FT                   FDVTTEYFDAGYTGEPIQVSTHRVQVGGPIGQFYVLKSVGVDDNGKWLVENKNGEIIPI
FT                   AQATPEDRQFYGNGIPKFNVGWNNNLNYKRFDLTVNFRGAFGHDILNMQRLYYENPVNK
FT                   AYNVLKTAYDPVYGKELKNDLVYVSHYIEKGDYLKLDNITLGYTLPKVIKGINNLRVYG
FT                   SVLNLYTFTGYKGIDPEGVSYTGDYTFAPGIDHRDKYPNTRTYTLGLNVSF"
FT   sig_peptide     complement(130270..130335)
FT                   /locus_tag="Lbys_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(130636..133848)
FT                   /locus_tag="Lbys_0109"
FT   CDS_pept        complement(130636..133848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0109"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="COGs: COG3507 Beta-xylosidase; InterPro
FT                   IPR006710:IPR000421; KEGG: bvu:BVU_1123 glycoside hydrolase
FT                   family protein; PFAM: glycoside hydrolase family 43;
FT                   coagulation factor 5/8 type domain protein; SPTR: Glycoside
FT                   hydrolase family 43 protein; PFAM: F5/8 type C domain;
FT                   Glycosyl hydrolases family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15905"
FT                   /db_xref="GOA:E4RSQ5"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ5"
FT                   /protein_id="ADQ15905.1"
FT                   /translation="MKKILFLTCLFFNCFAQNRNPLVPGYFADPTIKKIGDTFYLYATT
FT                   DGTGWGGGPAQVWTSKDFVNWTIQPMNWPNTHWYWAPDVTKGYDGKYYLYYSQPVEIFA
FT                   GQSESPVGPWTPIDSGKAIIPNYMIPGVITLDAQTFTDDDGSIYMFWGTWGIYPEHGCA
FT                   VGKLNPDMKTFSKVELIPNTVAKDFFEAPFMFKKDGIYYFMYSSGRCEDHTYRVQYLKS
FT                   TTGPFGPYEYPDENPILVTNEDGTVHGPGHHSVQEHEGKYYIVYHRHNNPHSNGGFHRQ
FT                   LAADLLEFDEKGNIKKVKPTHSGIGLLGPNQIPYTNLALGKTVKASSEYNLHFQASNAA
FT                   DDDNGTLWRAKDNMKQAWWQVDLGEVITIQSILTQFEYATYYYQYRIEYSTDQKTWKTF
FT                   ADRSQNTTWGSPMADFNQVQARYIRITILETQQPGLPRGIWNVKIFKEKIKGDFPTSSP
FT                   QKEPVVRKHKDLLVHLSASDLLPGEKLKSLSNDGAMGGKFSAANQAAVEIIEGKKGIKF
FT                   QGTDLWTSNFSFPLQGNSSFTLIYDIFNPTIERFEPLITWSRSPQDLTKATFGAGYDAQ
FT                   SGAVTHGGWADLSFKSSLKENKWQRIAITFDGYMQRVYVDGKEVSASDKMLFIRPDSLI
FT                   TLGRNGTEGFSGLLAELRIYDRAFEPNEIPSLESDKDWPYYYTARDLDYKKRQGWKNRG
FT                   YLQMEIPSVEVEDYDGKMAVVGQDFIPAEAMDYLKQNPHSELRAVCNPKNGENWGTLQL
FT                   KGNGSILWKGQKITTFKPTEWAFQQWGIYTGQKPPLALQGNVLKIEGCKAFYTSGNQVL
FT                   VQCIPQDGLEYYFDQWQNRNYHLYPQLPESIQVKVRDEEGNVSAYLNVPPPSIQKEKKV
FT                   NIPDEKDFLENLPEFWDGTQGDKNVEAYIRGKNGQMELGSVNSSWDFVGKKGPYIYKEV
FT                   EGNFTFSAKLTDIIGSAEKRNTATETGIMVQGSSTYLQNTILTGWNIGNMSTFGTQDSR
FT                   IQRNNGLGWNYYPYLQIQKADEYFHLRISRDGTNWEDLIGSPFYCPELKNEKLKIGLFH
FT                   ASNNNVKGYGTFDYIQIITERR"
FT   sig_peptide     complement(133765..133848)
FT                   /locus_tag="Lbys_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(134062..134850)
FT                   /locus_tag="Lbys_0110"
FT   CDS_pept        complement(134062..134850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0110"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002198:IPR002347;
FT                   KEGG: acd:AOLE_00935 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15906"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ6"
FT                   /protein_id="ADQ15906.1"
FT                   /translation="MTNFKYRSALITGASSGIGKAFAYELAKKGVNLVITARSENKLSQ
FT                   MAEDLQSKFKIQARYIVADLSDLRSPKFIYQEIKKLGLTIDLLINNAGIGKWTNFLDQS
FT                   LETYQSMLHLNINSLLSLTHLFLPEMLQNNNGGIVNIASTGALQPCPYIAVYCASKSFV
FT                   LNFSESLYGEYADRGIVVTCICPGNTDTGFQASANANTAGMKYESPEEVAKQSLDALLR
FT                   KKNNKIIGFDNVLQSLIPRLLPRKTVINIVKNMMDKKVNG"
FT   sig_peptide     complement(134782..134850)
FT                   /locus_tag="Lbys_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(134908..135507)
FT                   /locus_tag="Lbys_0111"
FT   CDS_pept        complement(134908..135507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0111"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595; KEGG: fjo:Fjoh_1392 cyclic
FT                   nucleotide-binding protein; PFAM: cyclic
FT                   nucleotide-binding; SPTR: Probable cAMP-binding domain
FT                   containing regulatory protein; PFAM: Cyclic
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15907"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ7"
FT                   /protein_id="ADQ15907.1"
FT                   /translation="MISRSNTTSMHEKLIHKVSNLIPLQEGDIQTICRAFKAIQIPKNT
FT                   LLEEENKRTKYLYYIVDGYVRVYYTKEGEERTTQINCPSGFITSYQSFIANVPAYDNVQ
FT                   TITECTLLRITKPELENLNTQIHQWSIFGEKIYEQALIYNEERTRDMILLSAEERYLKL
FT                   MRSYPDILQNVPLQYIASYIGIKPESLSRIRRQISS"
FT   gene            complement(135589..136116)
FT                   /locus_tag="Lbys_0112"
FT   CDS_pept        complement(135589..136116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0112"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="COGs: COG3832 conserved hypothetical protein;
FT                   InterPro IPR013538; KEGG: phe:Phep_1288 activator of HSP90
FT                   ATPase 1 family protein; PFAM: Activator of Hsp90 ATPase 1
FT                   family protein; SPTR: Activator of Hsp90 ATPase 1 family
FT                   protein; PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15908"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ8"
FT                   /protein_id="ADQ15908.1"
FT                   /translation="MKITHQKKNAPTLETFTKSLILESILEHMTPTVETQMLIRKPASL
FT                   VFQAFVDPSITTHFWFTKSSGPLEVGKTIKWEWEMYGVSCLVKVKEIIPNKRISIEWDE
FT                   PPTAVDFEFEAMTEESTYVTIRNYGFQQTGDALIEALLNNTGGFTTVLDGLKAYLEHHI
FT                   ELHLIRDKFPKR"
FT   gene            136492..137331
FT                   /locus_tag="Lbys_0113"
FT   CDS_pept        136492..137331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0113"
FT                   /product="DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase; Transcriptional regulator Ada"
FT                   /EC_number="2.1.1.63"
FT                   /note="COGs: COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase; InterPro
FT                   IPR001497:IPR014048:IPR000005:IPR018060; KEGG:
FT                   fjo:Fjoh_1575 methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain; SPTR: DNA-O6-methylguanine--protein-cysteine
FT                   S-methyltransferase / Transcriptional regulator Ada;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: 6-O-methylguanine DNA methyltransferase, DNA binding
FT                   domain; Bacterial regulatory helix-turn-helix proteins,
FT                   AraC family; TIGRFAM: O-6-methylguanine DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15909"
FT                   /db_xref="GOA:E4RSQ9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSQ9"
FT                   /protein_id="ADQ15909.1"
FT                   /translation="MNDQQQLNYNRIAQAIEYITEHFKEQPQLDEVAEMVHLSPFHFQR
FT                   LFKEWAGTTPKKFLQYTSLQYAKRLLQDQQATLFDTAYQTGLSGTGRLHDLFIQMEGMT
FT                   PAEFKNGGRNLSIQYSFADSPFGKVIVASTSKGICHMAFEEDEDQALWNLQQKFPFAKY
FT                   QNLFDDLQANALSIFQTDWTQLKQIKLHLKGTEFQLKVWEALLKIPFAGVSTYGKIADK
FT                   IGQPTASRAVGTAIGSNPVAFLIPCHRVIQSTGHLGGYMWGKTRKTAMLGWEAAKSD"
FT   gene            137830..138432
FT                   /locus_tag="Lbys_0114"
FT   CDS_pept        137830..138432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0114"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /EC_number="1.14.11.-"
FT                   /note="COGs: COG3145 Alkylated DNA repair protein; InterPro
FT                   IPR005123; KEGG: phe:Phep_1031 2OG-Fe(II) oxygenase; PFAM:
FT                   2OG-Fe(II) oxygenase; SPTR: Alkylated DNA repair protein;
FT                   PFAM: 2OG-Fe(II) oxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15910"
FT                   /db_xref="GOA:E4RSR0"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR0"
FT                   /protein_id="ADQ15910.1"
FT                   /translation="MGNRKNYLPYDGEVRYYGKILTSAEADGYLHKMLEKIEWQNDEAI
FT                   IFGRRIVTKRMVAWYGERPFSYTYSKVTKSALPWTQELLELKARVEGATGETFNSCLLN
FT                   LYHSGEEGMAWHSDGEADLKKDGAIGSLSLGAERKFSFKHKKNKERVDILLEHGSLLVM
FT                   AGTTQTYWWHRLPPTKKVLDARINLTFRTIEEKIAEI"
FT   gene            complement(138624..139349)
FT                   /locus_tag="Lbys_0115"
FT   CDS_pept        complement(138624..139349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0115"
FT                   /product="Methyltransferase type 12"
FT                   /note="InterPro IPR013217; KEGG: dak:DaAHT2_0375
FT                   methyltransferase type 11; PFAM: Methyltransferase type 12;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15911"
FT                   /db_xref="GOA:E4RSR1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR1"
FT                   /protein_id="ADQ15911.1"
FT                   /translation="MKQPHDNWGTYYDFVYKKTFGNSYNNLTTENLNVINQILPTGTIL
FT                   DFGAGTGRLSFPLTKQGYKVIGVEKSIGMFNEFKRKVECQNSEIEVYNCSISEYKNGKA
FT                   DLAIALFTVLSYSITEDELSKNIENICKHINPNGYFFFDLPNTVFFNAGRLTNIDTTTF
FT                   KRLVELTGNNENDIYTYREQCSGIFEGKEFSYEDEFKIRYWKISTLDELLSKNGFKDTL
FT                   KSFPQFNSTGSTYKLYKRQ"
FT   gene            complement(139724..139855)
FT                   /locus_tag="Lbys_0116"
FT   CDS_pept        complement(139724..139855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15912"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR2"
FT                   /protein_id="ADQ15912.1"
FT                   /translation="MYLTNGNIPQPYLQAHCQSPSSQRTDQCFVKWSEAEFVNTNKK"
FT   gene            complement(139842..141572)
FT                   /locus_tag="Lbys_0117"
FT   CDS_pept        complement(139842..141572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_5221 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15913"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR3"
FT                   /protein_id="ADQ15913.1"
FT                   /translation="MLRVIEIENIKGIQHKRFELDILPNKPSLLVAPNGFGKSSFAAAF
FT                   NSMNNRRINLSEDDFHAEDETLAPRIYIEYERPDNSIATLEATATTNTISSELDYFVIN
FT                   NPTKPKGIGNLYGRPSATLEIKDVVLVDRIPDNVQFGNQYRAAQQRFGQNARVLPNPNA
FT                   ALGNLKLVEKLSYNYQALERANGQRIRTRINDIINEINQQAGTIEVLTDWITAHRLNDL
FT                   KQIEYLNTIGNLINEYDLGYNSETKAYLIAIQLIWLYNDNPNNFKEACKYSNYQLDKQR
FT                   FQHTLSNFNCTWKGIRASQTEGQLVVKFPKANHISNGQRDILTFVAMLFRARQHLKKEA
FT                   NILIIDEVFDYLDDANLTAAQYYITTFIKDFKDEGKRLYPIILTHLNPNYFKNFAFSNQ
FT                   KVYYLDKSNIQVNQSIVRLLRNREHPSIKVDVSKHLLHFEPTHINKRAEFNALGLRELW
FT                   GEADNFYQFLFSEVDNYLNGRPFCPFAVCGGVRVKIEEIAYGKLQNPAAQTTFLTTKKT
FT                   RPKLEKAEEMGVVSPESHYLLGIIYNEGMHWKENQDNVSPIASKLENLTIKKLIRDVFN
FT                   "
FT   gene            complement(141575..143062)
FT                   /locus_tag="Lbys_0118"
FT   CDS_pept        complement(141575..143062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0118"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="COGs: COG0732 Restriction endonuclease S subunits;
FT                   InterPro IPR000055; KEGG: sli:Slin_3089 restriction
FT                   modification system DNA specificity domain protein; PFAM:
FT                   restriction modification system DNA specificity domain;
FT                   SPTR: Restriction modification system DNA specificity
FT                   domain protein; PFAM: Type I restriction modification DNA
FT                   specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15914"
FT                   /db_xref="GOA:E4RSR4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR4"
FT                   /protein_id="ADQ15914.1"
FT                   /translation="MTILEFFKTVHPSVLAAKMIFRHLQEHYPVLKIADIADTTSGGTP
FT                   NRGMPEYYNGDIPWVKSGELKDGVITTCDEYITEAGLKNSSAKLFPKGTLLVAMYGANI
FT                   GKTGILDFDATTNQAVCAIFPKVDISREFLSWYFKQQRIDFIAVGKGGAQPNISQTIIN
FT                   NASIVVPDEKVQKAIVKFLERIEKGDGIDYDFFIPEVLKDVETIYKYKNSYVTLSDSFE
FT                   SQLTQLENLNQAILQEAVQGKLVPQDPNDEPASELLKRIKAEKATLRQAQGKGKKEKPL
FT                   PPIKPEEIPFEIPENWVWCRLGEICEVNPRNKVDDEIDAGFIPMPMVSQLFGVKPTYEV
FT                   RKWGAIKKGFTHFANNDVVIAKITPCFENSKAGIISDLPNGIGAGTTELNVLRGNQYIL
FT                   PEYVYAFVKRIDFLKNGERIMKGVAGQQRVPTDYFYNTLIPLPPLAEQKRIVAEIEKQF
FT                   AKTKQLKEHIIANQQATEQLLKALLHQAFEVKEMEEV"
FT   sig_peptide     complement(143015..143062)
FT                   /locus_tag="Lbys_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(143059..144486)
FT                   /locus_tag="Lbys_0119"
FT   CDS_pept        complement(143059..144486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0119"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="COGs: COG0286 Type I restriction-modification system
FT                   methyltransferase subunit; InterPro
FT                   IPR002052:IPR003356:IPR002296; KEGG: sli:Slin_3088
FT                   site-specific DNA-methyltransferase (adenine-specific);
FT                   PFAM: N-6 DNA methylase; PRIAM: Site-specific
FT                   DNA-methyltransferase (adenine-specific); SPTR:
FT                   Site-specific DNA-methyltransferase (Adenine-specific);
FT                   PFAM: N-6 DNA Methylase; HsdM N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15915"
FT                   /db_xref="GOA:E4RSR5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR5"
FT                   /protein_id="ADQ15915.1"
FT                   /translation="MSNIAGTIKSIRDIFRKDPGLSGDAQRIEQLGWMIFLKLFDDKDK
FT                   EKEILNPKYRSPIPAELQWRNWAEDDEGITGDELINFVNNKLFPTLKNLTVAADDRLGI
FT                   TIRQIFDGTNNYMKSGTTFRQAINKLNEIDFTSSKDHHIFNVIYEEILQGLAAKKDTGE
FT                   FYTPRAVTQFIVDMVNPKLGEKITDPACGTGGFLVCTIEHLKRQVKNIDDRKTLQETVT
FT                   GSELKPLPFMLSVVNLITHDIEVPQLENGDSLSREYTSIKQKDRVDIIIANPPFGGVVG
FT                   DGMETNFPLNYRTKESADLFLILFIQLLKDGGRAGIVLPDGSLTGDGVKQRVRQKLLED
FT                   CNVHTIVRLPQSVFAPYATVNTNLIFFEKGKPTKEIWYYEHTLPDGQKAYSKTKPIRIE
FT                   EFEPIKQWWKNREESEVAWKVSMQTIIDRNYDLDVKNPNKKVEEVELNIGKILSILKTE
FT                   NNKVSTIIQELENDLVK"
FT   gene            complement(144572..144802)
FT                   /locus_tag="Lbys_0120"
FT   CDS_pept        complement(144572..144802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pvx:PVX_114340 SNF2 family N-terminal domain
FT                   containing protein; SPTR: Cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15916"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR6"
FT                   /protein_id="ADQ15916.1"
FT                   /translation="MMNLSADMDLKNIKDNILAKANNGNELFYPPDKSGGNAKSGGNAK
FT                   SGGNAKSGGNAKSGGNAKSGGNSNEIINLMK"
FT   gene            complement(144756..145193)
FT                   /locus_tag="Lbys_0121"
FT   CDS_pept        complement(144756..145193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0088 hypothetical protein; SPTR:
FT                   Probable transposase; PFAM: Transposase IS200 like"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15917"
FT                   /db_xref="GOA:E4RSR7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR7"
FT                   /protein_id="ADQ15917.1"
FT                   /translation="MPFVKVYIHFVWSPKNRYPFLDSKELRTKVWHHIRQNAKEKRIFI
FT                   DFINGYSDHCHCLVSLGIDQTIQKVVQLIKGESSFWINKNELTKVKFEWQDEYFAVSVS
FT                   ESMINKVREYIKNQEEHHTKKTFQQEYDEFISRYGFEKYKG"
FT   gene            complement(145284..147680)
FT                   /locus_tag="Lbys_0122"
FT   CDS_pept        complement(145284..147680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0122"
FT                   /product="Type I site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.3"
FT                   /note="COGs: COG4096 Type I site-specific
FT                   restriction-modification system R (restriction) subunit and
FT                   related helicase;
FT                   InterProIPR007409:IPR006935:IPR013670:IPR014001:IPR
FT                   014021:IPR001650; KEGG: sli:Slin_3086 type I site-specific
FT                   deoxyribonuclease; PFAM: EcoEI R domain protein; type III
FT                   restriction protein res subunit; protein of unknown
FT                   function DUF450; PRIAM: Type I site-specific
FT                   deoxyribonuclease; SMART: DEAD-like helicase; SPTR: Type I
FT                   site-specific deoxyribonuclease; PFAM: Type I restriction
FT                   enzyme R protein N terminus (HSDR_N); Type III restriction
FT                   enzyme, res subunit; EcoEI R protein C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15918"
FT                   /db_xref="GOA:E4RSR8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR8"
FT                   /protein_id="ADQ15918.1"
FT                   /translation="MNKKSLSERDICSKFITPALEKAGWDKQLQILEEVSFTDGKIYVR
FT                   GKITARGTRKRADYILYYKPNIPIAIIEAKDNNHSIRAGIQQGLDYAQILDIPCVFSSN
FT                   GDGFLFHDRTATDGNIETEISLDDFPTPEQLWEKYKKYKGIETPEAERIVSQDYYFDGT
FT                   NRKPRYYQQIAVNRTVEAIANGQNRILLVMATGTGKTYTAFQIIHRLWKSGAKKRILFL
FT                   ADRNALIDQTRRGDFKHFKDKMTVVKHRQIDKSFEIYLALYQGLSGTDEAANVYKQFSR
FT                   DFFDLIVIDECHRGSAKDDSSWREILTYFQNATHIGLTATPKETNEASNSEYFGDPVYT
FT                   YSLKQGIDDGFLAPYRVVRIALNVDAEGWRPEQGKTDKDGNEIEDRIYNRKDFDKNLVI
FT                   EERTDAVAKKVTEFLKGYDRFAKTIVFCVDIDHAERMRTALARHNPDLVSENYKYIMQI
FT                   TGDNDEGKRELDNFINPEEKYPVIATTSELMTTGVDAQTCKVIVLDSNINSMTKFKQII
FT                   GRGTRINEEYGKLYFTILDFRNATDLFADPQFDGEPIRIKPVTEAINLGDIIDEEEENT
FT                   EPIIDIESGEEIEITPPEIRYPEQEFPPSTVNEPRRKVYVNGVDVSVLISRELHFDQHG
FT                   KPITTSLKDHTKEIIKEQFASLDDFLNKWKGSDRKEAIIAELVEQGVMVEALYEAVDKQ
FT                   VDLFDLICHVAYDQPPMTRKERANNVMKRNYFTKYGDQARKVLEALLDKYADQGIENIE
FT                   NIQILTVPPINEFGSVTEIIKAFGSREEYEKAIKELENELYRNIA"
FT   gene            complement(148193..149011)
FT                   /locus_tag="Lbys_0123"
FT   CDS_pept        complement(148193..149011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0123"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro IPR000005:IPR018060;
FT                   KEGG: cpi:Cpin_6177 transcriptional regulator, AraC family;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; SPTR: Putative
FT                   AraC family transcriptional regulatory protein; PFAM:
FT                   Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15919"
FT                   /db_xref="GOA:E4RSR9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSR9"
FT                   /protein_id="ADQ15919.1"
FT                   /translation="MENHSNKITPDVFVFTIDAEKEKESDRFLSESILALQISGQLTLE
FT                   TNIEKMVMKPGDILLVRKHQFVKVTKTPIGKDYQKAILLILKDDILRKYALENQIDNNE
FT                   KYNGSSNILIPESDFLQGFFNSLIPYTQNHKNINDQLSSIKVKEAVQLLLLTKPELKNF
FT                   LFDFSEPHKIDLEKFMLSNYKFNVPIESFAKLTGRSLAGFKRDFQKTFGIPPRQWLQNK
FT                   RLTEAHYQIEKNNKKPSSIYLDLGFESLSHFSYTFKKQFGYAPTELTKTR"
FT   gene            complement(149025..149924)
FT                   /locus_tag="Lbys_0124"
FT   CDS_pept        complement(149025..149924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0124"
FT                   /product="dehydrogenase/reductase"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347; KEGG: mab:MAB_0717
FT                   dehydrogenase/reductase; SPTR: Probable
FT                   dehydrogenase/reductase; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15920"
FT                   /db_xref="GOA:E4RSS0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS0"
FT                   /protein_id="ADQ15920.1"
FT                   /translation="MIIVMTGATSGIGAEALKHFVKLPDTKVYVGARGSGRIVPEGTDV
FT                   LPLDLSSLRSVRSFADNIKQRLGETKIDVLILNAAIRATDHDQRSEEGFQLTFATNHLS
FT                   HYLLARLFLPIMAEGGKIVITTSDTHDPAIVPFGPKTLNPEELAYPNENSPKGMRLYAA
FT                   TKLCNLLTARSLSAISFEDKSNIRMIAFNPGLTGDTSLMGKQSAFMKVMVAVLIRPLFY
FT                   IVSMFIPFLFVGRVERAGETLAALALGKVTLPTDKIYASLVRGRLTFPDPSQLAQNNDV
FT                   RDLLWKKSAKMVDLPESE"
FT   gene            complement(150286..150795)
FT                   /locus_tag="Lbys_0125"
FT   CDS_pept        complement(150286..150795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0125"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="COGs: COG3631 Ketosteroid isomerase-related protein;
FT                   InterPro IPR009959; KEGG: bcg:BCG9842_B4455 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1486; SPTR:
FT                   Ketosteroid isomerase-related protein-like protein; PFAM:
FT                   SnoaL-like polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15921"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS1"
FT                   /protein_id="ADQ15921.1"
FT                   /translation="MTKSILVITISFCLTSAYGQNKQATTITNSKQTTSEKMGNIETVK
FT                   KMYELFATKDNNAIRQIFDENIKWNQMKGFPGGGQHVGADAVFEKVFGGFRQNWTNWKA
FT                   TITRYIDSGDGVFVIGFYEGTFNATGKYMKSEFACEYKVKDGKITEFNQYTDTFLIGQA
FT                   MGLTKE"
FT   sig_peptide     complement(150724..150795)
FT                   /locus_tag="Lbys_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(151046..152257)
FT                   /locus_tag="Lbys_0126"
FT   CDS_pept        complement(151046..152257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0126"
FT                   /product="metallophosphoesterase"
FT                   /note="InterPro IPR004843; KEGG: cpi:Cpin_0975
FT                   metallophosphoesterase; PFAM: metallophosphoesterase; SPTR:
FT                   Metallophosphoesterase; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15922"
FT                   /db_xref="GOA:E4RSS2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS2"
FT                   /protein_id="ADQ15922.1"
FT                   /translation="MKTVRKILKWLFGIIILSILTAVILVRFTDGSINTPDKTILGFDE
FT                   EKGRFLIWEKKTFNLNGIDGPYIIDNQLYEVTKENKLLNKNINRKEKLVVRVNNSDNDL
FT                   FTFQLKDSITSEPDFYELPEKLIVISDIEGNFDGFSSFLINNGVIDKNFNWTFGNGHLL
FT                   LNGDFVDRGENVTQVLWLIYKIENQAQKQGGKLHYILGNHEIMNFQGNANYNKKKYKRV
FT                   AQLISNNDSLRVATKFMYSNKTELGKWLRSKNVIEKIGNYIFVHAGISPEILKYNVSLS
FT                   DINQIARNNWDKNLYDEEENNKVENFITGKKGVYWYRGLAQDYKYYDKIKENELNEVLK
FT                   FYQADKIIFGHTVVENITKEFNGKTINTDVKHGQEKNSAKTKGLLIQNGIEYKINGKGT
FT                   KTKI"
FT   sig_peptide     complement(152171..152257)
FT                   /locus_tag="Lbys_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(152409..153275)
FT                   /locus_tag="Lbys_0127"
FT   CDS_pept        complement(152409..153275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0127"
FT                   /product="NmrA family protein"
FT                   /note="COGs: COG0702 nucleoside-diphosphate-sugar
FT                   epimerase; KEGG: sli:Slin_1587 NmrA family protein; SPTR:
FT                   NmrA family protein; PFAM: NmrA-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15923"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS3"
FT                   /protein_id="ADQ15923.1"
FT                   /translation="MKKIAIIGATGMLGQPVTKEFINAGFDVTLLVRDINKAKQIFGST
FT                   VRLVEGDLKDSNKLRQSLDGQDGLYLNLSVEQKSGKTDFQPERDGLDNILEAAKNSTVK
FT                   RIGYLSSLVHLYQGQNGFDWWAFDIKQKAVTKIKNSGLTYSIFYPSTFMESFDKGAYRQ
FT                   GNNIVLAGTSKHKMFLISGSDYGKQVVKAFQLDNGNHDYVVQGQDGYTADEAAKFYVDN
FT                   YTKKKVKIMKAPVGLLKFFGKFTNKFNYGANIIEALNNYPEKFEAEKTWQDLGKPQVKF
FT                   IDYIKKN"
FT   gene            complement(153314..153481)
FT                   /locus_tag="Lbys_0128"
FT   CDS_pept        complement(153314..153481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15924"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS4"
FT                   /protein_id="ADQ15924.1"
FT                   /translation="MTITHDRKESRPNNMRLASCGVTFLNSSAVFQINFSAGLTVLYSG
FT                   IPHERQAQKR"
FT   gene            complement(153481..154392)
FT                   /locus_tag="Lbys_0129"
FT   CDS_pept        complement(153481..154392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0129"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro
FT                   IPR013520:IPR001357:IPR006055; KEGG: cpe:CPE1401 DNA
FT                   polymerase III subunit epsilon; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; BRCT domain protein; SMART:
FT                   Exonuclease; SPTR: Probable DNA polymerase III epsilon
FT                   chain; PFAM: Exonuclease; BRCA1 C Terminus (BRCT) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15925"
FT                   /db_xref="GOA:E4RSS5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS5"
FT                   /protein_id="ADQ15925.1"
FT                   /translation="MEFVTIDFETATAQRDSPCEIGLTFVQDGQIIDTKSWLIKPMYDE
FT                   FDYFNILIHGIRPEHVADKPEFNELWSEIKPLVENKFLIAHNAGFDISVLRRTLEAYQL
FT                   PFPTLNYSCSYIFSKKVWQGLPAYDLKTLCKVNNINLKHHRAGADSKATAELTLKAFEI
FT                   AGVSSIDDFPEKLKTTVGQLYNGGYKPAETKRIYKAKDLTKIEGDPTKHNTESIFYGRT
FT                   VVFTGALSSMVRAEAQQTIADIGGILGNGVTKETDFLVVGQQDYRVVGEDGMSSKQKKA
FT                   ISLIEKGSSLEILSEDDFLKCL"
FT   gene            complement(154436..154660)
FT                   /locus_tag="Lbys_0130"
FT   CDS_pept        complement(154436..154660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15926"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS6"
FT                   /protein_id="ADQ15926.1"
FT                   /translation="MEIITQLTRLNKQLITLQIRVIRHREKEARTANMRLASFGVTCLN
FT                   SSEVFQLGFSAGLTVLCSETRPNAKPENR"
FT   gene            complement(154602..155471)
FT                   /locus_tag="Lbys_0131"
FT   CDS_pept        complement(154602..155471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0131"
FT                   /product="HNH endonuclease"
FT                   /note="COGs: COG3183 restriction endonuclease; InterPro
FT                   IPR002711; KEGG: bai:BAA_3822 hypothetical protein; PFAM:
FT                   HNH endonuclease; SPTR: Putative uncharacterized protein;
FT                   PFAM: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15927"
FT                   /db_xref="GOA:E4RSS7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS7"
FT                   /protein_id="ADQ15927.1"
FT                   /translation="MYSSENIIWIKNVKRNQGDGWAYDDVSCGSTFWLNWPKSKRGSAS
FT                   TPNIGDIIVLFQKPNSINGQRNYKVHITHLVSPVTDTIHEDNEHPDHKWCREVKLIAKA
FT                   NPISAIPNPGYYNFFKPNRGLTNPIINLTNNIGLSEAETQEDIWRMFDNHFCPDVQNEI
FT                   FRPQEPNGIFGEVEGDKIIREHIKQELTRRNSKIVQLAKTQALNANNGRIKCECCKFDF
FT                   LKTYGQIGFNFIECHHKIHISTGERITRIEDLALVCSNCHRMLHRKLENGDYHTVDTLK
FT                   QAINNASN"
FT   gene            complement(155639..156433)
FT                   /locus_tag="Lbys_0132"
FT   CDS_pept        complement(155639..156433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmo:Pmob_0629 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15928"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS8"
FT                   /protein_id="ADQ15928.1"
FT                   /translation="MRIDLNDIGNGIEALKNQSHDMGLIINPVINKYNLQDKEILEVCQ
FT                   IGKFLYRINPELRIADKPQPPNPDFIIKFDNKTIGLEHTRIVDTEKSQRVYSISNLFNA
FT                   AAKEYQKNNPESEICATFRLKNDTLNFEQSDKKNIIQAINVFVNEAKNGNYQNQPDFIE
FT                   EIVIMPNSVVSFSYLETNFRGKKLPLQELQNAISIKENKLEKYYGQSNSINEFWLVLMV
FT                   GSLNSASFELDESLDYRTESKFDKVYLMSDFSEKIIEVKAYC"
FT   gene            complement(156583..157191)
FT                   /locus_tag="Lbys_0133"
FT   CDS_pept        complement(156583..157191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0133"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="COGs: COG2184 Protein involved in cell division;
FT                   InterPro IPR003812; KEGG: bgr:Bgr_p00180 cell filamentation
FT                   protein Fic; PFAM: filamentation induced by cAMP protein
FT                   Fic; SPTR: Putative uncharacterized protein; manually
FT                   curated; PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15929"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSS9"
FT                   /protein_id="ADQ15929.1"
FT                   /translation="MSNSYKYIDPDFTYTDPKTGLLRNLQDITDPDVLLFVESGAVTKR
FT                   LQELYENPIKIKSIDSLFEIHRHLFQDIYVWAGKKRTVEISKDGKQFFPTSHFDNAFRY
FT                   INQLIADFKKIPKDNKQLLAEKLAEILDNVNYLHPFREGNGRTQREFLRLLAVEKGLTL
FT                   NLNPPDNKSVYERYMKGTIESDLQTLTELIFELIDTNDK"
FT   gene            complement(157184..157405)
FT                   /locus_tag="Lbys_0134"
FT   CDS_pept        complement(157184..157405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1364 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15930"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:E4RST0"
FT                   /protein_id="ADQ15930.1"
FT                   /translation="MFNTIEIDRSNLTIMGVKFSDLKTLESTANALGSNMFEGFKPTPK
FT                   GIEIIRDYVTGKISLTELVAFAKQKAYV"
FT   gene            complement(157629..158360)
FT                   /locus_tag="Lbys_0135"
FT   CDS_pept        complement(157629..158360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0135"
FT                   /product="Gp37Gp68 family protein"
FT                   /note="COGs: COG4422 Bacteriophage protein gp37; InterPro
FT                   IPR011101; KEGG: cph:Cpha266_1493 phage Gp37Gp68 family
FT                   protein; PFAM: Gp37Gp68 family protein; SPTR: Phage
FT                   Gp37Gp68 family protein; PFAM: Phage protein Gp37/Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15931"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:E4RST1"
FT                   /protein_id="ADQ15931.1"
FT                   /translation="MAQSSIEWTEMTWNPTTGCDKISAGCKFCYAEVMSKRLQAMGVEK
FT                   YKDNFEITIHEDELQTPYTWKKPKVVFVNSMSDLFHKDVPIDFIRKVFKVMKENPQHVF
FT                   QVLTKRADILRYYDSEGWLDWTHNIWMGVSVENNKVTKRIDLLRETGARVKFLSCEPLI
FT                   GAIPNMNLTGIDWVIVGGESGRKPRPMKEEWVTDIKNQCLDADVAFFFKQWGGTNKKKT
FT                   GRLLEGKTWDEMPEIELHKNV"
FT   gene            complement(158363..159478)
FT                   /locus_tag="Lbys_0136"
FT   CDS_pept        complement(158363..159478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_4264 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15932"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:E4RST2"
FT                   /protein_id="ADQ15932.1"
FT                   /translation="MGSKNIHLEPFDKGTITKLEIFEDYAQAWIPTFVMQSAKEIHIFD
FT                   LFSGPGYDSKNIPGSPIRLLEKINEHLGIIMSKKTKIVLHLNEFEPKKKKQKKFELLRE
FT                   NCNEYISRNPKFKYFLTINFYNENAEELFFKLTPTISKYPSLVYLDQNGVKFISQEYIN
FT                   ELEKLKTTDFLFFVSSSFFKRYGKTEEFRKALEIDVSELEVEEYRNMHRLVLNKMKSRL
FT                   PTKTELKLFPFSIKKNANIYGIVFGAKNYAAVHKFLTIAWKRNELNGEADFDIDDDNKK
FT                   NQLTIFEGKRMTKIEKFQSDLENKLLEIDSTTNKAVLIYTYQCGHIPKHAEVVLKKLKK
FT                   LGKLNYDTKTPYLTYENVFRNNNIITYQIKK"
FT   gene            complement(159512..159673)
FT                   /locus_tag="Lbys_0137"
FT   CDS_pept        complement(159512..159673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15933"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTB9"
FT                   /protein_id="ADQ15933.1"
FT                   /translation="MNNKKATANSRFAKAGVSCFYESEVLNSSFVHLMKFSAKNPRLRK
FT                   AANRCASA"
FT   gene            complement(159663..160571)
FT                   /locus_tag="Lbys_0138"
FT   CDS_pept        complement(159663..160571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_2492 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15934"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC0"
FT                   /protein_id="ADQ15934.1"
FT                   /translation="MAYTSPLFQSSFDLFSHSIEHFNMGTERDRKFVILHLANAVELIF
FT                   KDLMLDLGLSIYKNPKETVTITGAIETLSKEKSIKIPHLNKLELLIDERNALQHRYGFP
FT                   NELTTIFYMEATYDFFKEFLKENYNLDIEKVLEDFLEEDDLAIFKLRSVTTQTELDKLN
FT                   KLTKVHPVGALLSAYAYMEGQTNEIRELILSQATGEERDYRMSIFRFFNPDNVSRLMNE
FT                   YEVEIDEKTRKKLFDFRNVRNQVAHGRETVDSKQVIEFINMVKDLEPKFNELKEKVEKN
FT                   PRLLIEKEKARISERNTENEQ"
FT   gene            complement(160574..160936)
FT                   /locus_tag="Lbys_0139"
FT   CDS_pept        complement(160574..160936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00992990 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15935"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC1"
FT                   /protein_id="ADQ15935.1"
FT                   /translation="MEQKYINGQQLSDFVETHKLMNQYSIVHFNAIVTITTANNKITNR
FT                   QMEVMISFDNFNCLGQVTLMESDIDPKLYQTIFEANWQKMEHIENEYLLITDVHKKNPT
FT                   IGSYSVKIIPLNKTRD"
FT   gene            complement(161187..162020)
FT                   /pseudo
FT                   /locus_tag="Lbys_0140"
FT   gene            162316..163581
FT                   /locus_tag="Lbys_0141"
FT   CDS_pept        162316..163581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0141"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: coc:Coch_0145 integrase family
FT                   protein; PFAM: integrase family protein; SPTR: Integrase;
FT                   PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15936"
FT                   /db_xref="GOA:E4RTC2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="InterPro:IPR035386"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC2"
FT                   /protein_id="ADQ15936.1"
FT                   /translation="MEQEKRSTFKLLFYLKKNEPKKNGNVPVMGRITIDGTPKSFSTKL
FT                   DINPNNWDLKHGRVLGKSAQALSTNLKLDNIRVRINKIYDDMLKDEGFATAQKVKLSFL
FT                   GVGVMDDAILKVFKDQNEDFERMVSKGKRSQNTYNKYKTVYNHLSEFIRERYHREDMAF
FT                   RELTSDFIREFDFFLRIDKECTHNTVWVYTMPVIALAELAIKKGLIRQNPFEDYEISME
FT                   ETDRSYLLKEDVERLMLLKPSKSKYELVKDLFIFSCFTGLSYIDIQKLKWSNIQSFFDG
FT                   HQWIISRRKKSDVASNVRLLEIPKRIIEKYRGVTRNEYVFPVPSNATCNSHVKKLIEEA
FT                   EIITEQKVTFHTARHTFATMFLTEGVPLESLSKMMGHKNISTTQIYAKITSQKISKDMD
FT                   LVSHKFAGMEAAFIEMEEEVLV"
FT   gene            164130..164249
FT                   /locus_tag="Lbys_0142"
FT   CDS_pept        164130..164249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0142"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15937"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC3"
FT                   /protein_id="ADQ15937.1"
FT                   /translation="MEKYSIGNGNRVKRNFSTSSHYRINLKKSNQNKFHNAKK"
FT   gene            164255..164647
FT                   /locus_tag="Lbys_0143"
FT   CDS_pept        164255..164647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0143"
FT                   /product="single-strand binding protein"
FT                   /note="COGs: COG0629 Single-stranded DNA-binding protein;
FT                   InterPro IPR011344:IPR000424; KEGG: fjo:Fjoh_2979
FT                   single-strand binding protein; PFAM: single-strand binding
FT                   protein/Primosomal replication protein n; SPTR:
FT                   Single-stranded DNA-binding protein; TIGRFAM: single-strand
FT                   binding protein; PFAM: Single-strand binding protein
FT                   family; TIGRFAM: single stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15938"
FT                   /db_xref="GOA:E4RTC4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC4"
FT                   /protein_id="ADQ15938.1"
FT                   /translation="MNITGRLTRDAEVRTTSQDKQVVNFSIATNDSYRNKQGERIEQTT
FT                   YFDCSYWISPNVAKILTKGTLVELTGRVSARAWTGNDGEAHAGLNFHTSNIKLHGGGKR
FT                   AETVQATAKVESNKVVPQPVEDDLPF"
FT   gene            164693..165766
FT                   /locus_tag="Lbys_0144"
FT   CDS_pept        164693..165766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0144"
FT                   /product="phage/plasmid-related protein TIGR03299"
FT                   /note="InterPro IPR017686; KEGG: fjo:Fjoh_2980 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   phage/plasmid-related protein TIGR03299; PFAM: Domain of
FT                   unknown function (DUF932); TIGRFAM: phage/plasmid-related
FT                   protein TIGR03299"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15939"
FT                   /db_xref="InterPro:IPR017686"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC5"
FT                   /protein_id="ADQ15939.1"
FT                   /translation="MAHNINFNERTGRYSFFSVQQKAWHGLGQIVEQYPTSEEAIKYAG
FT                   LDYEVVKSPLFTKGSGIIETANGIEIGSSELEVPNYFANIRTDNNAVLGVVGKDYHIVQ
FT                   NREAFNFFDAIVGGGEGILYGTAGALGNGERIFITAKLPDYIRVGNGDDVTEKYIFLTT
FT                   SHDGSGSITAAFTPIRIVCQNTLNASLRNMSNVVRIKHTSGAKQRLENAHKVMGLANTL
FT                   SNQLEGIFNEWAKVKVTDREVRKLIQLALCPNKETFDLLKKGAEDEVSTLFKNTVEDAF
FT                   AYAMISDTQQMDTTKGTLFGAYNAVTGYYQNVRNYKNDEAKLQSIVMGGTAQLKTQKAF
FT                   ELCTSFATDGAEILNLN"
FT   gene            165819..166016
FT                   /locus_tag="Lbys_0145"
FT   CDS_pept        165819..166016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ath:AT2G32950 COP1 (CONSTITUTIVE
FT                   PHOTOMORPHOGENIC 1); protein binding / ubiquitin-protein
FT                   ligase; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15940"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC6"
FT                   /protein_id="ADQ15940.1"
FT                   /translation="MKSKSIDEAKNMAKDKSIETGHKDEAIYIIYCSRSEYFYVDTDSL
FT                   IRLWERLIGYYENGVYTAEK"
FT   gene            166029..166223
FT                   /locus_tag="Lbys_0146"
FT   CDS_pept        166029..166223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: enc:ECL_03140 rhs family protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15941"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC7"
FT                   /protein_id="ADQ15941.1"
FT                   /translation="MQVTDLNGCPIEVTNLREAIKMARQYKEYRHEDKSFSEFDKRQKA
FT                   YWTDMYEKLTAIKKRLDDN"
FT   gene            166236..166775
FT                   /locus_tag="Lbys_0147"
FT   CDS_pept        166236..166775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0147"
FT                   /product="PRTRC system protein E"
FT                   /note="InterPro IPR022273; KEGG: fjo:Fjoh_2981 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   PRTRC system protein E; TIGRFAM: PRTRC system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15942"
FT                   /db_xref="InterPro:IPR022273"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC8"
FT                   /protein_id="ADQ15942.1"
FT                   /translation="MNANFFNQIAQLDFTGNLQLTIAKGNDSNLIVSVLLNNEGCGDNA
FT                   KNLIPPLTFNAIPQDFDEGFFEQITTPIQKASGLMVDMEAFMKQLEEAKKNSAMEKEKA
FT                   DKQKKEQEAKDKKFKDGMAKAEELEKEGKFRDAWMKVPDITEFPEKADEIRKRKGELSA
FT                   KFSTPSLFGAEQEQIV"
FT   gene            166794..167012
FT                   /locus_tag="Lbys_0148"
FT   CDS_pept        166794..167012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2983 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: PRTRC system
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15943"
FT                   /db_xref="InterPro:IPR022289"
FT                   /db_xref="InterPro:IPR032866"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTC9"
FT                   /protein_id="ADQ15943.1"
FT                   /translation="MLLATQLERVFILNDKGQQIKLTDPEPKWSVEAVMNFYANSYPIL
FT                   TTAKVSAPVIRDDTVQYRFESVMGTKG"
FT   gene            167030..168184
FT                   /locus_tag="Lbys_0149"
FT   CDS_pept        167030..168184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2984 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15944"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD0"
FT                   /protein_id="ADQ15944.1"
FT                   /translation="MNYATQHHIGYYQNPTATQTADFAQTVGRVRRLDAKTKGRKRDTE
FT                   RQIESRTDSHATNGFLRCSFLPKLQEAETAQACKKSEKTERDFYQSLSKLAGHYGIQPI
FT                   QSRQYGYPYNIALALDDTEEQLRKKFRDWEEIRLIQDSKKTYFVSEERYSTGATLYYIP
FT                   VVPLYRLSKNPNRKQAVQLLQSVCAYLYHIADVPYYRQESSFLYWMYEMVTEWIVCDDE
FT                   NEDTPTYLNEIRQAEQIGERMEQKIYNGQNLSRFKERLNAFKIKDSFDQDCYKLASEAF
FT                   ALYGQFPTATINRNALPNGEANEEDMENIIGMEKYVSFCADAKGILFQTLFDSVNTELQ
FT                   EYGQMEEPTIVKRFDGSDITANTLEFENRVFSLIEELIYILDNY"
FT   gene            168197..168910
FT                   /locus_tag="Lbys_0150"
FT   CDS_pept        168197..168910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2985 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: PRTRC system
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15945"
FT                   /db_xref="InterPro:IPR022280"
FT                   /db_xref="InterPro:IPR032787"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD1"
FT                   /protein_id="ADQ15945.1"
FT                   /translation="MKDITQDFGTLYHPLSALVFYQTKGSSKATYVEHFDMDKNGNPIN
FT                   AHPLTEREAKVLAKALNTEKEKSKAFLKSNGILPTNVLHINPSENGTVLWYTKARKTKM
FT                   YFTESLEIPNGTAEVPAMLWYASKQSLVVFALDKDRRPTEKTALFHAPFFNVYEDGHVC
FT                   MGNVDVNIKNSASVEEFIQAWQSYFFNSYFSHLVNEHNPIKGNCVSLWKDLISTGKAFP
FT                   KEVLKKTNKTIKTIL"
FT   gene            168910..169716
FT                   /locus_tag="Lbys_0151"
FT   CDS_pept        168910..169716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0151"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="InterPro IPR000594; KEGG: fjo:Fjoh_2986
FT                   UBA/ThiF-type NAD/FAD binding protein; PFAM: UBA/THIF-type
FT                   NAD/FAD binding protein; SPTR: UBA/THIF family NAD/FAD
FT                   binding protein; PFAM: ThiF family; TIGRFAM: PRTRC system
FT                   ThiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15946"
FT                   /db_xref="GOA:E4RTD2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022500"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD2"
FT                   /protein_id="ADQ15946.1"
FT                   /translation="MNTEILKVHFTDSYLINPTNPITVNVIGAGGTGSKVMTALLEMNH
FT                   SLIELGHAGLFIRLWDDDVITQANLGRQRFAECEVGLYKSVAIINRINRWAGTNWKAEA
FT                   RKFEKDSKERLPENAGASIYISCVDSVQARFEIADILNGLNNGKAYSNRPRYWLDFGNS
FT                   QHTGQAILSTIGTIQQPKSEKYETVASLPMVTDEFGELLKQSELEDDTPSCSLAEALEK
FT                   QDLFINSSLVQMGCSLLWGLFRNGLTPYRGFFHNLKDFRTHPIKVA"
FT   gene            170022..170600
FT                   /locus_tag="Lbys_0152"
FT   CDS_pept        170022..170600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_2998 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: GIY-YIG catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15947"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD3"
FT                   /protein_id="ADQ15947.1"
FT                   /translation="MMIVDTKAIVKQSEIFALNLVKQISKITVRPFQEITFHSSEFRDK
FT                   MTLKAHLHKIPKSNYPLIYIIQVQSPTSLKKLIEHFEGYHTINKTKTKNKDRVNLSRYN
FT                   KTPSKVLYVGSSTTDFKTRIKNHLGTEGTRVYSLHLCKWDNCLDYKLKVSAFEVVSDNE
FT                   EVVERFIVEILEQHFWDKLKPVFGKRSGL"
FT   gene            complement(170611..171048)
FT                   /locus_tag="Lbys_0153"
FT   CDS_pept        complement(170611..171048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0153"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789; KEGG: bpf:BpOF4_05695 two-component
FT                   response regulator of extracellular degradative enzyme;
FT                   PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Possible response regulator;
FT                   PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15948"
FT                   /db_xref="GOA:E4RTD4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD4"
FT                   /protein_id="ADQ15948.1"
FT                   /translation="MNTMQIIRVALIDDHDLLRDGICKFLESFGFQTVFEAENGKVALD
FT                   EMQKVEVLPDVCIVDINMPVMDGFETTKALNADYPNVKILAFSVNDDEKDVLKMLKNGA
FT                   AGYILKGADPGELRKAIEVVYSGGKYFSAGISKIAERFFKN"
FT   gene            complement(171050..171319)
FT                   /locus_tag="Lbys_0154"
FT   CDS_pept        complement(171050..171319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_0334 hypothetical protein; SPTR:
FT                   Possible response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15949"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD5"
FT                   /protein_id="ADQ15949.1"
FT                   /translation="MDTENNTYPTLQFPASELSAFSVATNFFSISLKNGEVIHFTPDDM
FT                   EAFYNWLIKQGVRDIRNDILEEKRTSVAVKSVGGWKGLFQRKRR"
FT   gene            complement(171610..171900)
FT                   /locus_tag="Lbys_0155"
FT   CDS_pept        complement(171610..171900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF1794 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: DNA binding
FT                   domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15950"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD6"
FT                   /protein_id="ADQ15950.1"
FT                   /translation="MELLTNDDEEIMAHQEMILLLKTRIGEILKHYRPVMNGEIYLSGQ
FT                   DVCELLHISKRTLQQYRDDKILPYIQIGGKIIFKQSDIIATLEQNYVSVSL"
FT   gene            complement(171881..172192)
FT                   /locus_tag="Lbys_0156"
FT   CDS_pept        complement(171881..172192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF1793 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15951"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD7"
FT                   /protein_id="ADQ15951.1"
FT                   /translation="MEVIAIQKSTLEGMKNELKELLELTENATQKYAPIFKEEKWLDNQ
FT                   EVCLMMNITKRTLQTYKDKGLLPYSRLNRKNYYKLSDVQALLKAGQPYKSNEDGVIDQ"
FT   gene            complement(172369..172650)
FT                   /locus_tag="Lbys_0157"
FT   CDS_pept        complement(172369..172650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_2363 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15952"
FT                   /db_xref="GOA:E4RTD8"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD8"
FT                   /protein_id="ADQ15952.1"
FT                   /translation="MVASLVIGIIFLVAGLGLRYWINRRKFYRRSPMGAEGFSSYESSV
FT                   FIKLIEKVGKWIAYALIIFGLLSLWVYSREKNDKEKQEVKTEQPASHR"
FT   sig_peptide     complement(172600..172650)
FT                   /locus_tag="Lbys_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(172753..173202)
FT                   /locus_tag="Lbys_0158"
FT   CDS_pept        complement(172753..173202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfr:BF0113 hypothetical protein; SPTR:
FT                   Conserved protein found in conjugate transposon"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15953"
FT                   /db_xref="InterPro:IPR024355"
FT                   /db_xref="InterPro:IPR038707"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTD9"
FT                   /protein_id="ADQ15953.1"
FT                   /translation="MIAIFNKFKIGLLPVYVLLAILTASFTLVSCNKDDELEIQNDFPF
FT                   DVKVMPVPNDVANGQTVEIRITIQRTGNYSNTQYFLRYFQFDGQGTLRYYDEPPYLPND
FT                   LYELPTEQFRLYYTSASAVSQSFEVWISDNFGNEKQLSFQFNSSD"
FT   sig_peptide     complement(173107..173202)
FT                   /locus_tag="Lbys_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(173214..173774)
FT                   /locus_tag="Lbys_0159"
FT   CDS_pept        complement(173214..173774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0159"
FT                   /product="Conjugative transposon protein TraO"
FT                   /note="InterPro IPR018899; KEGG: bfr:BF1350 conjugate
FT                   transposon protein TraO; PFAM: Conjugative transposon
FT                   protein TraO; SPTR: Protein found in conjugate transposon
FT                   TraO; PFAM: Conjugative transposon protein TraO"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15954"
FT                   /db_xref="InterPro:IPR018899"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE0"
FT                   /protein_id="ADQ15954.1"
FT                   /translation="MKKYIYTVMLVLMGITMAQAQRMLPKQKGLEISTGILSDNKIGND
FT                   YYISAAMTVNGKNGNYQLWALEYTHQYHEYKDLRIPQESYSAEGGYSFFLLGDARKNIT
FT                   LNFGITGVVGYESINRGEAMLYDGAKILTEDNFIYGAGGRLTFETFLSDRFVLVLQGRT
FT                   KVLWGTDLEQFRPSAGVGLRFNF"
FT   sig_peptide     complement(173715..173774)
FT                   /locus_tag="Lbys_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(173802..174695)
FT                   /locus_tag="Lbys_0160"
FT   CDS_pept        complement(173802..174695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0160"
FT                   /product="conjugate transposon protein TraN"
FT                   /note="KEGG: pgn:PGN_1282 conjugate transposon protein
FT                   TraN; SPTR: Conjugate transposon TraN family protein;
FT                   TIGRFAM: Bacteroides conjugative transposon TraN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15955"
FT                   /db_xref="InterPro:IPR022298"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE1"
FT                   /protein_id="ADQ15955.1"
FT                   /translation="MKSLFKTFLALALIVGFAVQSHAQDSAKNRLALGKIEPYRMEVTY
FT                   DKTSHLIFPTAIRYVDLGSEYLIAGKAEDAENVLRVKASVKEFEPETNFSVITNDGRFY
FT                   SFNVHYSSYPEALSYDLLTMQKSVDKTKGNDVLFEELGNNSPSLAGLLLETIHKKDKRI
FT                   VKHIGAKSFGIQFTLKGIYIHNGKYYFHTELRNRTNVPFQIDFINFKVVDKKVAKRTVI
FT                   QERPLQPLRTYKPLNEIGGKTTEQNVFLLDQFTIADDKVLLIEIFEKNGGRHQTLQVEN
FT                   SDLIKARLINDMHLKF"
FT   sig_peptide     complement(174627..174695)
FT                   /locus_tag="Lbys_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(174720..176048)
FT                   /locus_tag="Lbys_0161"
FT   CDS_pept        complement(174720..176048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3000 hypothetical protein; SPTR:
FT                   Conserved protein found in conjugate transposon TraM; PFAM:
FT                   Protein of unknown function (DUF3714); TIGRFAM: Bacteroides
FT                   conjugative transposon TraM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15956"
FT                   /db_xref="GOA:E4RTE2"
FT                   /db_xref="InterPro:IPR022187"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE2"
FT                   /protein_id="ADQ15956.1"
FT                   /translation="MKENEKRVSILVEEGDQSKTSSLLDDKKSNKERLKKPLIFGLMGI
FT                   VFVGCMYLIFKPSSDKKEIQNIGLNDAVPQATEAGMQADKQKAYEQEMLEQKDQEKRNA
FT                   LATLSDYWNTDDKDASADEQPEEDDSFANGGGKGYTRSGNSTLNSYRNAQSTLGSFYQD
FT                   DNAETAELRRQLDELKEKLAEKNVPAGVTVDDQLALMEKSYQMAAKYLPSGTNNGQPAA
FT                   TDSAARSSSSNTQKEYFVAFSPTRKKAVSALYREPTDNEFLANWSENRNRGFYTAGSVE
FT                   QVAQPKNSVKACIQETQTIIGESGVRLRLLEPAQTPNRTIPQGTILTAIGKFQGGRLQL
FT                   KVTSIELDGNIIPVDITIYDLDGQQGLYVPYSPEMNALTEMAGNMSQTSGTSLMLTQSA
FT                   GQQIAADLSRGVVQGISGYFSKKVRTPKVTLKAGHQVFLVSKK"
FT   gene            complement(176035..176319)
FT                   /locus_tag="Lbys_0162"
FT   CDS_pept        complement(176035..176319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmx:PERMA_A0011 DNA replication protein DnaC;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15957"
FT                   /db_xref="GOA:E4RTE3"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE3"
FT                   /protein_id="ADQ15957.1"
FT                   /translation="MKKLRANMDRYFDRLDERWRALPVNKQHRYTLYFFTAYLLLTVGV
FT                   IFKVWYDTAKSDNSMVIEHIENPVLQKKESPAPLQDTLQILKNQFYERK"
FT   gene            complement(176338..176766)
FT                   /locus_tag="Lbys_0163"
FT   CDS_pept        complement(176338..176766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmg:100198550 hypothetical protein
FT                   LOC100198550; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15958"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE4"
FT                   /protein_id="ADQ15958.1"
FT                   /translation="MEALSDLNTFAKILTDKGYNGYFHTQGAYAGKLKDSIGEYLESCQ
FT                   KGTDSLPKQDLLLTGYLQWSGEDKPRVECSMWVQYLNGKFSLNKMEVAKKDRFGQLLKK
FT                   SELTSLSTITAPKAMDAIASVNDEQKQKAGQSPKRFRL"
FT   gene            complement(176778..177401)
FT                   /locus_tag="Lbys_0164"
FT   CDS_pept        complement(176778..177401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3001 hypothetical protein; SPTR:
FT                   Conjugative transposon protein TraK; TIGRFAM: Bacteroides
FT                   conjugative transposon TraK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15959"
FT                   /db_xref="GOA:E4RTE5"
FT                   /db_xref="InterPro:IPR022276"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE5"
FT                   /protein_id="ADQ15959.1"
FT                   /translation="MEFKTLRNIENSFRQIRLYAIVFAVLCIGVVGYAVWQSYHFAEQQ
FT                   RQKIYVLDNGKSLMLALSQDASINRPVEAREHVRRFHELFFTLAPDKNAIENNMKRAFN
FT                   LADKSAFDYYKDLSEKGYYNRIISGNVQQRIEVDSVVCNFDTYPYAVRTYAKQFIIRSS
FT                   NVTRRNLVTSCFLVNSVRSDNNPQGFNIEKFAVTENRDIEVIDR"
FT   sig_peptide     complement(177294..177401)
FT                   /locus_tag="Lbys_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(177424..178419)
FT                   /locus_tag="Lbys_0165"
FT   CDS_pept        complement(177424..178419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0165"
FT                   /product="TraJ family protein conjugative transposon"
FT                   /note="InterPro IPR012424; KEGG: fjo:Fjoh_3002 TraJ family
FT                   protein conjugative transposon; PFAM: TraJ family protein
FT                   conjugative transposon; SPTR: TraJ family protein
FT                   conjugative transposon; PFAM: Homologues of TraJ from
FT                   Bacteroides conjugative transposon; TIGRFAM: Bacteroides
FT                   conjugative transposon TraJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15960"
FT                   /db_xref="GOA:E4RTE6"
FT                   /db_xref="InterPro:IPR012424"
FT                   /db_xref="InterPro:IPR022393"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE6"
FT                   /protein_id="ADQ15960.1"
FT                   /translation="MEWDNLHELLRSLYDDMMPLAGDMAAVAKGLAGLGALFYVALKVW
FT                   QALSRAEPIDMFPLLRPFALGLCIMFFPTIVLGTINAVLSPVVTGTHQILEDQVLDLHE
FT                   LQEQKDRLEYEAMVRNPETAYMVSDEEFDKKLDELGWSPSDIGTMAGMYMDRQAYKIEK
FT                   AIKDWFRNLLEILFQAAALVIDTIRTFFLIVLSILGPIAFAISVWDGFQSTLTQWLTRY
FT                   ISVYLWLPVSDLFSSMLARIQSLILERDIAMLADPTYIPDTSNTVYIIFMIIGIIGYFT
FT                   IPTVTGWVIQAGGAGNFTRNVNQTAMKTGNIAGAGAGSTVGNIGGKLMGK"
FT   gene            complement(178423..179055)
FT                   /locus_tag="Lbys_0166"
FT   CDS_pept        complement(178423..179055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3003 hypothetical protein; SPTR:
FT                   Conserved protein found in conjugate transposon TraI"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15961"
FT                   /db_xref="InterPro:IPR025415"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE7"
FT                   /protein_id="ADQ15961.1"
FT                   /translation="MKKVMLLVCTALMLAVAPSAKAQWVVTDPANLASGILNSANEIVQ
FT                   TSSTVSNVVKNFNEVKKVYEQGKEYYDKLKAINNLVKDARKVQQTVLLVGDVSEMYVQN
FT                   FGKMMNDPNFSPQELTAIGNGYSALLNESTELLKELKQIITASSLSLNDKERMDIIDRV
FT                   YKEVKDYHSLVRYYTTKNISVSYLRAKKKNDAKRVLELYGTANQKYW"
FT   sig_peptide     complement(178990..179055)
FT                   /locus_tag="Lbys_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(179083..181587)
FT                   /locus_tag="Lbys_0167"
FT   CDS_pept        complement(179083..181587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0167"
FT                   /product="type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /note="COGs: COG3451 Type IV secretory pathway VirB4
FT                   protein; KEGG: fjo:Fjoh_3004 type IV secretory pathway
FT                   VirB4 components-like protein; SPTR: Protein found in
FT                   conjugate transposon; TIGRFAM: Bacteroides conjugation
FT                   system ATPase, TraG family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15962"
FT                   /db_xref="InterPro:IPR022509"
FT                   /db_xref="InterPro:IPR024451"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE8"
FT                   /protein_id="ADQ15962.1"
FT                   /translation="MRNVAKTTTLESKFPLLAVENNCILSKDADITACFEVRLPELFTV
FT                   ASAEYEAIHSAWHKAIKTLPDFTVIHKQDWYIKESYAPDMAKEDQSFLAKSYQRHFNER
FT                   PFLNHYSYLFLTKTTKERMRMQSNFSSLCKGVLIPKEIRDKEAIHRFMEAVAQFERIVN
FT                   DSGFIMLQRLTEEDIIGADGKQGLLEQYLTLSRDAGTPMQDIALGGEEVRIGNKRLCLH
FT                   TLSDTDDLPGTVSADTRYEKLSTDRSDCRLSFAAPVGLLLSCNHIYNQYLFLDNSEDNL
FT                   QKFEKSARNMHSLARYSRANQINKEWIERYLNEAHSFGLSSIRAHFNIMAWSEDPGELK
FT                   QLKNDSGSALALMECKPRHNTTDVATLYWAGMPGNAGDFPSEESFYTFIEPALCFFTEE
FT                   TNYHNSPSPFGIKMADRLTGKPIHLDISDLPMKRGIITNRNKFILGPSGSGKSFFTNHM
FT                   VRQYYEQGAHVLLVDTGNSYQGLCELIKGKTKGEDGVYFTYTEDNPIAFNPFYTDDGVF
FT                   DIEKRESIKTLIITLWKRDDEPPTRSEEVALSNAVSGYIERIKQEDVYPSFNGFYEYVQ
FT                   GDYRQVLEEKQVREKDFDIANFLNVLEPYYKGGEYDYLLNSDKQLDLLSKRFIVFEIDA
FT                   IKDHKILFPIVTIIIMEVFINKMRRLKGIRKLILIEEAWKAIAKEGMAEYIKYLFKTVR
FT                   KFFGEAIVVTQEVDDIIQSPIVKESIINNSDCKILLDQRKYMNKFDDIQAMLGLTDKEK
FT                   GQVLSINMNNDPSRLYKEVWIGLGGTHSAVYATEVSLEEYLAYTTEETEKMEVMQLASE
FT                   LDGNVELAIKHIAIQRRDKSNQ"
FT   gene            complement(181584..181916)
FT                   /locus_tag="Lbys_0168"
FT   CDS_pept        complement(181584..181916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3005 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15963"
FT                   /db_xref="GOA:E4RTE9"
FT                   /db_xref="InterPro:IPR025407"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTE9"
FT                   /protein_id="ADQ15963.1"
FT                   /translation="MSNYNINKGIGRTVEFKGLKAQYLFMFAGGLLGTLILVMILYMAG
FT                   VNSYICLFLGAGGASLIVWQTFSLNKKYGEHGLMKIAANKRHPRYIICRKPVHRYIKFT
FT                   RKSNAV"
FT   gene            complement(181928..182233)
FT                   /locus_tag="Lbys_0169"
FT   CDS_pept        complement(181928..182233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3006 hypothetical protein; SPTR:
FT                   Protein found in conjugate transposon"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15964"
FT                   /db_xref="GOA:E4RTF0"
FT                   /db_xref="InterPro:IPR008020"
FT                   /db_xref="InterPro:IPR025408"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF0"
FT                   /protein_id="ADQ15964.1"
FT                   /translation="MEKQRKKVLLAAAAMLSGIGVFAQGNGSAGINEATQMVTSYFDPA
FT                   TQLIYAIGAVVGLIGGVKVYNKFSSGDPDTSKTAASWFGACIFLIVAATILRSFFL"
FT   sig_peptide     complement(182165..182233)
FT                   /locus_tag="Lbys_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(182434..183234)
FT                   /locus_tag="Lbys_0170"
FT   CDS_pept        complement(182434..183234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpv:cgd1_3240 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15965"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF1"
FT                   /protein_id="ADQ15965.1"
FT                   /translation="MITKDDPDYIFEQYKGHTIASHKNNVVGKDINNLIIVYRSDEFPN
FT                   HGFIIGLDDSKLSGGRKSVPHNIDDARGYIDWVVETRQKQAEIKSENNIVDSKAYDLRV
FT                   NKGMLPTIDITGHTFYVDIRMDMLRPKDDFLSKGIVFSDIGNYYDEDKRTYTIPYNPKT
FT                   HEFQEPDYRNIKELPKDLIAVRFPSERLLDRIGWNRHYGFELTHGLEKQGLKLQFEAKQ
FT                   IPWEKTFLVGLIKSNLKTEKNLQKAEDKQQPTQQNKIKQKGRKL"
FT   gene            complement(183308..183943)
FT                   /locus_tag="Lbys_0171"
FT   CDS_pept        complement(183308..183943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3014 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15966"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF2"
FT                   /protein_id="ADQ15966.1"
FT                   /translation="METVIVICLLIVIALLVQDKIVIRKRSEQKPKQEKVNPNLPDIMG
FT                   QPKPVRSLSMPNTANERQIEEVEINPDNLDIEYDENENVSIQIPQEELDEVFRNTPDWE
FT                   EEEEEWNRYGIANGDNGFAQGVTFDELSSVGALLQKENLEQAQKETAAAIVQKLQGTEL
FT                   FSLLENSIEGASRKIAELLDSTLSSGSDDSSSTLRKSDLSDFDIGEFV"
FT   sig_peptide     complement(183869..183943)
FT                   /locus_tag="Lbys_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(183947..184384)
FT                   /locus_tag="Lbys_0172"
FT   CDS_pept        complement(183947..184384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3015 hypothetical protein; SPTR:
FT                   Protein found in conjugate transposon; PFAM: Protein of
FT                   unknown function (DUF3408)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15967"
FT                   /db_xref="InterPro:IPR021823"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF3"
FT                   /protein_id="ADQ15967.1"
FT                   /translation="MEKDNKRKATPDINEELMMNLMVDGVKKEGLQLPPELSEEPQKEE
FT                   VKTNELPKDKPTVKEKSRAKKVSDADYESIFFRRPDTNARDGKTVYIRPDFHEKLSRIV
FT                   QVIGEDKITIYGYLDNLLDYHFQEFGEQITKSFNDKYKPIL"
FT   gene            complement(184392..185156)
FT                   /locus_tag="Lbys_0173"
FT   CDS_pept        complement(184392..185156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0173"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: fjo:Fjoh_3016 chromosome partitioning
FT                   ATPase; SPTR: Protein found in conjugate transposon; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15968"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF4"
FT                   /protein_id="ADQ15968.1"
FT                   /translation="MNAKHKTVFIAFSSQKGGVGKSTFTTLVASTMHYRLGYNVAVFDA
FT                   DFPQHTLMKMKTRDLAMVMENEALKKLAYKQFTTINKKAYPIMQYKADSVLDAAHEFVN
FT                   ASSVPVDMVFFDLPGTVNTPGILKALAGMHHIFTPITADRVVMESTLIFTQLLQDVIMK
FT                   KGETAIQTINLFWNQVDGRESTPLYDVYNQLIEQLGLSLMQSQIKNSTRFRKESEADSK
FT                   TVFRSTVMPPDERLMKACQLDLFIDEFLKIIQ"
FT   gene            complement(185410..185556)
FT                   /locus_tag="Lbys_0174"
FT   CDS_pept        complement(185410..185556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15969"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF5"
FT                   /protein_id="ADQ15969.1"
FT                   /translation="MPNNATIIKAPIYVHSFVPVNRYKGVDSYAGNNVNTQLHIQRNTI
FT                   VQM"
FT   gene            185875..186312
FT                   /locus_tag="Lbys_0175"
FT   CDS_pept        185875..186312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3017 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15970"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF6"
FT                   /protein_id="ADQ15970.1"
FT                   /translation="MNENNNKKQNKGGRTPKSDPSIHRHVFRLTDEENARLLSLFEASG
FT                   MSNKAKFIIYLLFSKEMKSVKIDKGTVDFYMRLTSFHSQFRSVGVNYNQIVKLLYKHFS
FT                   EKKAAAFLYKLEKQTAEMAMLCQKIIQLTEEFEAKHLKKQP"
FT   gene            186315..187616
FT                   /locus_tag="Lbys_0176"
FT   CDS_pept        186315..187616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0176"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="InterPro IPR005094; KEGG: fjo:Fjoh_3018
FT                   relaxase/mobilization nuclease family protein; PFAM:
FT                   Relaxase/mobilization nuclease family protein; SPTR:
FT                   Relaxase/mobilization nuclease family protein; PFAM:
FT                   Relaxase/Mobilisation nuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15971"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF7"
FT                   /protein_id="ADQ15971.1"
FT                   /translation="MIAKIGRSGNLYGALAYNQLKVEHENGQILFTNRIIETTNGHYSV
FT                   AQLAQSFAPYLIANRNTEKHTLHISLNPDPNDKVSDDKFREMAEQYMREMGYGEQPFVV
FT                   FKHTDIGRSHIHIVSVCVDEEGKKISDKFEKMRSMNVCRELERQHGLIPATDKEHKQNE
FT                   KIFRPVDYRAGDVKSQIASVVRHLPNYYQYQTLGEYNALLSLFNVTTEKVEGELHGKMQ
FT                   RGLLYIPLNEKSERAGHPFKASLFGKNAGLPALELHFAKSKEALKDHPTKPTIKAAITI
FT                   ALKTTSDELSFKKQLAEQGINVVVRRNDAGRIYGMTFIDHNSKTVWNGSRLAKELSANI
FT                   FNDYWNNNIQPEVKEPPELQSKISHAKDIEDLPLEKPHHLFDFLNTEPIPEKYEGGLIE
FT                   ALGGLLPEAQGEDYEEQDFANKMKKKRKRQRGQK"
FT   gene            187809..188513
FT                   /locus_tag="Lbys_0177"
FT   CDS_pept        187809..188513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_3010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15972"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF8"
FT                   /protein_id="ADQ15972.1"
FT                   /translation="MKRKSNGHTDDYLKRQAKDIQKQENISYLQALEKAAKNAGFNNWN
FT                   HFVNSSKSGVTPSKEKVEKLKVDHLNQPDYDESKAINPYRNLLVAAINEVLDKNLITLN
FT                   ATTPPQQDGHVFVDLFGFPSVVLWQDIGFEELRISVWWKYNHSKHPQANLTGNARENFN
FT                   GSSPLANRNHYKNFVGVVISGWLERKTGKYIQGKNNESIFDRYIRKGEKAELEKLPLQK
FT                   TKGFKTEGKFHF"
FT   gene            188666..190669
FT                   /locus_tag="Lbys_0178"
FT   CDS_pept        188666..190669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3019 hypothetical protein; SPTR:
FT                   Mobilization protein; PFAM: TraG/TraD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15973"
FT                   /db_xref="GOA:E4RTF9"
FT                   /db_xref="InterPro:IPR025988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTF9"
FT                   /protein_id="ADQ15973.1"
FT                   /translation="MQGEDDLRGLAKIMAFMRAVSILLMLMHFYWFCYGFFLDRGWTLE
FT                   IINKILGNFERTASLFSHTLYTKIFALVLLALSCLGTKGVKNEKITWPKIYTALAIGFV
FT                   LFFLSSPLLQLSAGLATSLYILTSSLGYIALMMAGVWITRLLRTNLMEDVFNNENESFM
FT                   QETKLMENEYSVNLPTKFWYNKKEHKGWINIVNPFRATIVLGTPGSGKSYAIVNSYIKQ
FT                   QIEKGFSMYIYDFKFDDLSTIAYNHLLKHRDKYKVKPKFYVINFDDPRKSHRCNPINPD
FT                   FMTDISDAYESAYTIMLNLNRSWIQKQGDFFVESPIILLAAIIWFLKIYDNGKYCTFPH
FT                   AIELLNKKYSDVFTILTSYPDLENYLSPFMDAWQGGAQDQLQGQIASAKIPLSRMISPQ
FT                   LYWVMTGDDFTLDINNPKEPKILCVGNNPDRQNIYSAALGLYNSRIVKLINKKGQLKSS
FT                   VIIDELPTIYFRGLDNLIATARSNKVAVCLGFQDYSQLIRDYGDKESKVIQNTVGNIFS
FT                   GQVVGETAKNLSERFGKVLQKRQSLTINRNDKSTSISTQLDSLIPASKISTLTQGMFVG
FT                   AVSDNFDERIEQKIFHAEIVVDNERVAAETKAYKKIPEILSFTDEHGTDNMKQEIETNY
FT                   RQIKKDIVQVIEAELERIKNDPDLQHLVQQGN"
FT   sig_peptide     188666..188770
FT                   /locus_tag="Lbys_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(190719..196136)
FT                   /locus_tag="Lbys_0179"
FT   CDS_pept        complement(190719..196136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0179"
FT                   /product="N-6 DNA methylase"
FT                   /note="COGs: COG4646 DNA methylase; InterPro
FT                   IPR003356:IPR001650:IPR002296; KEGG: pgn:PGN_0086 putative
FT                   DNA methylase; PFAM: N-6 DNA methylase; helicase domain
FT                   protein; SMART: helicase domain protein; SPTR: Probable DNA
FT                   methylase; PFAM: N-6 DNA Methylase; Helicase conserved
FT                   C-terminal domain; SNF2 family N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15974"
FT                   /db_xref="GOA:E4RTG0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG0"
FT                   /protein_id="ADQ15974.1"
FT                   /translation="MGFSKRQHLQLNIDALRIAFKLEKEKRQATVGERLLMMQYSGFGG
FT                   LKFVLNPIENAIDINHWRKTEHDLFPLTQELHTLLKENSENDKQYRRYVDSMKSSVLTA
FT                   FYTPPQIIDAVSATLRENGLDIQKFLEPSAGIGSFIQSFSENQKASTTAYEKDLLTGKV
FT                   LKQLYPESNVRVSGFEEISEKEHNSYDVVASNIPFGDTSVFDLSYSRSKETAKVQATRS
FT                   IHNYFFLKGTDMLREGGLLAYITSQGILNSPKNEPIRRALMQDNNLVSVVRLPNNLFTE
FT                   YAGTEVGSDLIILQKNTAKKGLTEAEELFCQSRQTEYNTPGNALFQDSTRIVHTDRKLD
FT                   TDPYGQPALIYTHKDGVAGIARDLQRMLSEDFGKHLDFNLYKGERNDESVIQIPIIPQP
FT                   PVVEPIVINQERQSLATPTIIQESQQELKQLSIFDLFENIDEPVAVLAPPKRTTQPKRQ
FT                   SAKANRRAIGRQTDLFSAMQQPYTPPVSNRADNQNTSANGIKQEAIGDLFSGINDNGQA
FT                   AQPALLNTIPEPAPYGGELQSFHRNDCLVIDNGWIGHLQDVDTSGGTAVFHPLQLPPLQ
FT                   KARAEAYIAVRDNYQGLYNKEATFQTEYKEERETLNRLYDAFVKRYGNLNSADNIKLIK
FT                   TDSAGKEIPYLERVIGGVVHKADIFSHPVSFSTVTIATDNPEEALAASLNKYGSVDLSY
FT                   ISEISGMTDDALREALHGRIFYNPLQKEYEISERWISGNVVEKAEEVRAYIVSNPDDVQ
FT                   AKESLTVLEEARPGRIEFEELDFNLGERWIPTGIYARFASHLFDTDVLVHYSESSDDFS
FT                   VKCDQKNVHIWDKYSVKAESRTFDGIALLKHALVNTTPDITKKVMVGDQEVKVRDMEAI
FT                   QMANTKIDEIRTAFSDWLHGQNDEFKQRLTDQYNDTFNCFVRPNYDGSHQEFPGLDRKG
FT                   LNIQDLYSSQKDTVWMIKLNNGAICDHEVGAGKTLVMCTAAQEMKRLGLAHKPMIIGLK
FT                   SNVHEIAEAYRTAYPHAKILYPGKEDFTPKKRLRIFGDIKNNDWDCVILTHDQFGMIPQ
FT                   SPEIQKEILEIELDSVERNLDAMQSQGKEVTRGMLAGVIKRKENLEVKLKTLQHDIENR
FT                   KDDVVDFKMMGIDHLFVDESHQFKNLMFNTRHTRVAGLGNVDGSLKAMNLLFAIRTIQE
FT                   RINADMGATFLSGTTISNSLTELYLLFKYLRPRAMEKQGINSFDAWAAIYARKTTDYEF
FT                   SVANNIVAKERFRYFIKVPELAQFYSEITDYRTAKDIGIDRPNKNEVLYNIPPTPDQDV
FT                   FIKKLMDFAKTGNAELLGRPPLTDREEKAKMLIATDYARKMSLDMRMVSGRYEDHPDNK
FT                   ASHCAANIAKYYNQYKAQKGTQFVFSDLGTYKPGEWNVYSEIKRKLVEDHGVPAHEVRF
FT                   IQEAKNDKQRKELINGMNEGKIRVLFGSTSMLGTGVNAQKRAVAVHHLDTPWRPSDLAQ
FT                   RDGRAIRKGNEIVKFFADNKVDIIIYAVEKSLDSYKFNLLYNKQLFIDQLKSNNLGKRT
FT                   IDEGSMDEKSGMNFSEYVAILSGNTDLLDKAKLEKQIAGLESEKQAFNRSKFSSKYKLE
FT                   DTTAMLESAGSRLDKFNLDWDNLQGRIQKRSDGTIANPLQLDGLSSNSDVKQIGAKLNQ
FT                   IADTARTGGDYQEIGSLYGFQLLVKTEVSEKEGVDIRVNRFLVQGEGNIKYTYNNGIMA
FT                   KDPETAAMNFLKALEKLPGYIEQEQKKIAELQKDLPVLQEVVNGTWAKESKLIELKTEL
FT                   AAVERKIQLSITPEPKDEPVVQIEKPKEAPTVSESIVRTKGIHLPRGVL"
FT   gene            complement(196123..196560)
FT                   /locus_tag="Lbys_0180"
FT   CDS_pept        complement(196123..196560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0180"
FT                   /product="Domain of unknown function DUF1896"
FT                   /note="InterPro IPR015082; KEGG: bth:BT_2325 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1896; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF1896)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15975"
FT                   /db_xref="InterPro:IPR015082"
FT                   /db_xref="InterPro:IPR036297"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG1"
FT                   /protein_id="ADQ15975.1"
FT                   /translation="MDTQQKDLSYFRLRLQELLHTSFPEKAYDNKFIEQRSSWAANAYE
FT                   GAFRSGNSIDQCDEIANYILFEGLHFSRFDTVFQVVCNEFDTIMADEELRPFALKMLPV
FT                   CGPVFEGYVLTDNFAYSTAYDLLYTELTGTIAIWIEENGLQ"
FT   gene            196762..198045
FT                   /locus_tag="Lbys_0181"
FT   CDS_pept        196762..198045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_4373 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15976"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG2"
FT                   /protein_id="ADQ15976.1"
FT                   /translation="MFEISHRTEVVKCPNPSCTRNIQLSIGKVPGGVNDSGGWILQCDN
FT                   CSTKFPYKVKNPDDYSSVKSGATILDSWDNDVPESKMMALKKHDLDSFPEDFSFDNLLF
FT                   VQTGEPEKPTFSDIEENIFFCPGCKTHLEPILYAQLSDKLPSINKSINSYLNYYLKGRA
FT                   GNPDSIIVVVDYKCACGFNTKGVLYKDFKERELPIEEEHELILIDVIGADLEFTIDGVY
FT                   DRDDCLSILQKLLIRWQVYYNKVFLAVPFIGFDFKNSEAQRVELWNWILKNTIPHKTTL
FT                   LTRKATLTSFLEGSANTGMDINVLKDYGLLNPTVDELTDKKALFKRDFHAKFYAGFDRK
FT                   TAEVLVGSFNIHEGTYVENIHFKSYDFGDFFKKYILKMNIIFDPRIIDEEGEFLLINEH
FT                   EDGKEFIAKVEKYTTSRREKIYELITPK"
FT   gene            198090..199427
FT                   /locus_tag="Lbys_0182"
FT   CDS_pept        198090..199427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00657240 Guanylate-binding protein,
FT                   N-terminal domain containing protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15977"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG3"
FT                   /protein_id="ADQ15977.1"
FT                   /translation="MYGINHKINDPGLYLLSDIVEEQLNVYVKALADTPAEDKERIVQL
FT                   EHAISIYQGELDKFKQEIEDQKKERFQFSVEEIYAMYGQYERKFISIEFHKYSESAQKY
FT                   GRNISGIILYGKAEREALEQVIQSGNVPRTNGLVKFESTDEYLSKEQQEQLKNEGFVSG
FT                   DIYEVLATNLPAPKAFGQVGKKEIPNTIEIKMDPTGFDVNRSNHWLLGQKIKSGYPLTD
FT                   DEWAKFCGLSFYLEPESVNFDVIQNKGFSEDGKKTSLSRFFELEAKLYAKDISAEEMQE
FT                   FNEFLKERKAVRIEAIVKEIKRSTNKTLDKFKEEYPEIYKALEISRIEFDNETLAYHNV
FT                   VKPIYWDYEGFLHIYLRHCDELAIEGHFENKTKFQYSYKDIRRILKIAIENLLPQINDR
FT                   LSQGKDFRIYGDKSLYFNGNHYSLHVLENGRIAAFHPLENPQDEAK"
FT   gene            complement(199434..200315)
FT                   /locus_tag="Lbys_0183"
FT   CDS_pept        complement(199434..200315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0183"
FT                   /product="KilA-N, DNA-binding domain"
FT                   /note="InterPro IPR018873; KEGG: ddf:DEFDS_0289
FT                   hypothetical protein; PFAM: KilA-N, DNA-binding domain;
FT                   SPTR: Putative uncharacterized protein; PFAM: ORF6N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15978"
FT                   /db_xref="GOA:E4RTG4"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG4"
FT                   /protein_id="ADQ15978.1"
FT                   /translation="MDNKSIISHEEIRKLIYSIRGKQVMLDSDLASLYQVETKNLNRAV
FT                   KRNIERFPESFCFQLTEEEVENLRFQFGTSSLNHGGRRYLPMVFSESGVAMASAVLRSE
FT                   IAIKVSVEIMEAFVEMRRILISNASLFSRLDKIELKQLEADQKFEEIFKALESDKIHSE
FT                   KGVFYDGQIFDAYTFVADIIRNAGRSIILIDNYVDDTVLTLLGKRGQSVTATIYTKNIS
FT                   NQLQLDLQRYNSQYPSVDIHTFAQAHDRFLIIDGTELYHIGASLKDLGKKWFAFSRMDI
FT                   EVAKMLQFLNGL"
FT   gene            complement(200315..202399)
FT                   /locus_tag="Lbys_0184"
FT   CDS_pept        complement(200315..202399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0184"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="COGs: COG0550 Topoisomerase IA;
FT                   InterProIPR018089:IPR005738:IPR006171:IPR013497:IPR
FT                   000380:IPR006154:IPR003601:IPR003602; KEGG: fjo:Fjoh_3021
FT                   DNA topoisomerase; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain-containing protein; PRIAM:
FT                   DNA topoisomerase; SMART: DNA topoisomerase I DNA-binding;
FT                   DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain-containing protein; SPTR: DNA topoisomerase;
FT                   TIGRFAM: DNA topoisomerase III; PFAM: Toprim domain; DNA
FT                   topoisomerase; TIGRFAM: DNA topoisomerase III, bacteria and
FT                   conjugative plasmid"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15979"
FT                   /db_xref="GOA:E4RTG5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG5"
FT                   /protein_id="ADQ15979.1"
FT                   /translation="MKVVIAEKPSVAREIASLLGASEKKDGYLTGNGYFVTWAFGHLVG
FT                   LGMPEDYGITGFDKASLPILPNPFLLTVRKVKKDKGYTADPGALKQLKVIEQVFNRSDS
FT                   IIVATDAGREGELIFRYIYEYLKCKKPFERLWISSLTEKAIKQGLDNLKSGNEFNGLYQ
FT                   AAQGRSRADWIVGINATQALSIAAGNGIYSLGRVQTPTLALICRRYLENKDYKVKKYWQ
FT                   IQLLHNKEFIDFNSLSKNKWDDQKLAEDTLKSIERATSVTVTSVESKSTTEQPPSLFDL
FT                   TGLQKEANKKLNLSAEETLNIAQSLYEKKFITYPRTGSKYIPEDMWAEIPNLVRALQDR
FT                   ESCKQAVTKMKWGRFNKRIVNDLRVTDHHGLLITDKIPSALSAKENSVYDMIAFRLLEA
FT                   LSQACIKEVTDVSLLALHYDFTAKGVKILEPGWRSIKGSFSDDDIEPVQDLPELKKGDE
FT                   LKIKEASVLEKKTKPPVLYTEAGLLSAMETAGKEIENEDERKALQNIGIGTPATRAAII
FT                   ETLFTRNYIQREKKSLVPTEKGLQVYKLVKDKKIADVAMTAEWELALQKIETGESNAGT
FT                   FQMDIETYATTITQELLQTSIAQTNLPKLTCPKCKSHQLIIRDKIVKCPDEACNWVQFR
FT                   NVCEVQLSIADIESLITKRITALIKGMKSKAGKKFDAYIVLNEKAESSFEFEKNKSHKK
FT                   "
FT   gene            complement(202419..203882)
FT                   /locus_tag="Lbys_0185"
FT   CDS_pept        complement(202419..203882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3022 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15980"
FT                   /db_xref="InterPro:IPR025222"
FT                   /db_xref="InterPro:IPR025343"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG6"
FT                   /protein_id="ADQ15980.1"
FT                   /translation="MSEQTLDKQETPDQLSEILLVLDKDKKKIQAVKSIDENGKMETVD
FT                   PTRKNQNQFMRVDKGGDFFSNFFSNFFSQLKNPTNFSFFKVPAPLAIDTANEMQKQVNN
FT                   PTPEGEQLMKKHEVKAEPQQDQKQVNQNNMETTQATPETGEYRYKPEQIDWETMNNLGL
FT                   NKEKLEKMNLLDPLLKGYKTNELVPVSLNLGTAVTRMDARLSLQANEDGQVVVAIHGIR
FT                   REPNLNFEFFGHKFNEEDKNNLLQTGNMGRVVNLTNPKTGETIPSIISVDRLTNELVAL
FT                   RTDRIKVPDEIKGVKLDDAQKQTLAEGKPLYIEGMISKKGAEFNATVQFNADKRYVEFL
FT                   FDRSNTNQQAQSNGQSNQQSQSQEAPRTFRGKDLDNEQYNKFKDGQTVYLTGLVDKKGK
FT                   EYNGYITLNKETGKTDFSFQNPNKLKEQVKPTEAHKTQTAVNSEGKTNEATKNIKEPLK
FT                   SGQKNPDSKKQQEQQEKPKAPAKSKGVKR"
FT   gene            complement(203967..204275)
FT                   /locus_tag="Lbys_0186"
FT   CDS_pept        complement(203967..204275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3023 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15981"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG7"
FT                   /protein_id="ADQ15981.1"
FT                   /translation="MNIDRMEFIAWMERIMDRLDILGDHIDDLQKKRNSIDGEELLDNQ
FT                   DLLQMLKISNRSLQRYRSIGKLPYYTISGKLYYKLSDVHQFIRESFTAPLPKTNANK"
FT   gene            complement(204303..204656)
FT                   /locus_tag="Lbys_0187"
FT   CDS_pept        complement(204303..204656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT_0109 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15982"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG8"
FT                   /protein_id="ADQ15982.1"
FT                   /translation="MNIITIEEEAWKQLNERIKSINEYVLKLEDTSYDSLWLNNHEVCQ
FT                   YLHISEKTLWRMRNNGDLAYSKIYGQYFYTIGAIKDMLNANAVQTSDEYVKELMEKGKS
FT                   YIEKGRRLKSDKN"
FT   gene            complement(204919..205764)
FT                   /locus_tag="Lbys_0188"
FT   CDS_pept        complement(204919..205764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0188"
FT                   /product="Tetracycline regulation of excision, RteC"
FT                   /note="InterPro IPR018534; KEGG: fjo:Fjoh_3024 hypothetical
FT                   protein; PFAM: Tetracycline regulation of excision, RteC;
FT                   SPTR: Regulatory protein RteC family protein; PFAM: RteC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15983"
FT                   /db_xref="InterPro:IPR018534"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTG9"
FT                   /protein_id="ADQ15983.1"
FT                   /translation="MRHPLNKIVSDIQKEERKLSAETSSFIDEAFKMTVYLQELLRTVK
FT                   EDVIREGFSNREEEMLFFKQIKPNILGKLIYYNKVFRIETACPANNGNMYQSYFAMHLR
FT                   ILKQEYMEHVCNSDFYRYYRSGRTDRDEQYFMLGNINYHDGLNSFVFEIDPKFSTYFDY
FT                   KVSKIIGNELIYTYLTTKINPEQQPDILLQNDETKDIFWTHSKNALIELIYALHASGAI
FT                   SHGKIGIRKISMVFQILFRVSLNDIHNSFHRMKTRSGSRTLFIDQLKSSLDDYMDKEDS
FT                   "
FT   gene            205991..206923
FT                   /locus_tag="Lbys_0189"
FT   CDS_pept        205991..206923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0189"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro
FT                   IPR000005:IPR020449:IPR018060; KEGG: fjo:Fjoh_4441
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15984"
FT                   /db_xref="GOA:E4RTH0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH0"
FT                   /protein_id="ADQ15984.1"
FT                   /translation="MANGNINARTLHELYQQLGLSTDSLQKESGFTIHYLEDTFKNLPF
FT                   RSEPFRPNYFSFLFIKSAFGHYTIDDQRFEVTSNTVYFTNPGNYRIFEWEQLEHTCLIT
FT                   FGEGFLKEYVHDDVYRDFSFLLSEVVSPRVLTQHQFDQVEELCTQIHKEYKGDALYKNK
FT                   IIGALVIALLLKIKEYFFQDYNPIYEGNRSSQIVKNFKLNLERHFRDLISGKINTQLRV
FT                   QDYADLQSLHVNYLSSVISNKTGKPISSWIADKTITEAKVMLQDEALSIKEVAFRLGFL
FT                   ETPHFSNYFKKHTSISPADYRKQYFNSLS"
FT   gene            207020..207760
FT                   /locus_tag="Lbys_0190"
FT   CDS_pept        207020..207760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0190"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198:IPR002347; KEGG:
FT                   cpi:Cpin_0128 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15985"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH1"
FT                   /protein_id="ADQ15985.1"
FT                   /translation="MSTLNNKVILVTGASRGIGAEVAQRLATAGAKVIVNYAGGKDAVD
FT                   QVVSSIKEQGGDAIALQADVSNADAVKQLFDNAINHYGRIDVLVNNAGIMITKLIKDTT
FT                   DEDFSRQFDINVKGVFNTLREASTRLADNGSIINFSTSVNRLMLPTYGTYVATKSAVEQ
FT                   LTRVFAKEVGSRGINVNSVSPGPTNTELFTNGKSQEVIDRLASFSAFNRIGEPQDIAKV
FT                   IVFLASDEAKWVSAQNIGVNGAMA"
FT   gene            207795..208268
FT                   /locus_tag="Lbys_0191"
FT   CDS_pept        207795..208268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_4445 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1097)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15986"
FT                   /db_xref="GOA:E4RTH2"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH2"
FT                   /protein_id="ADQ15986.1"
FT                   /translation="MKTLPIAIAFGLFGAIAVTVSFSQQWPTWVMFVAWVSFYLFGKTW
FT                   QSSLWVFLQIVLGMCMAVLIQLTAGLLGQLIGAFGFAASVFLYIGSLAYIARTRKLNNI
FT                   PAWFLGLIILFGVHPPLEPLPILQILIPIIAGFVFAWLNNLVVEKIHARQSQQ"
FT   sig_peptide     207795..207863
FT                   /locus_tag="Lbys_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            208302..209054
FT                   /locus_tag="Lbys_0192"
FT   CDS_pept        208302..209054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0192"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198:IPR002347; KEGG:
FT                   cpi:Cpin_0127 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15987"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH3"
FT                   /protein_id="ADQ15987.1"
FT                   /translation="MNSLKNKVAIITGSGRGLGKAIAERYAALGADVVLNYSRDKASAD
FT                   EVESNIKAMGAKVISVQADVSKVDDIKRLFEEAKKAFGKIDIVVANAGIEMVETPVTEF
FT                   TEEQFDRLFSINTKGAYFTMQQAALNVEDNGRIIYVASSTTVFPVPGMAVYGGSKTTPR
FT                   YLVNVLSQEIAHRGVTVNTIVPFAVDHSGIFAEEGSYPELRKSLIDSCPMGRLAEVEDV
FT                   ANIAEFFASDLSSFVNGQHLVVNGGANQ"
FT   sig_peptide     208302..208370
FT                   /locus_tag="Lbys_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209147..209266
FT                   /pseudo
FT                   /locus_tag="Lbys_0193"
FT   gene            209390..210364
FT                   /locus_tag="Lbys_0194"
FT   CDS_pept        209390..210364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0194"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase; InterPro IPR013154:IPR013149;
FT                   KEGG: cpi:Cpin_4859 alcohol dehydrogenase zinc-binding
FT                   domain protein; PFAM: Alcohol dehydrogenase zinc-binding
FT                   domain protein; Alcohol dehydrogenase GroES domain protein;
FT                   SPTR: Possible NADPH:quinone reductase; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15988"
FT                   /db_xref="GOA:E4RTH4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH4"
FT                   /protein_id="ADQ15988.1"
FT                   /translation="MKAIVLKEFGSAENLQIAEIPTPEIAGNEVLIQVKAFGINPLDAH
FT                   VRAIPDWWKLVSGSAVTEPYVILGWDVSGVVTKVGKAVTRFKEGDAVYGLIRFLGAGNG
FT                   YAEYVSAPETDLSLKPDNISFEEAAAATMAVQTAWVSLVHYGKIKKGDKVVITGASGGV
FT                   GHYAVQIAKNFGAYVVAVSSGENKDWVLSLGADEYIDYKTQNFEEIIKDADLVHDAVWS
FT                   EDETHLARSLNALKPGGTLLSLMVFPSVDFIKAAKEQKNITVVRANLSDTPDKQADIEA
FT                   INALLSAGKIKSHVSQVFPMEDTYKAHLQIETHSTVGKLVVVP"
FT   gene            210488..211297
FT                   /locus_tag="Lbys_0195"
FT   CDS_pept        210488..211297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0195"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro IPR018060; KEGG:
FT                   cpi:Cpin_5386 transcriptional regulator, AraC family;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15989"
FT                   /db_xref="GOA:E4RTH5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH5"
FT                   /protein_id="ADQ15989.1"
FT                   /translation="MAVQTKNDFNEIVCSVTEEKYYKDDLFFDYHSFVRVLSGEMKVIQ
FT                   ADKTYVFGSGSTFLYPRNQLCTVIKYPLDGRPYRSIVMTLKPQRLEDFYKKQNVKSGES
FT                   SSPKIKEFYPNPLLDSLFDSLLPYFRLNNQLPENLTTLKIEEAISVLRAIDKDVDGILA
FT                   DFSQPGKINLFDFMQKNYMFNLSLEKFSYLTGRSLSAFNRDFRSTFHSSPQKWLTQKRL
FT                   ELAQQRIREEKIKPVDVYVEVGFENLSHFSYAFKKQFGYAPSEIPSL"
FT   gene            211522..212391
FT                   /locus_tag="Lbys_0196"
FT   CDS_pept        211522..212391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0196"
FT                   /product="NmrA family protein"
FT                   /note="COGs: COG0702 nucleoside-diphosphate-sugar
FT                   epimerase; KEGG: sli:Slin_1587 NmrA family protein; SPTR:
FT                   NmrA family protein; PFAM: NmrA-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15990"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH6"
FT                   /protein_id="ADQ15990.1"
FT                   /translation="MKKIAIIGATGMLGEPVTKAFINEGFDVSLLVRNVNKAKQIFPSN
FT                   VRLVQGDLRDIESIGQFLSEQEGLYLNLSVKQNSGKSDFQPEREGLDHVLQIAKNNTTV
FT                   TRIGYLSSLIHLYQGQNGFDWWAFDLKQEAVSKIKNSGLPYSIFYPSTFMENYDKGSYR
FT                   QGKNIVLAGTSKYKMYLISGNDYARQVVKTFQRDNGNNEYVIQGKEGFTADEAAKVFVE
FT                   NYTKEKLKIMKAPMALMSFMGLFSNKFNYGAKIVDALNNYPEKFEAEKTWLDLGEPQTK
FT                   FIDYIQNV"
FT   gene            complement(212452..213372)
FT                   /locus_tag="Lbys_0197"
FT   CDS_pept        complement(212452..213372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0197"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG4977 Transcriptional regulator containing
FT                   an amidase domain and an AraC-type DNA-binding HTH domain;
FT                   InterPro IPR000005:IPR018060; KEGG: fjo:Fjoh_2324
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR:
FT                   Helix-turn-helix-domain containing protein, AraC type;
FT                   PFAM: Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15991"
FT                   /db_xref="GOA:E4RTH7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH7"
FT                   /protein_id="ADQ15991.1"
FT                   /translation="MKKQEQIFQTVNSVKAYHELLQLEKPEHPMVSIIDFSKVKYNNPM
FT                   PGTSVILNLYCISIKQGPDCVLRYGPKTYDFNEGVMSFFKPGQVISVAEQSENVTDGYM
FT                   LTFHPDFIQSFALSNKIKKYSFFDYSVTEALFLSENEKTHMREIMAGIEREYHTNIDGF
FT                   SQEAIVSYIDLLLVYGNRYYNRQFITRKLQSDDLSTRFEQLLDEYFSKEDALVKGLPSV
FT                   QYFANRLHLSANYLGEMLRVSTGQSAQHHIQNKVIEMAKTLLSTTRLSVAEIAYQLGFE
FT                   RPQSLNRLFKSKTTLSPLEYRASFN"
FT   gene            complement(213471..214457)
FT                   /locus_tag="Lbys_0198"
FT   CDS_pept        complement(213471..214457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0198"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395:IPR020471;
FT                   KEGG: sli:Slin_1860 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15992"
FT                   /db_xref="GOA:E4RTH8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH8"
FT                   /protein_id="ADQ15992.1"
FT                   /translation="MRTKNLGKQGLEIPLVGLGCMGMSPSINVNTYGRANEKESIATIH
FT                   RSLELGGNFLDTADLYGPLLNERLVGKAIKGNRDKYIIATKFGFEIDDNEQLTWRINGK
FT                   PEYVKKAVERSLKNLGTDHIDLYYLHRPDPEVPIEETVGTMGELVKEGKVKYIGISEVT
FT                   AEQIKKAYEAFPITAVQNEYSLFERAAEEDGVYDTTKELGIGLVAYSPLGRGFLTGQIK
FT                   SPDDFDADDFRRSIPRFQGEQFYKNIELVNEINKLATEKGVNSTQLAIAWIIAKGITPI
FT                   PGTKKVKYVEQNIAAAEISLTDDDMNRIDAIIPVGAETGDRNIHQSF"
FT   gene            214485..214994
FT                   /locus_tag="Lbys_0199"
FT   CDS_pept        214485..214994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0199"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG4977 Transcriptional regulator containing
FT                   an amidase domain and an AraC-type DNA-binding HTH domain;
FT                   InterPro IPR018062:IPR000005:IPR020449:IPR018060; KEGG:
FT                   cpi:Cpin_4585 transcriptional regulator, AraC family; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15993"
FT                   /db_xref="GOA:E4RTH9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTH9"
FT                   /protein_id="ADQ15993.1"
FT                   /translation="MLIDNAKLSDRISRNVAELPGFVSTFRNLHKNIDAGLIKIKMLEL
FT                   LYDLAGTDKNLLQQLLQMKQPVRTEIPEVMEKNYTSPVSLTELAYLSGRSLASFKRDFQ
FT                   AIYNMAPSQWIRNKRLDKAKEVLENTSMAVSDICYTLGFENPAHFSRIFKEHFGYPPSN
FT                   LRQQQA"
FT   gene            complement(215092..215814)
FT                   /locus_tag="Lbys_0200"
FT   CDS_pept        complement(215092..215814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0200"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="COGs: COG1359 conserved hypothetical protein;
FT                   InterPro IPR007138; KEGG: pat:Patl_3536 antibiotic
FT                   biosynthesis monooxygenase; PFAM: Antibiotic biosynthesis
FT                   monooxygenase; SPTR: Antibiotic biosynthesis monooxygenase;
FT                   PFAM: Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15994"
FT                   /db_xref="GOA:E4RTI0"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTI0"
FT                   /protein_id="ADQ15994.1"
FT                   /translation="MKKSNLWNKIIPIIIITFMTNFNIASAQNVSEERITMLVTFNVKV
FT                   EQKEALRKALIADKNGALNEKGNISMELFEHKDKPNTFYLFERWDNQKSLDEHFTKKYA
FT                   KDVLELNKVALTKPMQILYLHDVSPLPKNEIKNPLSSDTPVDLVVIFKVKDGMQETFIN
FT                   QFQKSIVNSRPEQGNIEFFFHTVPGDNTKFVLYERWRSQAAIDFHFAQPYTKELFEMFK
FT                   SALEQPIEEYLNFITEIK"
FT   sig_peptide     complement(215734..215814)
FT                   /locus_tag="Lbys_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(215874..216722)
FT                   /locus_tag="Lbys_0201"
FT   CDS_pept        complement(215874..216722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0201"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro
FT                   IPR020904:IPR002198:IPR002347; KEGG: cpi:Cpin_3798
FT                   short-chain dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15995"
FT                   /db_xref="GOA:E4RTI1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RTI1"
FT                   /protein_id="ADQ15995.1"
FT                   /translation="MKKQKVWLVTGASRGFGLEIVKAALDAGDKVVATVRSNPEKLQAQ
FT                   LNNENLFVTVLDVTNEPQAKEVANLSTEKFGRIDVLVNNAGFGLLSAVEEASNTEVKAN
FT                   YEANVFGLLNVTRGVLPFMRKERKGHIINLSSVGGLTGIIGWGLYGSTKFAVEGITEAL
FT                   SKELAPLGIYATAVEPGFFRTDFLDQSSLTRSANSIEDYAETVGDMRSYATQVNQKQPG
FT                   SAEKLAQAILKIADAEKPPVHLPLGKDTLQLFKEKMDKFNADIEAWHEVITGTDHDDVV
FT                   A"
FT   sig_peptide     complement(216654..216722)
FT                   /locus_tag="Lbys_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(216835..217854)
FT                   /locus_tag="Lbys_0202"
FT   CDS_pept        complement(216835..217854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0202"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395; KEGG:
FT                   dfe:Dfer_4686 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Putative oxidoreductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15996"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU15"
FT                   /protein_id="ADQ15996.1"
FT                   /translation="MKYNYVGNTGLLVSELCFGTMTFGGQNAGMWENIGKLQQNEVNEL
FT                   MKSVIEAGINFIDTANVYSFGQSELLLGQSLKDLAVPRDQMVIATKVMGIMDDSPNGRG
FT                   LSRYHIFNSVDASLKRLQLDHIDILYVHGVDFKTDLEDIVRSLNDVVETGKVRYIAICN
FT                   WPAWMVAKAQAIAHYNGWHKFIGLQYHYAAVTRDIEHELVPLAQDHNLAIFPWSPLAGG
FT                   FLSGKFTRNQSSEGSRRANFDFPPVNKEKAYDLVDVMKEIGQQYDATVAQVALAWVRQQ
FT                   PGITSTIIGAKSINQLKDNIQSVTINLSAEDLKKIDAISPLPLQYPGWMVQSQRAYRI"
FT   sig_peptide     complement(217771..217854)
FT                   /locus_tag="Lbys_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(217925..218347)
FT                   /locus_tag="Lbys_0203"
FT   CDS_pept        complement(217925..218347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_0125 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15997"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU16"
FT                   /protein_id="ADQ15997.1"
FT                   /translation="MKRIMITGILSLTTFLFATGQTKMIPSLNNQKKEKMDTTILKNTI
FT                   VKKAIDALQAADRQTWFSMFTIEAELYDDGNKMDFKTFFDIGHERFTSIDKVENNGLNV
FT                   YGKFHSDKWGDFKTYFRFHINDKDKIERLDVGQADY"
FT   sig_peptide     complement(218288..218347)
FT                   /locus_tag="Lbys_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(218344..218748)
FT                   /locus_tag="Lbys_0204"
FT   CDS_pept        complement(218344..218748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0204"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR017871; KEGG: cpi:Cpin_0126 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15998"
FT                   /db_xref="GOA:E4RU17"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU17"
FT                   /protein_id="ADQ15998.1"
FT                   /translation="MKRTSFPLIAANFICNHTMKIFIIISMLFVVAIGIRQGWSMLNAQ
FT                   PEMVALFNKFNYDTAHVQVYGMLTIMSSLLIIFPQTYSLGNSVMATMILFIAILQVSIH
FT                   QYLKAMIEIPLLLLNVLLIYLKYPFKSLLL"
FT   sig_peptide     complement(218647..218748)
FT                   /locus_tag="Lbys_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(218946..219710)
FT                   /locus_tag="Lbys_0205"
FT   CDS_pept        complement(218946..219710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0205"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR020904:IPR002198:IPR002347;
FT                   KEGG: cgt:cgR_0065 hypothetical protein; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Putative uncharacterized
FT                   protein; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ15999"
FT                   /db_xref="GOA:E4RU18"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU18"
FT                   /protein_id="ADQ15999.1"
FT                   /translation="MNTENIAEKFTAKTVEGKTVIVTGAANGIGRAEAELLALSGANVV
FT                   FTDLDDSKGQEAIKPFGKKAVYFHHDVTKPSDWKNVLEQTIKLFGRIDGLVNNAGIYLP
FT                   GSIEEVTEETLERQISVNQKGTFWGIQYAAEAMKKTGGSIVNTSSICGIRGLAGCIIYN
FT                   STKWAIRGITKTAASELGQYKIRVNAVLPGFVETNIISVNAPQMNEQAARDAVLGRLGQ
FT                   PEDIAYLVRYLVSDESSFVTGSDFLIDGGWTL"
FT   sig_peptide     complement(219609..219710)
FT                   /locus_tag="Lbys_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(219774..220823)
FT                   /locus_tag="Lbys_0206"
FT   CDS_pept        complement(219774..220823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0206"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR000634:IPR001395;
FT                   KEGG: pmy:Pmen_3155 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16000"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU19"
FT                   /protein_id="ADQ16000.1"
FT                   /translation="MEYKALGNTGLLVSQLCLGTMTMGSGSGVYSHIGDVGQADANNLI
FT                   KAALEAGINFFDTADVYSSGESEKTLGQAFKDLGILRKDVVLATKFYSRIGPGRNDVGA
FT                   SRKHIMDAIESSLKNLQTDYIDLYQIHANDVLTPTDEILRTLDDLVTQGKVRYIGCSNW
FT                   QAWKLAQSLGTSALKNTVRFESLQAYYSIAGRDLEREIVPLLENEKLGLLVWSPLAGGL
FT                   LSGKFSRENQKPEGSRRTTFDFPIVDKERTWNILDVIFPIAEKYNCSAARVALAWLLSK
FT                   PVVTSVIVGAKREEQLQDNIAATKLKLTDEEIKQLDAVSELPAEYPGWMLATQGADRLG
FT                   EVDLWSDRS"
FT   sig_peptide     complement(220752..220823)
FT                   /locus_tag="Lbys_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(220876..222024)
FT                   /locus_tag="Lbys_0207"
FT   CDS_pept        complement(220876..222024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0207"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="COGs: COG1902 NADH:flavin oxidoreductase Old Yellow
FT                   Enzyme family; InterPro IPR001155; KEGG: dze:Dd1591_2284
FT                   NADH:flavin oxidoreductase/NADH oxidase; PFAM: NADH:flavin
FT                   oxidoreductase/NADH oxidase; SPTR: NADH:flavin
FT                   oxidoreductase/NADH oxidase; PFAM: NADH:flavin
FT                   oxidoreductase / NADH oxidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16001"
FT                   /db_xref="GOA:E4RU20"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU20"
FT                   /protein_id="ADQ16001.1"
FT                   /translation="MKQYKKLLEPFQLTKGIQIKNRITMAPMTTWAGNDDFTIADEEVE
FT                   WYKARVKGVGLVITGCTHVTPEGIGFTHEFAGYDDSFIPSLKKLADVAKSGGAPAILQV
FT                   FHAGNKAVTDLIPSRDVVSASAIKSEVTPFTPADLLTPRALKENEIWDIIKAFGATARR
FT                   AIAAGFDGIEIHGAHGFLNQNFLSPMFNQRTDQWGGSIDNRLRFSTEVVREVRRVIAKY
FT                   ANRPFALGFRISPEELPKEGLRLPDSLALVDRLIQEQVDYLHFSLFQVLTQKPLDSDTS
FT                   KTITEVLTSYVNKRVPVIAAGQVTTPTEADQALSLGLDLVAIGRSIVVNPKWAQWANEG
FT                   KEDQITMILDTERAADKKIPEKLMAIVHYAKGWIKTTEEVTA"
FT   gene            222093..222380
FT                   /locus_tag="Lbys_0208"
FT   CDS_pept        222093..222380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmy:Bm1_10115 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16002"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU21"
FT                   /protein_id="ADQ16002.1"
FT                   /translation="MQISNTPSDTKISSTIVLENNLDSLQEKRRDRLIIENSLFFYYSI
FT                   NEFNRYVSKLEKRDAVIARTPFIDEMKNALVLKNFPFCHSVLEIDSFTFY"
FT   gene            complement(222315..222866)
FT                   /locus_tag="Lbys_0209"
FT   CDS_pept        complement(222315..222866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0209"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR002563; KEGG: sme:SMa0322 hypothetical protein;
FT                   PFAM: flavin reductase domain protein FMN-binding; SPTR:
FT                   Putative uncharacterized protein; PFAM: Flavin reductase
FT                   like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16003"
FT                   /db_xref="GOA:E4RU22"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU22"
FT                   /protein_id="ADQ16003.1"
FT                   /translation="METYPVDKIYRQIEPGSVLLVSTQNKGVPNVMTMGFQMMIQHDPP
FT                   LIGAIVGPWDYSYKALVKNKECVLSIPGIDIIEKVVDIGNCSGDSDNKFEKFNLTVTPA
FT                   SIVQAPMIEDCLFNIECKVVNTELVDRYNLFVLEAVAAWKNADKDKIKPFHHHGNGIFS
FT                   VEGKTINLQDRMTKWKIFQD"
FT   gene            complement(222924..223955)
FT                   /locus_tag="Lbys_0210"
FT   CDS_pept        complement(222924..223955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0210"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase; InterPro IPR013154:IPR013149;
FT                   KEGG: epy:EpC_25070 putative alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; SPTR: Alcohol
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES-like
FT                   domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16004"
FT                   /db_xref="GOA:E4RU23"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU23"
FT                   /protein_id="ADQ16004.1"
FT                   /translation="MLEKSIAMKAWQLHAFGLENLTLDEVAVPTPGPNDILIKVGAVSL
FT                   NFRDKAIVDGIYEPEMIPKPLIPVSDAAGTVVEIGANVTRFKVGDRVTSHLYSKWIDGQ
FT                   PAPNEPDFCFGAPLPGGLAQYMLIHEESAVNVPSYLTDEEASTLPIAALTAWFSLVTYG
FT                   NLKAGETVLIQGTGGVSIFGIQIANALGAKVIVTTSSDQKGIKARELGAQEIINYVKTA
FT                   DWAAEVTKLTNGQGADHLLEVVGGEGLNHSVLATRVGGHISLIGFLTGQKTNLDLMPVI
FT                   FRQTNIQGIAVGHRAAFEEMNKAFAQHHIKPVIDTIYNFEDAVKAYEHLDRGAFGKIVI
FT                   RVS"
FT   gene            complement(224052..224957)
FT                   /locus_tag="Lbys_0211"
FT   CDS_pept        complement(224052..224957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0211"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro IPR000005:IPR018060;
FT                   KEGG: cpi:Cpin_5575 transcriptional regulator, AraC family;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; SPTR:
FT                   Transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16005"
FT                   /db_xref="GOA:E4RU24"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU24"
FT                   /protein_id="ADQ16005.1"
FT                   /translation="MERVTQAQQFFDDKLIWMPDHLQREIGQFNVFPIYSTPTNKINCQ
FT                   PYNRKGFYKISLLKGRTKFSYADKGLEFKDSALLFSNPNIPYSWELLDEEQTGYFCVFT
FT                   EGFFNHFGNINDYPVFKPGNIPLFELNEEQEEQIGIIFKKMIAEIESDYFYKYDAIRAL
FT                   VFELIHLALKLTPIKSNPVDDSNASLRITSLFTELLERQFPIESPRQQIKLRHPIEFAD
FT                   NLSVHVNHLNRSLKKVTGKTTSQFISERIMQEARSLLQHTDWNISEISWCLGFEELPHF
FT                   INFFKKAETSTPKHYRNSHL"
FT   gene            complement(224975..225676)
FT                   /locus_tag="Lbys_0212"
FT   CDS_pept        complement(224975..225676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0212"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR020904:IPR002198:IPR002347;
FT                   KEGG: bld:BLi02171 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   SPTR: Oxidoreductase, short-chain dehydrogenase/reductase
FT                   family; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16006"
FT                   /db_xref="GOA:E4RU25"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU25"
FT                   /protein_id="ADQ16006.1"
FT                   /translation="MELNNVKAVVTGGTSGIGYEAAKVLNELGAEVVICGTNEFKVDKA
FT                   SKELGVYGLKANVMIEEEVVALFDYAKETMGTVNVLINNAGIGKFASLVETTVEDFQKV
FT                   WEVNVRGLFLSGREAAKHFMEKRYGNIINIGSTASLRGYANGSSYVASKFAVSGLTECW
FT                   RAELRPYNVRVMQINPSEVITDFLIKEGREITNEANKLKPKEIAHLIVNMLSMSDIGFI
FT                   PDASVWATNPW"
FT   gene            225982..226821
FT                   /locus_tag="Lbys_0213"
FT   CDS_pept        225982..226821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0213"
FT                   /product="Tetracycline regulation of excision, RteC"
FT                   /note="InterPro IPR018534; KEGG: fjo:Fjoh_4473 hypothetical
FT                   protein; PFAM: Tetracycline regulation of excision, RteC;
FT                   SPTR: Regulatory protein; PFAM: RteC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16007"
FT                   /db_xref="InterPro:IPR018534"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU26"
FT                   /protein_id="ADQ16007.1"
FT                   /translation="MKNSLKKILADTENKLLAIHTQNENAVNVSVLSIEIITQSLIELK
FT                   QFVINHGFRSEIEEINFFKNVKPSLVSKFIYYNTILHFEAKKDKLTNKCFKKSLQKELK
FT                   RIKHFSIDNWEFYKYYKMNDTFYDKEYFLRESHKADFIFFDHFFEIDQSFSTTHDYKIS
FT                   RIIANDLIQVYLTDQILRLKQSSLKDSVVEQLNLDWTESKAALIELIYALHSRSVFNNG
FT                   NIEIKWIAKSFEKMLNIELGDLYHTYLEIRNRKINQTKFLDTLKYSLIKKMEEQDEK"
FT   gene            complement(226949..227230)
FT                   /pseudo
FT                   /locus_tag="Lbys_0214"
FT   gene            complement(227614..229824)
FT                   /locus_tag="Lbys_0215"
FT   CDS_pept        complement(227614..229824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0215"
FT                   /product="peptidase S9B dipeptidylpeptidase IV domain
FT                   protein"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; InterPro IPR002469;
FT                   KEGG: zpr:ZPR_1379 prolyl oligopeptidase family; PFAM:
FT                   peptidase S9B dipeptidylpeptidase IV domain protein; SPTR:
FT                   Prolyl oligopeptidase family; PFAM: Prolyl oligopeptidase
FT                   family; Dipeptidyl peptidase IV (DPP IV) N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16008"
FT                   /db_xref="GOA:E4RU27"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU27"
FT                   /protein_id="ADQ16008.1"
FT                   /translation="MKRLFVIMLALSYWTVQGQTMAHYYQKAAEYPNLIKDKVFYSPQN
FT                   ITWNEDLFWYVQQTPNGKEYLRVDTKQKSKRTLFDHQFLAHMLSKATGQKVKADSLPLS
FT                   NLQIIKNPDFISFEAFGKKWEYTNDTGHLTDKGQIPSRGPQSYWNNRYDDSQGAPVYSP
FT                   DSQYVALIRNNNVYVHPNGQPQQLQQLSFDGAPGEYYSAFLVWSPDAKKLAATKVRKVE
FT                   NRTLYFIESSPATQLQPILHTRNYPKPGDALPQHQPVLFNIETGKSYSVPYDLVLNQYS
FT                   LSRPKWTKDSKAFTFEYNQRGHQKYQVFELHAETGLTRALITEESPTFIDYSGKKYRYD
FT                   LENEIIWASERDGWNHLYLYDRASGQVKNQITKGEWVVRRVVHVNEKERYIIFEGSGKD
FT                   TDPYLIHYYKVNLDGSGLVDLTPESANHKAFFNKDHSLLVDTYSRIDLPQITVLRETAT
FT                   GKVIMELEKADISELKKAGWRPSEVFTAKGRDGKTDIWGIITFPTHYDPKKKYPIIENI
FT                   YAGPHSSFVPKSFSSNPSWMGELAELGFIVVQIDGMGTSNRSKAFHDVAWKNLKDAGFP
FT                   DRIAWIKAAAKKYPAMDISRVGIYGTSAGGQNAAGALIFHPEFYKVAVSSCGCHDNRMD
FT                   KIWWNEQWMGYPIGPHYEECSNVVNAHKLEGKLLLMVGEVDDNVDPASTYQLVDALIKA
FT                   NKDHDFVLLPGQGHTAGGKYGEQKRRDFFVRHLLGQTPPTWK"
FT   sig_peptide     complement(229759..229824)
FT                   /locus_tag="Lbys_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(229821..230687)
FT                   /locus_tag="Lbys_0216"
FT   CDS_pept        complement(229821..230687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0216"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR018062:IPR013096:IPR000005:IPR020449:IPR 018060;
FT                   KEGG: cpi:Cpin_5587 transcriptional regulator, AraC family;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; Cupin 2 conserved barrel domain protein; SMART:
FT                   Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator, AraC family; PFAM: Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family; AraC-like ligand
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16009"
FT                   /db_xref="GOA:E4RU28"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU28"
FT                   /protein_id="ADQ16009.1"
FT                   /translation="MKPLQFTIPVTPDKSVLVQEDRIPHFYPYLHRHKEAQLIWVRKGS
FT                   GTLIVDNNFHDFTDGDIFLIAPQQSHVFRSNSGEPEEGIHTLSVFYDPDGSLNALLNLP
FT                   ELRPFHGFIKEYRGGFKVPHEHVAHISKRMLKIQKATHTDQIIHFLHLLRAFCKMEPKP
FT                   VQLAPLNNEIISEGEGLRMGKIYNYVLKNYKNPLTLDDVAAAAHLTPQAFCRYFKKHTG
FT                   VTFVTFLNELRVTEACKNLTSGKFDNISSVAYSCGFNSIANFNRVFKNVAGTSPKDYLT
FT                   KYLKNVS"
FT   gene            complement(230917..231618)
FT                   /locus_tag="Lbys_0217"
FT   CDS_pept        complement(230917..231618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0217"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="COGs: COG0813 Purine-nucleoside phosphorylase;
FT                   InterPro IPR004402:IPR000845; KEGG: gym:GYMC10_5646 purine
FT                   nucleoside phosphorylase; PFAM: purine or other
FT                   phosphorylase family 1; SPTR: Purine nucleoside
FT                   phosphorylase deoD-type; TIGRFAM: purine nucleoside
FT                   phosphorylase; PFAM: Phosphorylase superfamily; TIGRFAM:
FT                   purine-nucleoside phosphorylase, family 1 (deoD)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16010"
FT                   /db_xref="GOA:E4RU29"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU29"
FT                   /protein_id="ADQ16010.1"
FT                   /translation="MRSIHLEAEVGEIAETVLLPGDPLRAKFVAENYLTEVKCYNKVRN
FT                   MFGFTGLYKGERVSIQGTGMGMGSAGIYIHELINTYQCKNLIRVGTCGSIQENLDLGQV
FT                   LLVTAACGDSDANSILFQNQHFAPTASFELLLKAHESAKEQNIKVHPGLVFSTNTFYDL
FT                   VPNRWDVWKAHGVLGIDMETEILYTMAARFGVNALSLLTVSDNILTGQASSQEEREKTY
FT                   NEMMEIALSLI"
FT   gene            complement(231631..233973)
FT                   /locus_tag="Lbys_0218"
FT   CDS_pept        complement(231631..233973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0218"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016160:IPR015590:IPR011408; KEGG: fba:FIC_01836
FT                   aldehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase; SPTR:
FT                   Aldehyde dehydrogenase; PFAM: Aldehyde dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16011"
FT                   /db_xref="GOA:E4RU30"
FT                   /db_xref="InterPro:IPR011408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU30"
FT                   /protein_id="ADQ16011.1"
FT                   /translation="MNVKDIFLTMEYGPAPESDKNAQEFLDQHDRRFGLFINGEWTEGE
FT                   NHFPSLNPATGETLAQISEASTAQVEAAVAAAKSAYPSWSQLSGHERAKYLYALARQIQ
FT                   KHSRLFAVLETLDNGKPIRETRDIDIPLVARHFYHHAGWAQVMEQEFPNFESIGVIGQI
FT                   VPWNFPLLMLSWKIAPALAMGNTLVLKPAEQTSLTALLFAEICQEIGLPKGVVNIITGH
FT                   GSVGEALTLHPDVQKIAFTGSTEVGKKIRRNTAGSSKKLSLELGGKSPFIVFEDADLDS
FT                   TVEGIVDAIWFNQGQVCCAGSRLLVQESIAEKFYAKIKNRIQKLVLGSPLDKGIDMGAL
FT                   VSEEQWNTVNGFVERAKAEGLEYWQVENCPTKGCYFPPTLFPYVSPASEIAQEEIFGPV
FT                   LVGMTFRSHQEAIKLANNTRYGLAASLWTENINLALDVAPQIKAGTVWINTTNVFDAAS
FT                   GFGGYRESGFGREGGKEGLYEYIKPKSIKSSTGFTIHNKEVNLRSYIDRTPKMYIGGKQ
FT                   ARPDSGYSIKVSNPAGQTVGEVGEGTRKDIRNAVEAAHAQSGWAGMTGHARAQVLYFIA
FT                   ENLSARAEEFEQRLVEASGYSGKDAKLEVEKSLERIFTYAAYADKFDGRVHSTTSRHVT
FT                   IAMHEPVGILGVVCPKEYPLLGMISLVLPAIAMGNRVIVLPSETSPLSTTDFYQILDTS
FT                   DVPGGTVNIITGDHKSLTTELAKHFDVDGIWYFSDKQNAETLEKLAADSMKRTWIESEY
FT                   DWLQNPLQKVFLRKATEVKNIWIPYGA"
FT   gene            complement(233980..234933)
FT                   /locus_tag="Lbys_0219"
FT   CDS_pept        complement(233980..234933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0219"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="COGs: COG0274 Deoxyribose-phosphate aldolase;
FT                   InterPro IPR011343:IPR002915; KEGG: fba:FIC_01837
FT                   deoxyribose-phosphate aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Deoxyribose-phosphate aldolase; SPTR:
FT                   Deoxyribose-phosphate aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase; PFAM: DeoC/LacD family
FT                   aldolase; TIGRFAM: deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16012"
FT                   /db_xref="GOA:E4RU31"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU31"
FT                   /protein_id="ADQ16012.1"
FT                   /translation="MSSEHIRNEGIPYSTEYFDHININRSAVERRASSLPARRTVKKEY
FT                   QAAWLLKAVNCIDLTTLSGDDTAGNVYRLCQKALQPVRQDILQALGFEDLTVGAVCVYH
FT                   NMISDAKKALGSSSLPIAAVSTGFPAGKIPLEQKLQEIKASVAAGATEIDIVISRELVL
FT                   NNKWEELYEEVKACREACGEAHMKTILATGEIPTLTKVAKASWVSMMAGSDFIKTSTGK
FT                   EAVNATLPVSLVMVRAIREFYELTGVKVGYKPAGGIQKAKQALDFLILIKEELGVEWLN
FT                   NQLFRFGASSLLGDIERQLEHYVTGSYSASYRHAMA"
FT   gene            235143..235670
FT                   /locus_tag="Lbys_0220"
FT   CDS_pept        235143..235670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_3756 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16013"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU32"
FT                   /protein_id="ADQ16013.1"
FT                   /translation="MKKIISSLLFALLTFSVSTVSAQFEKGDKLLNAGINLGGTYGGGG
FT                   VGVGGSFEVGIHDFISVGGQADFVTWNYGWTGYKWKYNFLTIAARGSYHFGKHFLTMDN
FT                   LDLYAGPSLGYRVSSYKSPDGFGGIYSDSYGSGVFFGVFAGARYYFNPGMGVFAEVGHN
FT                   ASPLKAGITFKF"
FT   sig_peptide     235143..235208
FT                   /locus_tag="Lbys_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(235731..236891)
FT                   /locus_tag="Lbys_0221"
FT   CDS_pept        complement(235731..236891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0221"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="COGs: COG1015 Phosphopentomutase; InterPro
FT                   IPR010045:IPR006124; KEGG: tte:TTE0463 phosphopentomutase;
FT                   PFAM: metalloenzyme domain protein; PRIAM:
FT                   Phosphopentomutase; SPTR: Phosphopentomutase; TIGRFAM:
FT                   phosphopentomutase; PFAM: Metalloenzyme superfamily;
FT                   TIGRFAM: phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16014"
FT                   /db_xref="GOA:E4RU33"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU33"
FT                   /protein_id="ADQ16014.1"
FT                   /translation="MKRVILIVLDSVGIGELPDAHLYGDTGSNTLGHIVERFPDIKIPH
FT                   LTALGLGNIVPENALPKTDAPQAAYGRAKEKSAGKDTTTGHWEISGCVLDKPFPTFEQF
FT                   PKAFMDAFEAAIGTKTIGNYSASGTAIINELGDEHVRTGFPIVYTSADSVFQVAMHEEI
FT                   IPVERQYEICAIAREMLSGELEVGRVIARPFLGTSGQYYRTKNRKDYATLPPHTVLDAI
FT                   STEGKGVYAIGKIVDIFAGKGISRYQKTKNNQEGVEKTLEALQSASEAFIFTNLVDFDM
FT                   EYGHRRDVQGYAKALEEFDAALPALMGAMKEEDLLIITADHGNDPTAPGTDHTREHIPI
FT                   LVVGKDVKKGNHLGTLECFADIAATVAEYLEVPYSTSGISFLPKVL"
FT   gene            236966..237295
FT                   /locus_tag="Lbys_0222"
FT   CDS_pept        236966..237295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_3024 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16015"
FT                   /db_xref="GOA:E4RU34"
FT                   /db_xref="InterPro:IPR029377"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU34"
FT                   /protein_id="ADQ16015.1"
FT                   /translation="MKYLMYFLVLLYVLCAIVQYNDPDPLVWILAYLLPAYLCFYRSKG
FT                   KGDATLYLALGLLYVLWAINQFPPQWEGLMFENLSMKTINVELGRESLGLGLCAIGMFL
FT                   CAIKK"
FT   sig_peptide     236966..237010
FT                   /locus_tag="Lbys_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(237320..240163)
FT                   /locus_tag="Lbys_0223"
FT   CDS_pept        complement(237320..240163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0223"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ);
FT                   InterProIPR005479:IPR006275:IPR005481:IPR005480:IPR
FT                   005483:IPR011761; KEGG: dfe:Dfer_2476 carbamoyl phosphate
FT                   synthase large subunit; PFAM: Carbamoyl-phosphate synthase
FT                   L chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; SPTR: Carbamoyl-phosphate synthase,
FT                   large subunit; TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain, ATP
FT                   binding domain; Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation domain; Carbamoyl-phosphate synthase L
FT                   chain, N-terminal domain; TIGRFAM: carbamoyl-phosphate
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16016"
FT                   /db_xref="GOA:E4RU35"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU35"
FT                   /protein_id="ADQ16016.1"
FT                   /translation="MPKNPSIKSVLIIGSGPIVIGQACEFDYSGSQAARSIRQEGIEVA
FT                   LINSNPATIMTDPMNADYVYLKPLEKKSISEILKKHEEMGKPITHVLPTMGGQTALNLA
FT                   IDCDKAGIWKKHNIEIIGVDIKAIETTEDRELFRKKMLELKVGVCKGRTAKSFLEGKEI
FT                   AQETGFPLVIRPSYTLGGTGGGFVNTPEEFDAALNHGLHASPVHEVLVEQSIMGWKEYE
FT                   LELLRDHNGNIVIICTIENFDPMGVHTGDSITVAPAMTLPDTIYQKMRDMAIRMMNGIG
FT                   QFAGGCNVQFALNPETDDIIAIEINPRVSRSSALASKATGYPIAKIAAKMAIGYNLDEL
FT                   INPITGSTSAFFEPAIDYVIVKVPRWNFDKFPGSDRRLGLQMKSVGETMGIGRNFQEAL
FT                   QKACQSLEIKRNGLGADGREERDQEKLKQSLANPSWDRLFHVYDAFKAGLSFNTIQNLT
FT                   KIDKWFLRQIEEMVILEGQVQKYNLDSIPRDLLLSAKKMGYADRQLAHLLRCMESEVTL
FT                   KRKELGIKRAFKCVDTCSAEFEAHTPYYYSTFNLSDENPDNESVVSDKKKVIVLGSGPN
FT                   RIGQGIEFDYSCVHGVLAAKESGYETIMINCNPETVSTDPDISDKLYFEPVFWENVFDI
FT                   IEYEKPDGVIVQLGGQTALKMAEKLTKYGVKIIGTSYEALDLAEDRGRFSTKLQELNIP
FT                   YPKFDTVRTADKASEVAKELGFPLLVRPSYVLGGQSMKIVINEEELEQHVVKILNDIPD
FT                   NNILLDHFLENAIEAEADAICDGEDAYIIGIMEHIEPAGIHSGDSYAVLPPFDLSENVL
FT                   RQIEEYTKKIAIALDTKGLINIQFAIKDEVVYVIEANPRASRTVPFICKAYQEPYVNYA
FT                   TKVMLGAKKVKDFNFKPVKEGYAIKIPVFSFNKFPNVNKELGPEMKSTGEGIYFIEDLT
FT                   DDFFLKVYAERNLYLSR"
FT   sig_peptide     complement(240065..240163)
FT                   /locus_tag="Lbys_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(240256..241653)
FT                   /locus_tag="Lbys_0224"
FT   CDS_pept        complement(240256..241653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0224"
FT                   /product="ATP-dependent exoDNAse (exonuclease V)"
FT                   /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit - helicase superfamily I member; KEGG:
FT                   dfe:Dfer_0232 ATP-dependent exoDNAse (exonuclease V); SPTR:
FT                   ATP-dependent exoDNAse (Exonuclease V); PFAM:
FT                   Uncharacterized conserved protein (DUF2075)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16017"
FT                   /db_xref="GOA:E4RU36"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU36"
FT                   /protein_id="ADQ16017.1"
FT                   /translation="MDFFEEQLHYNFHLSPTKGQKELFRKLSKFMEDEDERTIFLLKGY
FT                   AGTGKTSVLESFMKAAPTLNYSVNLLAPTGRAAKVMQQYTKRFASTIHRKIYRQKDVSG
FT                   LPQFSLVKNKENQTVYLVDEASMISELGELGSNGLLRDLISYVFSGERNKLILIGDEAQ
FT                   LPPVHLAISPALDKQHLEGYYHAKVYSHTLTEVMRQNAGSGILVNATALRDQLPLEEIE
FT                   VKFNTKGFKDFYRMPAEKLEDGLRYCYDKYGLENTIVLTQSNKNAVQYNQFIRNRILYY
FT                   EAEVDYGDTLMVVKNNYQTLPSESQAGFLANGEFVKVKRIGSEEEMHGFRFLNVTLSLV
FT                   DYPDDPEIDTLILLDTLFSPLPNLSGEDSKKLYESVVEDYAWVKTAKERKKMIREDKYL
FT                   NALQVKFAYALTCHKSQGGQWDAVFIDQFYLREETQSPEFLRWLYTAVTRGMKEVFLVN
FT                   FPDKFFV"
FT   gene            complement(241668..242135)
FT                   /locus_tag="Lbys_0225"
FT   CDS_pept        complement(241668..242135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4725 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16018"
FT                   /db_xref="GOA:E4RU37"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU37"
FT                   /protein_id="ADQ16018.1"
FT                   /translation="MQNIRPTFLTILCILTFINSGWNIFQGIGNYTSSEVNAGIIQNQF
FT                   EMIQDRIAEQEGAESMEKIIDAFLSSLTAENLQNNGLATAISSVLTLVGAVLMWSLRKR
FT                   GFYIYLIGTIAGILAPMLIFGGIGGTFMAMGTAFFGILFVILYGLNLKHMS"
FT   sig_peptide     complement(242076..242135)
FT                   /locus_tag="Lbys_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(242141..243490)
FT                   /locus_tag="Lbys_0226"
FT   CDS_pept        complement(242141..243490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0226"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016160:IPR015590; KEGG: cpi:Cpin_2318 aldehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; SPTR: Aldehyde
FT                   Dehydrogenase; PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16019"
FT                   /db_xref="GOA:E4RU38"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU38"
FT                   /protein_id="ADQ16019.1"
FT                   /translation="MFKSIYPYSGEVVAEYEEDAAPLQKVEKAHQVFSTWKNKSLAERQ
FT                   QLIVRFAEVLEYRKLEYAKIISLEMGKLYNEALAEVEKCAITTRYYAEHAPEYIQPLVM
FT                   QSSFPRAYTSFEPMGTILAIMPWNFPFWQALRCAVPNLLLGNTVVLKHASNVMGSALKM
FT                   QEAFLEAGFPDGAFQALFLSSDKVEQIIADPRIKGVTLTGSGPAGSSVASLAGKYLKKS
FT                   VLELGGSDPFVVLKDANIQLAAETAVKSRFQNAGQTCIAAKRWIVEEDIYDEFKELTLN
FT                   HVSKLKLGDPFDTQTTLAPVSREDLAISIEKETKKLIADGAKALLPTERQGCLLSPTIL
FT                   EITRSHSAYYKEELFGPVGFLLKAKNTTEAIEIANETPFGLGASLWAQNMEQAAGLMRQ
FT                   IQAGSVYLNSMVKSEGALPFGGIGESGYGRELGKYGIQEFANVKTYAIQI"
FT   gene            complement(243483..243902)
FT                   /locus_tag="Lbys_0227"
FT   CDS_pept        complement(243483..243902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0227"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: sli:Slin_5437 transcriptional
FT                   regulator, BadM/Rrf2 family; PFAM: protein of unknown
FT                   function UPF0074; SPTR: Transcriptional regulator,
FT                   BadM/Rrf2 family; TIGRFAM: transcriptional regulator, Rrf2
FT                   family; PFAM: Transcriptional regulator; TIGRFAM: rrf2
FT                   family protein (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16020"
FT                   /db_xref="GOA:E4RU39"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU39"
FT                   /protein_id="ADQ16020.1"
FT                   /translation="MISKKAKYALKALTRLTLNYETRKPLLISEISETENIPKKFLEAI
FT                   LLELRNNGILQSQKGKGGGYLLKLPPAEVKIARIIRVIDGPIAPLLCVSLHFYDKCEDC
FT                   SSEEACKIRPLMQQIRDANLTVYENTTLQDLTYNV"
FT   gene            244021..245208
FT                   /locus_tag="Lbys_0228"
FT   CDS_pept        244021..245208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0228"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="COGs: COG0144 tRNA and rRNA cytosine-C5-methylase;
FT                   InterPro IPR001678; KEGG: dfe:Dfer_1088 Fmu (Sun) domain
FT                   protein; PFAM: Fmu (Sun) domain protein; SPTR: Putative sun
FT                   protein; PFAM: NOL1/NOP2/sun family; TIGRFAM: ribosomal RNA
FT                   small subunit methyltransferase RsmB"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16021"
FT                   /db_xref="GOA:E4RU40"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU40"
FT                   /protein_id="ADQ16021.1"
FT                   /translation="MKKIRLHKPLVRGILEALQSAETKKVDHVLPALLKAQPKWGSRDR
FT                   NFVAENTYEVVRNKRFIQFLLGGDATPSKMLGAWLILKGLYDPEEEIFRYLDPEVIQDN
FT                   ARSDMPLEIRFSLPDELSQRAKRELGDDRWAKEAEAMHGQAPVYLRVNERWITRDKLVS
FT                   VLLSKDIAVEPVASVPSAIKVLKRAGLNQLEEYKKGFFEIQDAGSQEIAHFLDPQAGEF
FT                   IVDTCAGAGGKTLHLADLSRNKAKILALDVEEGKLEELEKRAARNRVSQVETSLWNNDI
FT                   LDQYRGQADAVLMDVPCSGLGVLRRNPDAKELLTEAYIDSIRDVQAEILQKYSALVRKG
FT                   GRLVYATCSLLPSENEGQVKRFLENHGDFELIKDKQIWPSETDFDGFYMALLRKK"
FT   gene            245205..246137
FT                   /locus_tag="Lbys_0229"
FT   CDS_pept        245205..246137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0229"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006139:IPR006140; KEGG:
FT                   dfe:Dfer_0419 D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; SPTR: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16022"
FT                   /db_xref="GOA:E4RU41"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU41"
FT                   /protein_id="ADQ16022.1"
FT                   /translation="MKILVVDEMHECLLPLLHNLGAEVSYQPTFGKKDAEQVIHQYEGL
FT                   LIRSKFFIDSAFLDLATSLKFIGRAGAGLDLIDLEACKERGVEVFGANEANKVAVAEHL
FT                   LGMILMLFNKLNTSPQEIRNDQWLREKNRGEELMGKTVGIIGYGHNGSTAAARFAAFGC
FT                   RVLAYDKYKKGFGSAEIEEVDLETIFTEADVFSFHVPLTEETRKWADSDFFSKFRKPIY
FT                   FCNVARGEIMVQEALIQALENGKVKGACLDVLENEKITALTDKGRKEFEYLRAHPRVIL
FT                   SPHVAGWTIESYRKINEVLCEKIKALYKL"
FT   gene            complement(246125..247234)
FT                   /locus_tag="Lbys_0230"
FT   CDS_pept        complement(246125..247234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0230"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: sli:Slin_2585 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16023"
FT                   /db_xref="GOA:E4RU42"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU42"
FT                   /protein_id="ADQ16023.1"
FT                   /translation="MKTLIIHNTLWAHYKSVLFEEIAKQYPPEGEFHVLQIAKSEVSRK
FT                   GMEGEGKTYTYPYTLLFDGFIEEVPKWKELQRVFQFILQYKPDIINVTGYSSSFSTLPT
FT                   IFFARLLGIKVVMSNESTQKDKTRSWLKESIKKWAVQACKGFVVFGKTSEDYVLDLGAK
FT                   PEQILVHKGAVVDNKVLSSVYHKAKETTLYPEITTQKNFIYVGRMAEEKNVELLIKCFQ
FT                   KLNKQEWGLILVGKGPKDQEIDQLIAKSPDRIYKYPPVHWMEVPKFFSRSSCFVLPSTS
FT                   EPWGLVVNEAMVCGLPVIVTDVCGCSTDLVNGNGVVIPSNSASALISALKKIISTPDLT
FT                   EMENKSLEIIKDFSVQEVAKRYIQGIQSL"
FT   gene            complement(247236..248489)
FT                   /locus_tag="Lbys_0231"
FT   CDS_pept        complement(247236..248489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2584 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16024"
FT                   /db_xref="GOA:E4RU43"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU43"
FT                   /protein_id="ADQ16024.1"
FT                   /translation="MALAIFLTGVPLIYYLRDGLGVAPGNTMFSIGLIFFPFALTIPFK
FT                   NFRFFDLPNKVTFPYLTFFLIYLFAYFFLKDRYYLTVSFYTEILTYIIIVFVAFSTVFM
FT                   RNEAINRRFIYLCILLSTLSAISLMYYVSQNPLYVIGQRAAFGYGGEVGVGNPHINSKV
FT                   AYFGIILGVLSLKYYRQIKLGLIFPVILIILNIAILFLTQTMLAFLATFGFTVMFLVFN
FT                   LSFSNAVSTFRLFFTKWYIVVLVLAGFMTLSYQINKNARLLNPAFNYFNTRFEGIKKSL
FT                   TESSESKKIKVKETGDDSANTRIQHVEGVMERLEKSFDKGNYHYILFGQGYKFMYVDIP
FT                   HLEMIDSFGLIGFTIFTILFLRLILMSVREMRDPESIGTEFLAYAMIYFFIANFTSGQM
FT                   LDYTRFASFYIFCRFLKK"
FT   gene            complement(248605..251592)
FT                   /locus_tag="Lbys_0232"
FT   CDS_pept        complement(248605..251592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0232"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916:IPR013026; KEGG: dfe:Dfer_4967
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF2723)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16025"
FT                   /db_xref="GOA:E4RU44"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU44"
FT                   /protein_id="ADQ16025.1"
FT                   /translation="MSFKKLNNLAGWLAFLISLITFTLTVEPTASFWDCGEFIACAYKL
FT                   QVPHPAGAPFFLLIGRIFSLFAGSNLESVAFMVNMVSVLASAFTILFLFWTISMIARKV
FT                   VGKGDEDLSNPESFLILGSSMVGALAYNFSESFWFSAVEAEVYGMSSFFTAIVVWAAFK
FT                   WERIEDPVKQNRWLIFLAYLVGVSIGVHLLNLVTIPALALLYYFKKENKPTITGGFISF
FT                   MVGMVVLGIINVGVITGIPSISFWFELLFVNSFGLPFGSGMVFFILVLVTALVYGIRYT
FT                   HQKGKALQNTILLCFAFVLIGFSTYTIALIRSNFNPPLNENNPSNVLNFTSYLKREQYG
FT                   SRPLLYGPIFTAQLAGIERGTPNYIQGEKKYEIYDYNPEYTWDSKGKMLLPRIWSQDPG
FT                   HISLYRAKLNLPEGQNPTFADNIRFMISHQFGHMYWRYFMWNFWGRTSDIQDTGFTNIF
FT                   ESKNDLPPSIASNKARTNFFGLPLILGIAGFLFLYFRREKDAIVTFLMFFLTGLALVVY
FT                   LNSPPIEPRERDYIYAGSFYFFTIWIGLGVMAIYTYVLKFLKNRMAQAGIASALGLVVP
FT                   VIMGASSWEGHDRTGRVHQIDFARNMLATCEPNAILFTGGDNDTFPLWYVQEVEGFRTD
FT                   VRVCNLSLLGTDWYIEQMKRKTYESEALPITLNSENYYKGINDHIPYVANPNPQIKAGI
FT                   DLREYINLIRKKDQAIQRMVSTGDMINILPSANFFFSQNAEEIAKMPFIGEEQKALITD
FT                   RFEWSFGERDILKNDLIVLDIISNNNWKRPIYFGGTLPQNQYLGLKEFMQLEGYAYRLM
FT                   PFKIEGAKDGFVNSDILKKKLMTQMKWTNLNNTDVYYDTESFRVPFITARYAFLRLADE
FT                   LLRENKKKEAEEVLDKSLEIMPDASVPYDQLVTNFPIFYYEIGSKEKGTKLADEIVNKA
FT                   DKELAYFGPKFAKSGDKQWGDDNIRQFVQSNMRTIQMLYQAAEQYDKDAAARYRQIYEK
FT                   HLSKLQ"
FT   sig_peptide     complement(251500..251592)
FT                   /locus_tag="Lbys_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(251658..252287)
FT                   /locus_tag="Lbys_0233"
FT   CDS_pept        complement(251658..252287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0233"
FT                   /product="deoxynucleoside kinase"
FT                   /note="COGs: COG1428 Deoxynucleoside kinase; InterPro
FT                   IPR001977:IPR002624; KEGG: dfe:Dfer_0477 deoxynucleoside
FT                   kinase; PFAM: deoxynucleoside kinase; Dephospho-CoA kinase;
FT                   SPTR: Deoxynucleoside kinase; PFAM: Deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16026"
FT                   /db_xref="GOA:E4RU45"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU45"
FT                   /protein_id="ADQ16026.1"
FT                   /translation="MHIAITGNIGAGKTTLAEKLASHYGWEVYYEAVDGNPYLAPFYDD
FT                   MPLWSFHLQIFFLNTRFEQVLKIKERSDKTIIQDRTIYEDAYIFAQNLYESGHMNETDF
FT                   TTYKSLFNTIMRAISPPDLMIYLKADLPRLQKGIRKRGREYEQNIDPNYLLGLNELYSK
FT                   FAQQYHHGKFLEIDVNDLDFVENEADFRKITDLLEKNINIGTQLKI"
FT   gene            252394..253167
FT                   /locus_tag="Lbys_0234"
FT   CDS_pept        252394..253167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0234"
FT                   /product="stationary-phase survival protein SurE"
FT                   /note="COGs: COG0496 acid phosphatase; InterPro IPR002828;
FT                   KEGG: dfe:Dfer_0474 stationary phase survival protein SurE;
FT                   PFAM: Survival protein SurE; SPTR: Stationary-phase
FT                   survival protein SurE; TIGRFAM: stationary-phase survival
FT                   protein SurE; PFAM: Survival protein SurE; TIGRFAM:
FT                   5'/3'-nucleotidase SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16027"
FT                   /db_xref="GOA:E4RU46"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU46"
FT                   /protein_id="ADQ16027.1"
FT                   /translation="MKPLILVTNDDGITSKGIKVLIEEMSELGEVFVVAPDSPNSGMGH
FT                   AITVASTIHIKKSPIFGSIESYECSGTPADCVKLAKHEFLKDRKIDLLVSGINHGANSS
FT                   ISVIYSGTMSAAIEGAIEGIPSIGFSLDDFDYNADFGHIRKYVREIAAHVLKNGLPADT
FT                   ALNVNFPKASAGPIKGVKVGRQTRGYWHEEFDSRVDPSGRPYFWMGGHYVNSEPKAEDT
FT                   DVWALENNYVSVFPCHFDLTHYKALAEIKGLEDII"
FT   gene            complement(253164..254141)
FT                   /locus_tag="Lbys_0235"
FT   CDS_pept        complement(253164..254141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0235"
FT                   /product="cytochrome c-related protein"
FT                   /note="InterPro IPR009056; KEGG: chu:CHU_2867 cytochrome
FT                   c-related protein; SPTR: Class I diheme cytochrome c; PFAM:
FT                   Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16028"
FT                   /db_xref="GOA:E4RU47"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU47"
FT                   /protein_id="ADQ16028.1"
FT                   /translation="MKTLKKTGLYVLGIFSLLLILAIIVLFTLFPKVDTAPELTVERTP
FT                   ERIERGRYIANAVAVCMDCHSQRDWSSYSGPMVPGTLGMGGERFSREMGFPGVFYSKNI
FT                   TPAALSGWTDGEIYRTITSGVDREGKALFPVMPFHSYNQLHDEDIFSIIAYIRSLDPIE
FT                   NEIPERTVDFPVNLLVRTFPNKRNQVDQIPDKADKVAYGRYVTTMAGCIDCHTPVKKGN
FT                   IILEEIFSGGRAFEMPGGTLVSSNLTPHNTGIANWTEAQFISTFKQYQDSTYVSPKLGA
FT                   TDMNTLMPWMMYSTMKEEDLRAIFAYLKSLPPIERTVQKFVPKN"
FT   sig_peptide     complement(254037..254141)
FT                   /locus_tag="Lbys_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(254253..254792)
FT                   /locus_tag="Lbys_0236"
FT   CDS_pept        complement(254253..254792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0236"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR020084:IPR000086; KEGG: dfe:Dfer_0471
FT                   NUDIX hydrolase; PFAM: NUDIX hydrolase; SPTR: NUDIX
FT                   hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16029"
FT                   /db_xref="GOA:E4RU48"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU48"
FT                   /protein_id="ADQ16029.1"
FT                   /translation="MSNKWKKLDSQTVYENPWIEVQHHEVINPSGGKGIYGQVNFKNLA
FT                   IGIVPLDKEGNTYLVGQHRFPIDEYSWEIPEGGCPHDEDILDCAKRELLEETGLRAEKW
FT                   TQISKIHTSNSVCNETGFIFLAEELTQGEAEPEETEDLVVRKVSLEEAFQMVMKDEITD
FT                   SLSIAGILKTRLLRKY"
FT   gene            complement(254789..256168)
FT                   /locus_tag="Lbys_0237"
FT   CDS_pept        complement(254789..256168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0237"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001763; KEGG: dfe:Dfer_3119
FT                   beta-lactamase domain protein; PFAM: Rhodanese domain
FT                   protein; SMART: Rhodanese domain protein; SPTR:
FT                   Metallo-beta-lactamase superfamily protein; PFAM:
FT                   Metallo-beta-lactamase superfamily; Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16030"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU49"
FT                   /protein_id="ADQ16030.1"
FT                   /translation="MKVEQIYTGCLAQGAYYICSEGEAAIIDPLREVGPYLQRAEKDQS
FT                   TIKYVFETHFHADFVSGHLDLSKKTGAPIVYGPTAKPNFPAKIAEDGEIFTIGKIKIQA
FT                   IHTPGHTLESTCYLLIDEEDKPKALFTGDTLFIGDVGRPDLAQKVVEDLTQDKLAGMLY
FT                   DSLRNKIMPLPDDIIIYPAHGAGSACGKNMSKETSDTLGHQKQTNYALRDITKEQFIKE
FT                   VTDGLLPPPIYFPENVKMNISGYESLDTVMERGLQALDAEGFETAANATGALILDTRSP
FT                   QEFAKGFIPNSINIGIDGSFAPWVGALIPDIRQEILLVTEPGREQEVITRLARVGYDKT
FT                   IGYLKGGIESWKGKEMDHITSISPQDFVDNHFPVENILDVRKPTEFQTGHLETAKNVPL
FT                   DFINENLSELDKDQTYYIHCAGGYRSMIFASILKSRGFENVVDIQGGYKALVETGTPTT
FT                   V"
FT   gene            complement(256168..256983)
FT                   /locus_tag="Lbys_0238"
FT   CDS_pept        complement(256168..256983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0238"
FT                   /product="protein of unknown function DUF81"
FT                   /note="InterPro IPR002781; KEGG: pgi:PG1572 hypothetical
FT                   protein; PFAM: protein of unknown function DUF81; SPTR:
FT                   Membrane protein, putative; PFAM: Sulfite exporter
FT                   TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16031"
FT                   /db_xref="GOA:E4RU50"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU50"
FT                   /protein_id="ADQ16031.1"
FT                   /translation="MEAFGYLAAIAIGITLGMIGGGGSILTIPLLVYVFGIDPILATLY
FT                   SLFIVGSTSWVGGIPKYTQGLVNLRTALLFGIPSIISVLLTRAFIAPAIPNTILRIGNF
FT                   QLEKSVFLMLLFASLMIGASLSMIKDKRIRRNMMRSKSAEVKTTRIMLEGVMVGILTGL
FT                   VGAGGGFLIIPALILFGKLPMKIAVGTSLIIIAANSSIGFLSGLSHHAEEIDWKFLLTL
FT                   TALAIIGIFLGHRISKKWDGERLKKNFGRLILVLGITILVLEGIKIIKM"
FT   gene            257098..258000
FT                   /locus_tag="Lbys_0239"
FT   CDS_pept        257098..258000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0239"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="COGs: COG0248 Exopolyphosphatase; InterPro
FT                   IPR003695; KEGG: sli:Slin_0096 Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase; SPTR: Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16032"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU51"
FT                   /protein_id="ADQ16032.1"
FT                   /translation="MNKAIIDLGTNTFHVLIFNEKEVVYKQSTAAKLGMGGINQGLITE
FT                   EGIERGVKVLQQFREKLDQFQVEKIFAFGTSALRVAKNQAQVLQAFEDRTGIKVSVIDG
FT                   EEEAQLIYEGVRKAVPIEKVSLIVDIGGGSVEFILCNPDKILWKQSFEIGGQRLVEKYM
FT                   NKDPLPMQEIPRMQSYFREALLPLTNAIHQYSPEVLIGSSGSFDTLNDMYFQRTKGTWP
FT                   PQDQAGFDYPLSEFQSAYEQLVFQDREKRMAIPGMRELRVDMIVVAMVLIRFLIEEYKI
FT                   SEVKISNYALKEGAMNYAQ"
FT   gene            257990..259456
FT                   /locus_tag="Lbys_0240"
FT   CDS_pept        257990..259456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0240"
FT                   /product="protein of unknown function DUF814"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616:IPR008532; KEGG:
FT                   dfe:Dfer_2016 protein of unknown function DUF814; PFAM:
FT                   protein of unknown function DUF814; Fibronectin-binding A
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF814);
FT                   Fibronectin-binding protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16033"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU52"
FT                   /protein_id="ADQ16033.1"
FT                   /translation="MHNNYFFLRRYAPELNEKLRGKILTSAFSQDKDEVILEFSEEEYL
FT                   KCILKPEFSVVILMPEFHRAKRNSATLWEDLYGQKVVSVRVGKNERAIRIDLEQATLVL
FT                   KLFRPNLMIFDGNLRMFNQRLITDRELTLDSFDRDISDDKETFIRVGYKKQFYTLGKDL
FT                   IAYLDEKTRGLDADQTWEEIQALLAYLEHPKIYLNRTLPAISLLEGEEMNSASQAIQVF
FT                   AQLYLKSNGLERLRQQRLQINARDLAKTTAYIEELERKKAKWESGLKNEEIGHLIMAHL
FT                   HLIPDGATEVSLPNFYGTGEVKVKLKKELSAQKNAESYYRKSKNERIEQENLERNIERA
FT                   YGRLEALEEERELISSTEDPKVLRRVEKAKEIEFPFKEFIYKKVKIWVGKNAKNNDLLI
FT                   TRYAHKDEWWLHARDTTGSHVIIKHVSPSAEILEYAARIAAYYSKRKSEGLVPVQVTQR
FT                   KFIRKGKNLPAGQVIVDKEQTLLVEPHPGL"
FT   gene            complement(259451..259699)
FT                   /locus_tag="Lbys_0241"
FT   CDS_pept        complement(259451..259699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: act:ACLA_091860 protein-ER retention receptor,
FT                   putative; SPTR: Protein-ER retention receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16034"
FT                   /db_xref="GOA:E4RU53"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU53"
FT                   /protein_id="ADQ16034.1"
FT                   /translation="MAMRFYFIRTAWIAFILLGLYLILDDRNDNFQTALYAIWIVVGII
FT                   YYLYSKDNFRNFWLSVIVALATVATILYYFYFRNWML"
FT   gene            259825..261510
FT                   /locus_tag="Lbys_0242"
FT   CDS_pept        259825..261510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0242"
FT                   /product="Aromatic amino acid hydroxylase"
FT                   /note="COGs: COG3186 Phenylalanine-4-hydroxylase; InterPro
FT                   IPR019774; KEGG: phe:Phep_3273 phenylalanine
FT                   4-monooxygenase; PFAM: Aromatic amino acid
FT                   hydroxylase-like; SPTR: Phenylalanine-4-hydroxylase; PFAM:
FT                   Biopterin-dependent aromatic amino acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16035"
FT                   /db_xref="GOA:E4RU54"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU54"
FT                   /protein_id="ADQ16035.1"
FT                   /translation="MKQINTFGNAAVAALPAHLLRYVVDQNYERYTWIDQAVWRYVMRQ
FT                   NYNYLKEIAYYPYIRGLHQAGLSIERIPDLQTINDHLGKIGWGAVTVDGFIPPSAFMEY
FT                   QAHRVLVIAADIRRLEHIEYTPAPDIIHESAGHAPIIAEPEYHAYLSYFGSIGAKAMFS
FT                   AKDFELYESIREVSILKESEDKEALKAAEEKLQYISENMGEPSEMALLSRLHWWTVEYG
FT                   LIGTLEDPKIYGAGLLSSIGESKSCMRPEVKKLPYTIDAINYAYDITKPQPQLFVTPHF
FT                   NRLLEVLEEFASTMAFRRGGAESLKKAVDCGQVCTVSLDSGVEISGKFISYSGDVDFIK
FT                   TEGPTALAYGGRQLPGHDKTLHKEGYSSPIGEYFIQKGSLSVGEDVLLQYASGYTVEGR
FT                   VTETLFQEGRLIVATLMECTVRTPTAEICYRPEWGRFDLVLGIKVISVYSGAADKSAYE
FT                   TDVYLSEQSTKKEEYSSKLHEIYGGIRQIREGGWDISPLKDYFAILQNEFPEDWLASLE
FT                   ILELWPDPAVEAHLNQLKERFPEYRQVIEDGLRLHYEHSSYRSK"
FT   gene            261482..262183
FT                   /locus_tag="Lbys_0243"
FT   CDS_pept        261482..262183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0243"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002198:IPR002347;
FT                   KEGG: phe:Phep_3274 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Probable dehydrogenase/reductase; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16036"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU55"
FT                   /protein_id="ADQ16036.1"
FT                   /translation="MNIVVTGASSGLGFETALELSKKGEHRVVAISRNTDKLKRLLEIG
FT                   RSLNPDIQLIPVSFDLVNDDIKLLQDFIIRTLGSVDILINNAGQLINKPFMKTTSEEFL
FT                   GLLQANVLSHFSISKALVPFMNKGAHILNIGSMGGYGGSVKFPGLSAYSASKGALHILT
FT                   ECMAVELQEYEIKVNCLALGSVQTEMLEEAFPGYTSPVMAFEMGEYVADFALNGSRFYN
FT                   GKVLTVALTTP"
FT   gene            complement(262173..263405)
FT                   /locus_tag="Lbys_0244"
FT   CDS_pept        complement(262173..263405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0244"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765:IPR007863; KEGG: dfe:Dfer_2951 peptidase M16
FT                   domain protein; PFAM: peptidase M16 domain protein; SPTR:
FT                   Peptidase M16 domain protein; manually curated; PFAM:
FT                   Peptidase M16 inactive domain; Insulinase (Peptidase family
FT                   M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16037"
FT                   /db_xref="GOA:E4RU56"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU56"
FT                   /protein_id="ADQ16037.1"
FT                   /translation="MINFEHFTLSNGLQVFVHQDSKSLTSAFNLCYHVGSRDEHPEKTG
FT                   FAHLFEHLMFGGSKNVPSFDEPVQRAGGSNNAFTSLDITNYYITLPNQNLETAFWLESD
FT                   RMHSLSFDPKVLVTQKSVVIEEFKQRYLNQPYGDVWLHLRPMLYQQHPYSWPTIGKETS
FT                   HIENASMEDVKDFFFRFYRPNNAVLVVAGETSKARDWAEKWFGPIPAGPKIPRNYPMEI
FT                   PQTQARYKTVHANVPVKTLYKAFKTPAKYSSEAYALDIFADAFGRGQTSALYQKLVKDQ
FT                   GIFTSAGASHTAYHDGGLFVIHGTLANEVSFEDADHAINALLQSEIARADYSKKLQKVK
FT                   TQALSLDKFGETEILNRAMKLAFAATFGNPNLCNTALDLLLQVDEDFMKHQAKTYLHAN
FT                   NSCTLFYSPRE"
FT   gene            263462..263947
FT                   /locus_tag="Lbys_0245"
FT   CDS_pept        263462..263947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0245"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="COGs: COG0245 2C-methyl-D-erythritol 2
FT                   4-cyclodiphosphate synthase; InterPro IPR020555:IPR003526;
FT                   KEGG: phe:Phep_4060 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; PFAM: MECDP-synthase; SPTR:
FT                   2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase;
FT                   TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: YgbB family; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16038"
FT                   /db_xref="GOA:E4RU57"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU57"
FT                   /protein_id="ADQ16038.1"
FT                   /translation="MQIRIGHGYDVHQLSAGYALTIGGVQIPHEVGSMGHSDADVLLHA
FT                   LCDALLGALSLGDIGQHFKNTDPRWKGMDSKHFLREVYKMISEKGYRVGNVDSSLILEA
FT                   PKIGKYIPQMKTEIATCLGISPEDVSIKATTSETMGFVGRKEGLEAHAVCLLYKKED"
FT   gene            264001..264882
FT                   /locus_tag="Lbys_0246"
FT   CDS_pept        264001..264882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0246"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR020625:IPR005263:IPR002220; KEGG: dfe:Dfer_5112
FT                   dihydrodipicolinate synthase; PFAM: dihydrodipicolinate
FT                   synthetase; SPTR: Dihydrodipicolinate synthase; TIGRFAM:
FT                   dihydrodipicolinate synthase; PFAM: Dihydrodipicolinate
FT                   synthetase family; TIGRFAM: dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16039"
FT                   /db_xref="GOA:E4RU58"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU58"
FT                   /protein_id="ADQ16039.1"
FT                   /translation="MKELYGLGTALTTPFTEDNQVDYPALKKHLDYINEEGVDYYVVNG
FT                   TTGESATLSKAESAEILSFVKKYNAGKRAIVFGIGGNNTQAVLDTISQTDFEGVTAILS
FT                   VCPYYNKPSQRGIYLHFKAIADASPVPVILYNVPGRTVISMSVETIAELAKHPNIIGLK
FT                   DASSSIEVAIDLSRTLPDDFLLLSGDDNLFTAQASLGYKGVISVIGNGFPKEFYELVHS
FT                   AMEGDFDNAKRLQGKFLDFDTLLYIESNPVGIKCVLDIKGIYDGRVRLPLAKASDELYQ
FT                   KMETSMRKEGFL"
FT   gene            264879..265499
FT                   /locus_tag="Lbys_0247"
FT   CDS_pept        264879..265499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0247"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: bfs:BF4336 putative
FT                   transmembrane PAP2-family protein; PFAM: phosphoesterase
FT                   PA-phosphatase related; SMART: phosphoesterase
FT                   PA-phosphatase related; SPTR: Putative uncharacterized
FT                   protein; PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16040"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU59"
FT                   /protein_id="ADQ16040.1"
FT                   /translation="MKRIFAITFLTCASLSGLAQGWDLKKLEDINLGRNTDMDKPLNFL
FT                   SNSTDYLAVGFPVGMLAVGFAKDDASLKQEGFQMATTTVMTYGLGYVLKKVIDKERPYV
FT                   THPHIQNYKEFSGGSFPSGSTALAFATGTSLSLSYPKWYVILPSTLYACTVGYSRLHLG
FT                   AHYPSDVFAGAALGIGTAFASRKLNQWVRNEGKKKKLKQQMHE"
FT   sig_peptide     264879..264941
FT                   /locus_tag="Lbys_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            265492..265629
FT                   /locus_tag="Lbys_0248"
FT   CDS_pept        265492..265629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_1397 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16041"
FT                   /db_xref="GOA:E4RU60"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU60"
FT                   /protein_id="ADQ16041.1"
FT                   /translation="MNKDKLIAYFKKLGWAGFFFFLIKGLTLYVILPFLIAKGVIDCKG
FT                   "
FT   sig_peptide     265492..265539
FT                   /locus_tag="Lbys_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(265630..267138)
FT                   /locus_tag="Lbys_0249"
FT   CDS_pept        complement(265630..267138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0249"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590; KEGG: dfe:Dfer_5034 aldehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; SPTR: Aldehyde
FT                   Dehydrogenase; PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16042"
FT                   /db_xref="GOA:E4RU61"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU61"
FT                   /protein_id="ADQ16042.1"
FT                   /translation="MKEFIRDLGLENINYGYSTGLKNRAGAGEELISYSPADQTPIAST
FT                   TLCTTTDFEEAIQAAKSAYVQWRNVPAPKRGEIVRQMGEAFRKNKQALGQLVSYEMGKS
FT                   LQEGLGEVQEIIDICDFAVGLSRQLYGLTMHSERPEHRMYEQYHPLGIVGIISAFNFPV
FT                   AVWSWNAMIAWVCGNVCIWKPSEKTPLSAIACQNIISSVIESNQLPEGLSTLLIGGPEI
FT                   GQALSSHEDVALVSATGSTRMGKAVAKTVASRLGKYLLELGGNNSIIVTENADLNLTVP
FT                   AVVFGAVGTAGQRCTTTRRLIVHQSVKEELTQRLVKAYGQLKIGDPLDPAHHVGPLIDQ
FT                   DAVLNYTNAIEAAVAQGGEILFGGEVLEGNYVLPTIIDMPAQTEIVKHETFAPILYILT
FT                   YEDWNDAIFLQNDVPQGLSSAVFTQNIREAERFLSANGSDCGIANVNIGTSGAEIGGAF
FT                   GGEKETGGGRESGSDAWKAYMRRQTNTINYGTTLPLAQGIKFDL"
FT   gene            267303..268211
FT                   /locus_tag="Lbys_0250"
FT   CDS_pept        267303..268211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_0200 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: S1/P1 Nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16043"
FT                   /db_xref="GOA:E4RU62"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU62"
FT                   /protein_id="ADQ16043.1"
FT                   /translation="MKLLCFYLLLLVPPWGFYAHKWINRMAVFLQPPELFVFLKKHIHY
FT                   ISDHAVNPDKRRYAVVGEAERHYIDLDEYNAEEKLVLPSLTWEKAVERYTEDSLRARGI
FT                   VPWQIIRMKHQLTEAFMHRDVSRIVKLCTDLGHYIADAHVPLHTTKNYNGQLTGQNGIH
FT                   GLWESRLPELYLQGYDMWIGRAAYEPRIQERVWRTVFDSHAAVDSVLSFEKRLSEDKKY
FT                   TIEERNGVLVKTYSSLFSAQYHKALQDQVERRMRAAIQTVADIWYTAWSDAGKPDLGDE
FT                   IFEIQADTIPRAQVLKVREEN"
FT   sig_peptide     267303..267359
FT                   /locus_tag="Lbys_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(268208..268798)
FT                   /locus_tag="Lbys_0251"
FT   CDS_pept        complement(268208..268798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0251"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: dfe:Dfer_5477 polysaccharide deacetylase;
FT                   PFAM: polysaccharide deacetylase; SPTR: Polysaccharide
FT                   deacetylase; PFAM: Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16044"
FT                   /db_xref="GOA:E4RU63"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU63"
FT                   /protein_id="ADQ16044.1"
FT                   /translation="MILEWIFPRYLWKVPTAEKVIYLTFDDGPIPEVTPWVLEQLAAYH
FT                   AKATFFCVGDNIRKHPETFQSILDAGHSVGNHTFHHINGWKTPLAQYLEDIEKFDQMYQ
FT                   TPLFRPPYGRIKRSQADALLPARQIVMWSVLTRDYDASYREDSCLNNAIKRTSPGAIVL
FT                   LHDSLKAWKNMSYVLPRYLKHFSEKGYRFEALP"
FT   gene            complement(268795..269856)
FT                   /locus_tag="Lbys_0252"
FT   CDS_pept        complement(268795..269856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0252"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   dfe:Dfer_2026 glycosyl transferase family 2; PFAM: glycosyl
FT                   transferase family 2; SPTR: Glycosyl transferase family 2;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16045"
FT                   /db_xref="GOA:E4RU64"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU64"
FT                   /protein_id="ADQ16045.1"
FT                   /translation="MILLSSILLIYVLIVLFSTGIWINIKAEKYSVHKPWVTAIVVVRN
FT                   ESENIKDLLNSLKSQTYPHLEVLLVDDHSTDNTLALAEEVAWEGLQILPLPQVSTAPKK
FT                   EGISFAIHKAKGEYIFTTDGDCTLPPQLIETYVNSIGNKHFLSGPVTFKKNNQIWNNIQ
FT                   TVEFASLLGSSAVAMDLGSPIMCSAANLFYRKQTFLEVGGYSDNLNLASGDDEFLMNKI
FT                   HKSFPGSTSFVKDANCIVETEASPTLSAFYRQRKRWAGKWNQHLNSKLTAIFIFAVNLA
FT                   TIILALQGEWTPLIVRFLTEAVFLSSVQIFLNRKKSILYIPITQCIYSLYVVFFGIVSL
FT                   FPGTYRWKDRTLR"
FT   sig_peptide     complement(269776..269856)
FT                   /locus_tag="Lbys_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(269840..270748)
FT                   /locus_tag="Lbys_0253"
FT   CDS_pept        complement(269840..270748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_1378 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0104)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16046"
FT                   /db_xref="GOA:E4RU65"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU65"
FT                   /protein_id="ADQ16046.1"
FT                   /translation="MKFPTQNTVSFLSKPNLRGLFNGVLLVFLFYLLYQKYPNLTEISF
FT                   PSPIYLLLGILCVIPNYALEIYKWQLLSAQIQERTFLQAKTEVLRGLKLGILTPFMSGD
FT                   YLGRSMGFNKGQRTNAALLNFFNSITQTWTALFFGSMALILWNIELWEINTRVAGIILL
FT                   MISTFSLALLLGLKVTIWKKYQTALDLPLKLKWEVIYLSLLRTLTYLLQYYFVYLAFDI
FT                   QVTYMDLFIGTNLLLLAKTIGGGLNAIGDLTLRQVVSIFFFAPLGISEEKIIVATFVVW
FT                   LISVFLPVFYSIFAKKHDSAV"
FT   sig_peptide     complement(270692..270748)
FT                   /locus_tag="Lbys_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            270760..271329
FT                   /locus_tag="Lbys_0254"
FT   CDS_pept        270760..271329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0254"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="COGs: COG0817 Holliday junction resolvasome
FT                   endonuclease subunit; InterPro IPR002176; KEGG:
FT                   dfe:Dfer_2024 crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   PRIAM: Crossover junction endodeoxyribonuclease; SPTR:
FT                   Crossover junction endodeoxyribonuclease RuvC; TIGRFAM:
FT                   crossover junction endodeoxyribonuclease RuvC; PFAM:
FT                   Crossover junction endodeoxyribonuclease RuvC; TIGRFAM:
FT                   crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16047"
FT                   /db_xref="GOA:E4RU66"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4RU66"
FT                   /protein_id="ADQ16047.1"
FT                   /translation="MQAKVSEKIILGVDPGTRVMGYGIIEVKNSQLKVIQYGVLRLEKL
FT                   TSHELKLKRIFERITQLINEYLPDEMAIEAPFYGENVQSMLKLGRAQGVAMAAALAKDI
FT                   NIVEYLPKKVKQSVTGNGNATKEQVAYMLEKLFNHPLERTFLDATDALAVGVCHFMHSG
FT                   TKALTGNNSKKNGWGAFLQENPDRIK"
FT   gene            271441..271527
FT                   /locus_tag="Lbys_R0002"
FT   tRNA            271441..271527
FT                   /locus_tag="Lbys_R0002"
FT                   /product="tRNA-Ser"
FT   gene            271541..271618
FT                   /locus_tag="Lbys_R0003"
FT   tRNA            271541..271618
FT                   /locus_tag="Lbys_R0003"
FT                   /product="tRNA-Pro"
FT   gene            271644..271720
FT                   /locus_tag="Lbys_R0004"
FT   tRNA            271644..271720
FT                   /locus_tag="Lbys_R0004"
FT                   /product="tRNA-Arg"
FT   gene            271753..271827
FT                   /locus_tag="Lbys_R0005"
FT   tRNA            271753..271827
FT                   /locus_tag="Lbys_R0005"
FT                   /product="tRNA-Pro"
FT   gene            271836..271911
FT                   /locus_tag="Lbys_R0006"
FT   tRNA            271836..271911
FT                   /locus_tag="Lbys_R0006"
FT                   /product="tRNA-Lys"
FT   gene            272528..273801
FT                   /pseudo
FT                   /locus_tag="Lbys_0255"
FT   gene            274015..274401
FT                   /locus_tag="Lbys_0256"
FT   CDS_pept        274015..274401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1952 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16048"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUP7"
FT                   /protein_id="ADQ16048.1"
FT                   /translation="MESFLPLVEFLLPDFILTYFHLKKVDNVLGTLHVYLEEKNYDPSD
FT                   PIKVDLESKVFLPESTIQDFPIRDKRVFLHVSRRRWLNTKTGQMHHRDWDEVAKGTRMT
FT                   KEFSAFYPLIPTPIVLKALLNFMV"
FT   gene            274380..275275
FT                   /pseudo
FT                   /locus_tag="Lbys_0257"
FT   gene            complement(276017..276880)
FT                   /locus_tag="Lbys_0258"
FT   CDS_pept        complement(276017..276880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_1188 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16049"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUP8"
FT                   /protein_id="ADQ16049.1"
FT                   /translation="MKSAYLMALLLAILITSCAETENPFVPEEPKPENPVQIVDEPDPV
FT                   DFQVTETKEPYFTIADKGFEALLIVLNIDTDNQINGKVSQADVLNVKDLRHNLNGSPNL
FT                   KAEFIKQKYGAMPTIKDFDDIRHFKNLQNLGVHGGKTIDLSLNANLEKIEWTGGLGFET
FT                   LNLTNLDKLKIVQCYAPMMPHASGDPGEVQLKNNTSLEVFEYYGHANSIDLSQAPNLKI
FT                   LIFNSWSYQDSVVNLLNTTHLDKVHIGITNRKGVKVLVSPQTMEKIKTNPSNFHIPETA
FT                   IWTVRG"
FT   sig_peptide     complement(276824..276880)
FT                   /locus_tag="Lbys_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            277029..277337
FT                   /locus_tag="Lbys_0259"
FT   CDS_pept        277029..277337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0259"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: sli:Slin_6765 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Putative transcriptional regulator,
FT                   Fis family protein; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16050"
FT                   /db_xref="GOA:E4RQU5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RQU5"
FT                   /protein_id="ADQ16050.1"
FT                   /translation="MSKHRKTWSLEEKEKIVLHSIQHGVSYSSREFGVSTVSIYNWKEK
FT                   FEKLGKSGLEAGAMTDAERELKQLRRENEALKRIVAEKELAIQIKDSLLKKSQSLKK"
FT   gene            277502..278175
FT                   /pseudo
FT                   /locus_tag="Lbys_0260"
FT   gene            complement(278183..279202)
FT                   /locus_tag="Lbys_0261"
FT   CDS_pept        complement(278183..279202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0261"
FT                   /product="Two component regulator propeller"
FT                   /note="InterPro IPR011110; KEGG: cpi:Cpin_3143 two
FT                   component regulator propeller domain protein; PFAM: Two
FT                   component regulator propeller; SPTR: GGDEF domain protein;
FT                   PFAM: Two component regulator propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16051"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ0"
FT                   /protein_id="ADQ16051.1"
FT                   /translation="MNRKIILIYLIIILTLNFSCVEKKSKEGETNKSELEATSKTDTLK
FT                   FTSGIRAIFQDSKGNYWFGSHNEGVSFYNGKSFEYFTTNEGLSDNQIRSIQEDKNGKIW
FT                   FGTARGVSVYDKVKFTNYPSINNNPIFDWNKTNGDLWFNAGEEDGINRFDGINMNYLIF
FT                   PKPKNKNADNADNTYGVTGISKDKDGKVWIATYAALFNYDGKMVNIFDHEKLNLKDNEL
FT                   LHIRSVLADSKGRIWIGNNGIGVLLMEGNSIINFSEKNNLIHPTSKRNGNKSEPGTLEH
FT                   PFAIEEDSEGNIWFGDVYTGAWKYNGKTFVLNAITWTLFLIYFTNSDQFLHQLIRGIF"
FT   sig_peptide     complement(279128..279202)
FT                   /locus_tag="Lbys_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(279298..279390)
FT                   /pseudo
FT                   /locus_tag="Lbys_0262"
FT   gene            279620..279915
FT                   /pseudo
FT                   /locus_tag="Lbys_0263"
FT   gene            complement(279905..282106)
FT                   /locus_tag="Lbys_0264"
FT   CDS_pept        complement(279905..282106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0264"
FT                   /product="Sucrose-phosphate synthase., Sucrose-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.24"
FT                   /EC_number="2.4.1.14"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR012821:IPR001296:IPR006380; KEGG: dak:DaAHT2_1337
FT                   sucrose-phosphate synthase; PFAM: sucrose-6F-phosphate
FT                   phosphohydrolase; glycosyl transferase group 1; PRIAM:
FT                   Sucrose-phosphate synthase., Sucrose-phosphate phosphatase;
FT                   SPTR: Sucrose-phosphate synthase; PFAM: Sucrose synthase;
FT                   Glycosyl transferases group 1; Sucrose-6F-phosphate
FT                   phosphohydrolase; TIGRFAM: sucrose-6F-phosphate
FT                   phosphohydrolase; sucrose-phosphate synthase, putative,
FT                   glycosyltransferase domain; HAD-superfamily hydrolase,
FT                   subfamily IIB; sucrose phosphate synthase, sucrose
FT                   phosphatase-like domain, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16052"
FT                   /db_xref="GOA:E4RUQ1"
FT                   /db_xref="InterPro:IPR000368"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR012821"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ1"
FT                   /protein_id="ADQ16052.1"
FT                   /translation="MKYYVQLFSPHGLIRHKNAEIGRDKDTGGQVKYVLELLEALSHDH
FT                   RIRKIDLVTRKIVDKRVPSDYGREIEIVNDKARIVRIQCGGLLYKEKESLWNHLDEFVD
FT                   KVIRFTEAQEDFPDVVHGHYADGNYIAGELSKVFNTIFIATGHSLGRNKKNILLREGLS
FT                   AEKINTRFNIEKRIQVEENTLSMADAIIVSTQHEIASQYKLYENNGKARFQVIPPGINH
FT                   HIFYPYFRAVMPGFTMSTEEEIATFRINSEIERFLFSPEKPLILSIGRADKRKNFETII
FT                   NSYGKDKELQAMANLAIFAGVRKDISLMSPDEQETLTNLLLLMDKYDLYGKMAIPKKND
FT                   PFNEVPEIYRIAARKKGVFINATPGENFGLTIVESAACGLPVVASPTGGPKDIVENLEN
FT                   GLLVNVEKPEEIANGLKSVLADGQQWEEYSEKGIIRSKEMYSWDAHAKKYIQLLDSISE
FT                   KEQKTETGKAPGNTLLKTPVYFISDLDGTLIEGEEAPGLSELVDFLKENNNRVVFGIST
FT                   GRNVQLTREALSQHPLLSRAEIIICSVGTEIYYTSDFIADKGWEKHINYQWERKKLLEA
FT                   LNDHSALELQEEEAQTPHKLSYYIKGVFGDDQLAELYKMLDDKQLRAKIFVTDNTHLDL
FT                   VPVRSGKGKALHYLSYKWKKPIQNFIVSGNGGNDIGMLGGRTNGIVVSNHSPELVVLKE
FT                   NSNVYFSKNPLAEGVLEGIRHYIKNRKHLYKILEENINT"
FT   gene            282328..282534
FT                   /locus_tag="Lbys_0265"
FT   CDS_pept        282328..282534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0265"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="InterPro IPR000595; KEGG: dhd:Dhaf_3071
FT                   transcriptional regulator, Crp/Fnr family; SPTR: Cyclic
FT                   nucleotide binding regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16053"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ2"
FT                   /protein_id="ADQ16053.1"
FT                   /translation="MERYRNFKLFHDISTEDYSLLTDKLKPKTFKKGQLINVPGQVQKE
FT                   LYFVKSGVQMSYFEVLPIFWTAE"
FT   gene            282555..282836
FT                   /locus_tag="Lbys_0266"
FT   CDS_pept        282555..282836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0266"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: paa:Paes_2107 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Transposase IS3/IS911 family protein;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16054"
FT                   /db_xref="GOA:E4RUQ3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ3"
FT                   /protein_id="ADQ16054.1"
FT                   /translation="MKKERRKFSADFKAKVALEAIKERNTVLQISSKYKISPAQVTKWK
FT                   HEFLEKATTVFEKESPNQKESEKKEQELYSKIGELQVQVDFLKKVLGK"
FT   gene            282833..283705
FT                   /locus_tag="Lbys_0267"
FT   CDS_pept        282833..283705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0267"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: gfo:GFO_1996
FT                   integrase/transposase; PFAM: Integrase catalytic region;
FT                   SPTR: Integrase; PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16055"
FT                   /db_xref="GOA:E4RUQ4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ4"
FT                   /protein_id="ADQ16055.1"
FT                   /translation="MSVHQKRSLIVRSYRKLSVSKQCALLELPRSSYYFKSRGENLLNQ
FT                   FLMNKIDAKFTECPFYGVERMTDYINYNYGLGVNVKRIRRLYKIMALDTLMPKPGLSKK
FT                   AKDAFIFPYLLNNLTIDRPNQVWQADITYIAMQRGFMRAAFRYKFAIIDVHSRKILGWG
FT                   TSNTMSVAWMIEVLESVIRKYGKPEIFNSDQRSQFTSIKFVSLLKKHKIKQSVDGKGRA
FT                   LDNVFIERYWRSYKYEYLFLNPPKDAWELFSETEKYVKFYNKERRHEALERLTPNEVYF
FT                   NYRKLPNVS"
FT   sig_peptide     282833..282904
FT                   /locus_tag="Lbys_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(284144..284419)
FT                   /pseudo
FT                   /locus_tag="Lbys_0268"
FT   gene            complement(284483..288439)
FT                   /locus_tag="Lbys_0269"
FT   CDS_pept        complement(284483..288439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0269"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR018062:IPR011110:IPR011123:IPR003661:IPR
FT                   003594:IPR001789:IPR000005:IPR004358:IPR018060:IPR005467;
FT                   KEGG: pru:PRU_2699 sensor histidine kinase/DNA-binding
FT                   response regulator; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Two component
FT                   regulator three Y domain-containing protein; Two component
FT                   regulator propeller; response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   Helix-turn-helix, AraC domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Y_Y_Y domain; Response
FT                   regulator receiver domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; Two component regulator
FT                   propeller; His Kinase A (phosphoacceptor) domain; Bacterial
FT                   regulatory helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16056"
FT                   /db_xref="GOA:E4RUQ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ5"
FT                   /protein_id="ADQ16056.1"
FT                   /translation="MSRIISAILLLLLSACHSPENYLENAAVETEGQAISNKFITSIVE
FT                   DQYGYIWLGTTRGLNRYNGHEFTQFTFNNDSVSLQANVVSALLYDSKNRLWVGTSTHGV
FT                   SLYENGKFKIIPTGSSSNFIAQILEDKSGKIIINTSNDICVFNPEKNTFESKLTYFSKF
FT                   PNPTVLNLEAFDSNNRLWVATQNNISVYDPDFKLIKKLEIPAVKLIHSLYINEFGELWL
FT                   SHSNGISIVDTDTIEFKQLPEKIATYTDFPASGISNIFRYNQRAVILKTFQNELFYFDF
FT                   VTNTLVHQSHKDFPFAAPDFELTTVFTDSRNNLWFGSTDKGFEMVRKSEKIFNEKYLLE
FT                   NALQGKSIMKIVQAKDKNLWILTSKDGIYKYTVSDGQVTKATLPHTGFGKNGNLFFDSN
FT                   GYLWVNSGNDLYQCSVHNSTVSIVKSYKFEETMSSIAEDDNGNIWVAGFGEYIYYKKGD
FT                   TFEKKQFYKPGYNYTTGLTKLRSGEIAVSALGRGVFLINPNTLTTKNIEIKPSVTPFLP
FT                   NQVFEDSNGNLWIPTHLNGLFTYSPTTRQTKNYLNAKAICNDASGIIEDSQGYLWIPTQ
FT                   NGLSKLDPKTDKAIVYFSEDGTGGNQYNFNALAKDDEGRLYFGGTHGITEINPLKAIPE
FT                   QSNKIVIEKVTSDKHKLFETSSQSTPVKRIQLKNWNNSFSIHYTILNYSQLKNYKYEYK
FT                   LEGYNDDWTDAGKSRQANFYKIPPGNYIFKVRASSNSQGEIFETAISLKMLPPWWASSP
FT                   MILLYVLTLGGVSYVFFRLYSSWKTDKDKTLLAEREKQEAIRINELNFNYFSNISHEFR
FT                   TPLTMIKGPVTMLSAQNLNPETLNLLSIIQRNVDKMLGLVNQILDFNNLKDGDSPLKTI
FT                   YLDIIPEIRRNVDLFSFSAKEKNIRLSVQIESGPIMLYLDRDKFDKILSNILSNAIKYT
FT                   PAGGNIEVLVSITDNEYPNTPSTETKLVKVDIKDTGIGIPKKDLKRVFERFYQVNHHNG
FT                   LNHYGTGIGLNYSQRLIRAHHGEIEAFQNETGGTTISIVLPLGNQNYSPSEIISEDSVD
FT                   KPQDSSISSPADNEIETLLGKKEKILIVDDEPEITHFLKTILSADFTIESVFNAEDAIK
FT                   TMETFEADLIISDVLMPGMSGYDFCQYLKENIEYSHIPVILLTAKSTTQEQVKGLYKGA
FT                   DAYIVKPFDPLYLIAVVKSQINNRKKVREILTTTTTTKRMLSEAGISPHDKVLLNEFYA
FT                   LMNEELDNSELNIVKMTERLNLSRTKFYYKIKSLTGENPASFFKTYKLNKAAEYIKTGQ
FT                   YNISEIAYMTGFNTLSHFSISFKKQFGVSPSEFK"
FT   sig_peptide     complement(288362..288439)
FT                   /locus_tag="Lbys_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            288687..291788
FT                   /locus_tag="Lbys_0270"
FT   CDS_pept        288687..291788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0270"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="InterPro IPR012910:IPR000531; KEGG: pru:PRU_2697
FT                   hypothetical protein; PFAM: TonB-dependent receptor plug;
FT                   TonB-dependent receptor; SPTR: Putative uncharacterized
FT                   protein; PFAM: TonB-dependent Receptor Plug Domain; TonB
FT                   dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16057"
FT                   /db_xref="GOA:E4RUQ6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ6"
FT                   /protein_id="ADQ16057.1"
FT                   /translation="MKNVLSQARWRLCYSLFKFLLFFILPLAASAQQSFKGKVTDGKEP
FT                   LIGVSVTVKGTSTGGFTDAEGNFEVKTSLEKPVLVFSMVGYSTKEVAAVSSGNIEVVME
FT                   ESNIGLDEVVVVGYGVQRKSDLTGAISQVKTEDIENRTVVNAQQALQGKAAGVQVIQTS
FT                   GAPGSNPTIRIRGFSSNSSSDPLYVVDGLRTSNIAGIDPNNIESMEVLKDAASAAIYGA
FT                   QAGNGVILITTKKGKSGVAKITYDYQMSTSELNRIPKVMNAQQYVSYMTEANFITPNEV
FT                   NTLWDGVTNTNWADIAFEKSLMHRHNLGLQGGNEKGTYFVGLSYLDQDGIVVGNQDVYN
FT                   RVSGMINGDYKIRPWLKIGTTNTLEKWTSQTVSENSEYGSLLAAVLTMDPLTPNLYSEN
FT                   NLPDFMKSHLQVGRALIRNSSRDYYGVSRIFESEQIHPGIMRDVNQNKNSGANILGTMF
FT                   MDIMPLKGLVFTSKFGYRGAFSNNHTFQDMYYANAVAYRDKINMSRTNSNSIYYQWENF
FT                   ANYHFKLKSHDFTVMAGTSYQHTETASVNAAGNELIKNDLPYRDLDFLAPTATRTIGGI
FT                   QLYTRQLSYFGRLSYNYLDKLLFQASLRRDASDNSILPYENRWGTFPAMSLGYVISKEK
FT                   FFPKTDWISFLKVRASWGQNGSTGPLGGYAYLASIMSGGMYPYSSDINYQVASSPNTLT
FT                   NPNLKWETSEQTDFGIDLRAFDNRFSATLDYFHKKTSGLLVAITPPYETGVTSTVVNAG
FT                   NVTNKGFEAELGWEDQFSSGFKYGIKGNIATLKNKVTYLDPSISRISGASYHTFTGITA
FT                   FEQGLPVWYFRGYELQGINRETGDPIFKDQFTVDTNGDGIPDQGDGIINDQDMAMIGSA
FT                   IPDFTYGITLTGSFKGFDLTVFGAGSQGNQIYNALTRIDRPRGNKLSIFYDERWTPTNQ
FT                   DAPRPRPNANGEDKYWISDAAIFDASFFKIKQLQIGYRLPSSLLSKLKVDNCRVYTSLD
FT                   DWFVFTKYPGMDPEASAGSTSALGVDKGAYPIAKKLVFGINLSF"
FT   sig_peptide     288687..288779
FT                   /locus_tag="Lbys_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            291794..293371
FT                   /locus_tag="Lbys_0271"
FT   CDS_pept        291794..293371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0271"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: pru:PRU_2696 putative
FT                   lipoprotein; PFAM: RagB/SusD domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16058"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ7"
FT                   /protein_id="ADQ16058.1"
FT                   /translation="MKNIVYKIAIIIVVAVSSACENHLRIVQPGATSVENFYKTDKDAE
FT                   EAIAAVYASWRASLYGQFWLKNLLSDDVICGGGSRGDNSMYEQINEYNFGAANTTVSST
FT                   FAQYYNAIYLANLIINRIEPDSDVKKRAVAEAKTIRAAVYFDLVTLWGNVPLVTMELSP
FT                   DEYQQPNGDKNALWNLIETDYKDALQSNSLPQKGSAANTAQPARLTSDAARAFLGKAQL
FT                   FQGKNEEAFENLSTVINDGKHGLVADYENVLRAVSDFSSESVFEFNSIGDDNNAFEQGN
FT                   TLWGIMNGYRSDKLNLSGYFTGLHGIYPSGWGFGNPTSALYQAFLAEEGAEGYRLNNTI
FT                   KTYKQLNNVGIALNPGSSLYGNEGYFNWKHRYLGSEVLVASFGFSTTANFRVLRYAEVL
FT                   LLAAEAAVQTGRNAQALSYINQIRSRAKLKALDNVSLDNIKTEKRLELCFEGVRFQDLV
FT                   RWGDTHFLEKQGEKVPTFTGLNNDGSHTIIYPYSNQTFGFKKGKNELLPFPEHEMNVNK
FT                   NIKQNPGW"
FT   sig_peptide     291794..291886
FT                   /locus_tag="Lbys_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            293365..294168
FT                   /locus_tag="Lbys_0272"
FT   CDS_pept        293365..294168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0272"
FT                   /product="esterase"
FT                   /note="COGs: COG0627 esterase; InterPro IPR000801; KEGG:
FT                   dfe:Dfer_0298 putative esterase; PFAM: esterase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16059"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ8"
FT                   /protein_id="ADQ16059.1"
FT                   /translation="MVTQKIVVAVVLLLASLNSQGQGFIMPPQGKIEYEVIESKVLNTT
FT                   RNYSIYLPKSYKTEESRQYPILYLLHGMNDTHKGWPTRGHVEDVANQLIDGGEVREMII
FT                   VTPDAGTDWNGYFDMEGWSYERFFFEEFLPHIEGKYRVSRGKEERAIAGLSMGGGGSTV
FT                   YAQKHPELFSSVYAMSALMNIPFVGGPPGLDKKLDLLTQSVIANSSIAFVEKADAATLE
FT                   KLKAVNWFVDCGDDDFLLDVNIDYVRAMKKVGIPLQFRIRDGGHT"
FT   sig_peptide     293365..293442
FT                   /locus_tag="Lbys_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            294250..295434
FT                   /locus_tag="Lbys_0273"
FT   CDS_pept        294250..295434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0273"
FT                   /product="esterase"
FT                   /note="COGs: COG2382 Enterochelin esterase; InterPro
FT                   IPR004193:IPR000801; KEGG: pdi:BDI_2687 putative
FT                   glycosylhydrolase; PFAM: esterase; glycoside hydrolase
FT                   family 13 domain protein; SPTR: Putative esterase; PFAM:
FT                   Carbohydrate-binding module 48 (Isoamylase N-terminal
FT                   domain); Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16060"
FT                   /db_xref="GOA:E4RUQ9"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUQ9"
FT                   /protein_id="ADQ16060.1"
FT                   /translation="MKKTILTLSILIMSVIMLHAQQNLDFSGAQGIISPQVNDNNTVTF
FT                   KLDAPKAAEVFLQGDWMPAEGWVPGKVAMKKDEKGIWTYTSESLKSDLFMYNYIVDGLK
FT                   ITDPNNVYQIRDIANMFSIFITNGDQSSAYKVADVPHGTVSRTWYDSPGLKATRRLTVY
FT                   TPPGYERSKESYPVLYLLHGVGGDEEAWISLGRTAQILDNLIAAGKAKPMLVVMTNGHT
FT                   SNAAAPGESSKGLYKPIMMTPDVGSGNMESTFQDVVDFVEKTYRVKKNKADRAIAGLSM
FT                   GGSHTLFISANLNNTFDYVGLFSAAYRLNRPDAKQVPAVYENYEKNLEKQRDNGYKLYW
FT                   IGMGKTDFLYQSGVDFRKLLDDKKVKYTYRESEGGHTWSNWRLYLSEFVPLLFK"
FT   sig_peptide     294250..294309
FT                   /locus_tag="Lbys_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            295472..297829
FT                   /locus_tag="Lbys_0274"
FT   CDS_pept        295472..297829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0274"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="COGs: COG1472 Beta-glucosidase-related glycosidase;
FT                   InterPro IPR017975:IPR019800:IPR001764:IPR002772; KEGG:
FT                   pdi:BDI_2428 beta-glucosidase; PFAM: glycoside hydrolase
FT                   family 3 domain protein; SPTR: Glycoside hydrolase family 3
FT                   protein; PFAM: Glycosyl hydrolase family 3 C terminal
FT                   domain; Glycosyl hydrolase family 3 N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16061"
FT                   /db_xref="GOA:E4RUR0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR0"
FT                   /protein_id="ADQ16061.1"
FT                   /translation="MFCSGMCLNFQNSTKIILNTHEKTIYISRHIFLLISALRPASPQL
FT                   GKNSVQEVLNAMTLEEKVDLLVGAGMPGFGGPTVGQTENLVPGAAGTTKAIPRLGIPAI
FT                   VLADGPAGIRISPTRQNDTQTFYATAFPIATLIASSWNLELAENIGKAMGKEALEYGAD
FT                   VLLAPALNLHRHPLNGRNFEYYSEDPIISGKMTAAAVNGIQSNGVGTSIKHFAANNQES
FT                   LRSKNDVRIKNRTLRELYLKGFEIAVKESSPWTVMSSYNKINGTYTSESRELLTTVLRD
FT                   EWKFDGIVMTDWFGGTNIVKQVHAGNDLLMPGIKPQKDAILQNVKDGKLDVKDVDVNVR
FT                   RILDLILKTPRFKKYPYSNKPDLKAHALIAREAAAEGMILLKNEKLTLPISSETKIAAF
FT                   GVTSYDFISGGTGSGDVNEAYIISLMDGLSAFSVERKLAEKYSVYVGDYKEKNKPDPNN
FT                   PMAAFLNKPRMPELELSESEIGEYAKSTDMAIITIGRNSGEFEDRKTTNDFYLSDEEQN
FT                   LISKVAKAYHSKGKKVVVILNVGGVIETASWKEKPDAILLAWQAGQEGGNSVADILSGK
FT                   VGPSGKLTMSFPNDLKDVASNNNFPIDIELNFQEMMGGGPPNSAQEPRKNLEFTTYEED
FT                   LHVGYRDYITNKKQVSFPFGFGLSYTSFDFRNSKISGDSKVGFTLKVTVKNTGKAKGKE
FT                   IVQIYRSNLNKDPDRELISFGKTKELAPGEVQILTFKINSEDFSIFDESINAWVTKAGN
FT                   YHLLIGKSVSDIILTENVEIKEKFERRVIARF"
FT   gene            297880..298899
FT                   /locus_tag="Lbys_0275"
FT   CDS_pept        297880..298899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0275"
FT                   /product="esterase"
FT                   /note="COGs: COG0627 esterase; InterPro IPR000801; KEGG:
FT                   srm:SRM_02222 putative esterase; PFAM: esterase; SPTR:
FT                   Putative esterase superfamily protein; PFAM: Putative
FT                   esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16062"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR1"
FT                   /protein_id="ADQ16062.1"
FT                   /translation="MKQALSIIFLLVSIFGFAQKGSVQTFTINSKALINKGGENPNRSC
FT                   SVYLPPGYEGGKERYPVIYFLHGFTGTDAISPEIKKVLDEGIVRKKIKPYILVIPNHYT
FT                   LYQGSFYTDSELTGNWETFTSKELVDYMDKNFRTLATKESRGIAGHSMGGYGAIKIAMR
FT                   HPEVFSSVYGLSPGLMSFVKEFGPNSPYFKIYQNARTEEELTRAYYPKVLAAVGRAWSP
FT                   NPNNPPFYADMPFTYKGDSLIVNQKVLEKWHRNMPVEMVNDYADNLRKLTAIKLDWGRN
FT                   DSPRFPVQNMAFSQKLENLGINHYAEEYIGTHVDKIWTLDGRVLNAMLPFFNDYLKFE"
FT   sig_peptide     297880..297954
FT                   /locus_tag="Lbys_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            298904..300199
FT                   /locus_tag="Lbys_0276"
FT   CDS_pept        298904..300199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0276"
FT                   /product="citrate/H+ symporter, CitMHS family"
FT                   /note="COGs: COG2851 H+/citrate symporter; InterPro
FT                   IPR014738:IPR004680; KEGG: sli:Slin_4146 citrate/H+
FT                   symporter, CitMHS family; PFAM: Citrate transporter; SPTR:
FT                   Citrate/H+ symporter, CitMHS family; TIGRFAM: citrate/H+
FT                   symporter, CitMHS family; PFAM: Citrate transporter;
FT                   TIGRFAM: citrate transporter, CitMHS family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16063"
FT                   /db_xref="GOA:E4RUR2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR2"
FT                   /protein_id="ADQ16063.1"
FT                   /translation="MLVLYGLLIIGLFLVLIWSKRVPVMIALVMTPVLVAVIAGFSVAD
FT                   IGTFALSGIRQVAPTAVLLMFAVLYFSIMLDSGLFDPVIKTVLKLVKGDPLKVVIGTAL
FT                   LTMLVHLDGDGTATFMIVITAFLPIYKALKMSKLVLAGIVALSVGPIHLVPWSGTSARA
FT                   LSVFEASSAQLFVPNLPAIGAGILWVLFVAWYWGRAEKRRLGVLDFSYTFGEDFSKDKR
FT                   LLRRPKLVLVNAVLTVTVIVLLTLEIVPSSVLFVLASLLVLQINYPKLQEQKMVLSRHG
FT                   NNIFMVVSMIFAAGVFSGILTNGGMTEAMATSLVSGMKSENSGLLVLLTAITSMPASII
FT                   FTPDAYYFGVLPIIKESASQLNIDAVQFGRAALLGQMTVGFPLSPLTASTFLLIGMAEV
FT                   DLGDHQKHTFFWAWGTTLVMTLVAILTGSIFL"
FT   sig_peptide     298904..299035
FT                   /locus_tag="Lbys_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            300200..301513
FT                   /locus_tag="Lbys_0277"
FT   CDS_pept        300200..301513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0277"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="InterPro IPR010839; KEGG: sli:Slin_4147 protein of
FT                   unknown function DUF1446; PFAM: protein of unknown function
FT                   DUF1446; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1446)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16064"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR3"
FT                   /protein_id="ADQ16064.1"
FT                   /translation="MKETIRIGCGAGFSGDRFEPAVILAEKGQLDYLVLECLAERTIAL
FT                   AQQQKQINPDLGYDPFLERRISSLLPFLEKKKIRLITNMGAANPIAAARKVKELCLEQG
FT                   LDLKVAAVTGDDVLGLITGNEMAIETNKPISESGSLVSANAYLGIEGIIESLAADSDII
FT                   ITGRVADPSLFLAPMVFEFGWTDAEQFGQGTVIGHLLECGGQLTGGYFMDVSRKKIADP
FT                   ANLGFPIAEVSRNGAAILSKVDGTGGNLNLRTVKEQLLYEVLNPYKYITPDVIADFSKV
FT                   RLTELRKDEVLVEGGIGAEASNYLKVSVGYKAYHLGEGEISYTGYDAVDRSKLAITILE
FT                   ERLKSDGVQEVRYDLIGLNSINEDKFSVNSFPYDVRLRVAAKCSSKIEAQRIGEEVEAL
FT                   YTNGPAGGGGSRKYYKEVIGIHSIFVRKEDVSFKVTIL"
FT   gene            301510..301812
FT                   /locus_tag="Lbys_0278"
FT   CDS_pept        301510..301812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_4148 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16065"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR4"
FT                   /protein_id="ADQ16065.1"
FT                   /translation="MTKLYHLAHSRAGDKGNTSTLSLIPFKEEDYPLLCEKVTVEKVRE
FT                   HLWSFLQGSITRYELYNIKSLLFVCEGALSGGVTTSLSLDPHGKCLSSLLLEMEI"
FT   gene            complement(301922..303071)
FT                   /pseudo
FT                   /locus_tag="Lbys_0279"
FT   gene            complement(303134..303795)
FT                   /pseudo
FT                   /locus_tag="Lbys_0280"
FT   gene            complement(303773..304122)
FT                   /pseudo
FT                   /locus_tag="Lbys_0281"
FT   gene            complement(304700..305851)
FT                   /locus_tag="Lbys_0282"
FT   CDS_pept        complement(304700..305851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0282"
FT                   /product="beta-lactamase"
FT                   /note="COGs: COG1680 Beta-lactamase class C and other
FT                   penicillin binding protein; InterPro IPR001466; KEGG:
FT                   sli:Slin_2778 beta-lactamase; PFAM: beta-lactamase; SPTR:
FT                   Beta-lactamase; PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16066"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR5"
FT                   /protein_id="ADQ16066.1"
FT                   /translation="MRTKIVARIFFIAFHTASCQQDDITAPTLATCASEYTHHPLHEPY
FT                   MKLLDIYQKGTIAPGSILAIKQNGKEPWIGATGYSNLDHMTKMMVCTPFRTGSVTKMYT
FT                   AALILKLVENGLIDLDDKVTTHLPALQGKIPQVDEIIIRNLLNHTSGLSHPTDDNLEYQ
FT                   LGLINNAEYFASLTSRQRLQRYIYNEPLKYTPGSMTQYSNAGYWLLEWIIESVTGKRFA
FT                   ECLQEHILTPLGLKETYIHRKENHNVARGYNSSGPYLQDVTRWDAADSDGDPAAGIIST
FT                   AEELLIFGEGLFSGKLLNSETLKAMTAIFEDPHCKDCGYGLGLEKWKLGSYTGYGMNGS
FT                   SLGVDANLLYFPEQKCTLVLFSNYGGGNSKEILEAALHLSKDN"
FT   sig_peptide     complement(305789..305851)
FT                   /locus_tag="Lbys_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(305867..306466)
FT                   /locus_tag="Lbys_0283"
FT   CDS_pept        complement(305867..306466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2779 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16067"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR6"
FT                   /protein_id="ADQ16067.1"
FT                   /translation="MKKRKLWQKVCSAILSVGALLFSQSTAQAQSNLPGLLLKIGLHLE
FT                   QVALPGVSGLKYGLNPGILIGAEYQYKSTGKVTLFHSLEYSVSANKSYGANNVFSTYFG
FT                   PRFVNKDNQISLGVGGGFNLFRPANPLYQNKQTDYVRKATQGKWLAGATVKYGHQFGKY
FT                   IPYASYGCYVDTPFLNSSSSILPHQFIQVGLKMAGS"
FT   sig_peptide     complement(306380..306466)
FT                   /locus_tag="Lbys_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            306787..306903
FT                   /locus_tag="Lbys_0284"
FT   CDS_pept        306787..306903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16068"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR7"
FT                   /protein_id="ADQ16068.1"
FT                   /translation="MAANLEAFQPIWMNFSTNSLIVQRRPLFIDERLADGCS"
FT   gene            307167..307706
FT                   /locus_tag="Lbys_0285"
FT   CDS_pept        307167..307706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0285"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR013096; KEGG: dfe:Dfer_1447 cupin 2
FT                   conserved barrel domain protein; PFAM: Cupin 2 conserved
FT                   barrel domain protein; SPTR: Cupin 2 conserved barrel
FT                   domain protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16069"
FT                   /db_xref="GOA:E4RUR8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR8"
FT                   /protein_id="ADQ16069.1"
FT                   /translation="MKETIINPVIKDQVTFMQTAAASQGRITTLQVSLMPGGGTPMHYH
FT                   KNFTETFVVVEGILTLKLSSSTIHLFPGEKYTVEIGQVHAFANESSEPVVFTTVVSPGC
FT                   EGFEFALRILYGLAADGQTDKKGLPKSLLALAVVSKISDIRPAGAGALMIPLFGLLNLI
FT                   AQLNGFKKELLRRYCS"
FT   gene            307758..309209
FT                   /locus_tag="Lbys_0286"
FT   CDS_pept        307758..309209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0286"
FT                   /product="esterase"
FT                   /note="InterPro IPR000801; KEGG: aca:ACP_2491 putative
FT                   lipoprotein; PFAM: esterase; SPTR: Putative secreted
FT                   protein; PFAM: Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16070"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUR9"
FT                   /protein_id="ADQ16070.1"
FT                   /translation="MKEFCFLLLFLPNALHAQVRVNVHLAPNLMGPYSGQLLVYTLSDT
FT                   SKHFSDDTFENEAAFTMQVPEWTQGKVITLPPDVPFFNIGLKDLKDGYYRMVAILRTNT
FT                   SEHRKLSVGNLYTRKEVILKVQKGQDSSVDLELNAAIPDQVFREDEHTKLLKFLSPSLS
FT                   TQKKKDTYILAGIYLPPSFYRDTDRNYPVVFVHPGWGGTHFQATNPSIRKLYGVGLGEE
FT                   KIFVFMNPEAQTPYGLHAFVDSRVNGDWGTAFVQEFIPYLVKQYRVNPDPKLHFLTGQS
FT                   SGGYGALWLALHFSTSFGGTWVTSPDPIDFTHFTGVDIYHDQNYYYDQNGKERGFMTVE
FT                   GTFKSTLKKTIQLERFEGDGGQQQSFEAEFGLPDEKGRPVHLMDVLTGEINKEVAESWK
FT                   PYDLALYTLNNIEKLKKLAGPVKIFVGGKDNFLLHKSAQAFQEKTKNLGLNIHVITLPE
FT                   ADHFNVRTVELSAEMQSEIDQLIKN"
FT   sig_peptide     307758..307832
FT                   /locus_tag="Lbys_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            309234..309728
FT                   /locus_tag="Lbys_0287"
FT   CDS_pept        309234..309728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0287"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0431 flavoprotein; InterPro IPR005025;
FT                   KEGG: fjo:Fjoh_2187 NADPH-dependent FMN reductase; PFAM:
FT                   NADPH-dependent FMN reductase; SPTR: NADPH-dependent FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16071"
FT                   /db_xref="GOA:E4RUS0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS0"
FT                   /protein_id="ADQ16071.1"
FT                   /translation="MKRILVINGSASEHSSNGLLIEQLISLGSSFFEFEKFESLKSLPH
FT                   FDPKPVEIPDAVVLFWKKVEEADKVLFCTPEYIFSIPSGLKNALEWSVSTTIFSGKSIG
FT                   IITASASGVLGHEELQRIMKTLGAHFSPENTLLISGIKGKAGVDPELDEKLSLFLSSWE
FT                   N"
FT   gene            complement(309725..310153)
FT                   /locus_tag="Lbys_0288"
FT   CDS_pept        complement(309725..310153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_1619 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16072"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS1"
FT                   /protein_id="ADQ16072.1"
FT                   /translation="MKSPLSLLVILCMACKTPQKLKNELYQAELAFSASSAQKGFYAAM
FT                   LDVASEEIALFDTGDTVINGLPHIHKNIQKFLESPTPPYTLTWKPEKVDVARSGDLGYT
FT                   YGWYTLSQNDSLGNIKIKKGLYSSIWKKIQREWKLVLD"
FT   sig_peptide     complement(310112..310153)
FT                   /locus_tag="Lbys_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(310155..311390)
FT                   /locus_tag="Lbys_0289"
FT   CDS_pept        complement(310155..311390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msv:Mesil_3342 phosphoribosylglycinamide
FT                   synthetase, N-domain protein; SPTR:
FT                   Phosphoribosylglycinamide synthetase, N-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16073"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS2"
FT                   /protein_id="ADQ16073.1"
FT                   /translation="MKYFLGITIALLFVSCKDPDIEDSPKEPLKTSHGEFIGTLLQAMI
FT                   GPEGGLMKSPGITVSIPKSAVEKETQFMIQEVAPNPNLSIVKVYRILPEDIVLKKEVEI
FT                   TLSYTEEDYAGSDEDFLFPGYQDAEGLWHKMMNCTLDKGKKELKVKTKHFSDWGIFREI
FT                   RIHSPKDEIGSKEEVELELFAQDMYAETADADDYLLTASAISSDKIMEWKVISGGGTIS
FT                   GGKSSKVRFTAPETDSKIEVIIEVTAKNLISKSHPDRPGSGGMVIIRKTLTILPEEYVI
FT                   WTIGGKKFTSKFHALGVFNGESILTATAVESEIGFRANGTKLGKYSFGKLTDPQSSQFT
FT                   GSFNLVSYLSEYTECNTFKKVYGEGSVVFEIFGESGGGIVQGTFEGVLYKLGDCDVSNK
FT                   HIYGTFRIKRTY"
FT   sig_peptide     complement(311325..311390)
FT                   /locus_tag="Lbys_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(311387..312370)
FT                   /locus_tag="Lbys_0290"
FT   CDS_pept        complement(311387..312370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phu:Phum_PHUM430290 ankyrin repeat-containing
FT                   protein, putative; SPTR: TonB-dependent receptor plug
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16074"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS3"
FT                   /protein_id="ADQ16074.1"
FT                   /translation="MYKYIIFLMVWLASCKDTSEVNSAVNWGEQPELPEVSGQATFNLS
FT                   GSQYYVNVMGNTIPRMPNFPALSVKGGIARGYVADLRGNPLKGAHIGVSSSLTGGFYSS
FT                   GSGYTDENGYYQFSIPAGAAYFFGTAITVNYNDTPTVMALYPVGGTSSFPSGNGVVKNF
FT                   VLLSYGTGNPDELAAQPSNESNYYGGALSFGFQLNYPGDPFQDPEYLPSDGTIEIELVP
FT                   IEPGMYGEKRSFKIRKKIGNTTLFSIHNIPIGKYSIKAQMSDGRKLKMRAVGPLANVFE
FT                   KLGLSPDEAIGTSTVTFTPNYKYTPVMVSSFKSNWDALEIDLRIAQ"
FT   sig_peptide     complement(312326..312370)
FT                   /locus_tag="Lbys_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(312452..313258)
FT                   /locus_tag="Lbys_0291"
FT   CDS_pept        complement(312452..313258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4527 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16075"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS4"
FT                   /protein_id="ADQ16075.1"
FT                   /translation="MKALRWKFIIVALSIGAAACDPESNSEPIPDAEKDNYIPRVNTKY
FT                   HYSVIEDGVNIGTAEKRVISSRDSSGIKLYNLRTDLQFAEGGMTLYNEIYDANARTYTQ
FT                   VNMPDAWYLIIEELRKNPDIIIDEARVTGFPYFMVMDNALVEGSNLTWEIPEDPGQIIK
FT                   YRRKDAEHLVFQMKQTLLHQPTKAAAVESVTVPAGTFVCTKYIYEIAQDQTLSLNGEPV
FT                   VTITGTETVTIWMAHGIGLVKQENTTIFNQKITRSSIILNKIAPTS"
FT   sig_peptide     complement(313181..313258)
FT                   /locus_tag="Lbys_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(313327..313932)
FT                   /locus_tag="Lbys_0292"
FT   CDS_pept        complement(313327..313932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0292"
FT                   /product="YceI family protein"
FT                   /note="InterPro IPR007372; KEGG: dfe:Dfer_0371 YceI family
FT                   protein; PFAM: YceI family protein; SPTR: YceI family
FT                   protein; PFAM: YceI-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16076"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS5"
FT                   /protein_id="ADQ16076.1"
FT                   /translation="MKTKLFTALLAAVVLSSCSSKESIGTFEYKADEEASAIEWKGSAP
FT                   DHFHEGAFKVSATIQTNSDGKITAGEFKIPIASITNYDIPDETVKEQLLNHLLSPDFFN
FT                   VALHPNAHFKITGVEEYQSAETNVNYLIIGDFSLLGQTHTIKIPAFIKVENNQISAVGS
FT                   FILDRHKWEMNSYNDPAAPLYILPEVDIKLNLKFKKSN"
FT   sig_peptide     complement(313855..313932)
FT                   /locus_tag="Lbys_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(313939..314391)
FT                   /locus_tag="Lbys_0293"
FT   CDS_pept        complement(313939..314391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0293"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="COGs: COG1917 conserved hypothetical protein
FT                   contains double-stranded beta-helix domain; InterPro
FT                   IPR013096; KEGG: cpi:Cpin_3791 cupin 2 conserved barrel
FT                   domain protein; PFAM: Cupin 2 conserved barrel domain
FT                   protein; SPTR: Cupin 2 conserved barrel domain protein;
FT                   PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16077"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS6"
FT                   /protein_id="ADQ16077.1"
FT                   /translation="MNEYRAYQGGYFKTLLQPSGAGSKLAMIEFTLPKGSEPPKHVHTL
FT                   EDEAFYVLEGELGVEIGESYQVLKAGEALFAPRLVPHSFRILTDQAKFINIIAPGDLWN
FT                   YFIEVSKPIPNQLKEVAAIRPSVETINAQLERISTTYQVKFLLTNP"
FT   gene            complement(314845..315573)
FT                   /locus_tag="Lbys_0294"
FT   CDS_pept        complement(314845..315573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0294"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="COGs: COG3279 Response regulator of the LytR/AlgR
FT                   family; InterPro IPR001789:IPR007492; KEGG: phe:Phep_1841
FT                   response regulator receiver; PFAM: LytTr DNA-binding
FT                   region; response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Response regulator receiver;
FT                   PFAM: Response regulator receiver domain; LytTr DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16078"
FT                   /db_xref="GOA:E4RUS7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS7"
FT                   /protein_id="ADQ16078.1"
FT                   /translation="MTKIRTLIVDDEPHAMEIIRRYATHIPEIEIIGTCNNAIEAFQTI
FT                   QYQAIDLLFLDIKMPKLLGTDLVRSLKSPPMIIFTTAYQEYAVEGFDLNAIDYLLKPIP
FT                   LKRFLQAIDKVMHFLHGEKATELAQEEIQHTQDHFLYLRVERRLIKVNTRDILWIESIK
FT                   DYIMVVTKEKTYQTKQKISVTEKLLPQGEFMRIHRSYIVPLNRVEGYHPNHLLVDGNKI
FT                   PIGRNYKQACAEKFDPKGTY"
FT   gene            complement(315570..316580)
FT                   /locus_tag="Lbys_0295"
FT   CDS_pept        complement(315570..316580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0295"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="COGs: COG3275 Putative regulator of cell autolysis;
FT                   InterPro IPR010559; KEGG: phe:Phep_1842 histidine kinase
FT                   internal region; PFAM: histidine kinase internal region;
FT                   SPTR: Histidine kinase internal region; PFAM: Histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16079"
FT                   /db_xref="GOA:E4RUS8"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS8"
FT                   /protein_id="ADQ16079.1"
FT                   /translation="MSFILLTIIYGTAYGSYVLGAEVILLHLPIHMGYFYLITQWVLPQ
FT                   FFFKEKYIQTFLVILLLIPTIAILYRLTEIFISNPLVYKYYHDHGNPIEWSSLQLPWHQ
FT                   QLTQPTDFANALERTNTVVWICVTIRLFILWQERKQSILQAELNFLKGQLHPHFLFNSL
FT                   NNLYALSLEQSPQTPDIILGLSHMLRYVLYDCTAEKVPLKKDVEALINYIELEKLRYED
FT                   RLELNVNINPKIGEEEIAPLLMLPLVENAFKHGAAEATDTPWINIELHLNNKELTFKVS
FT                   NSKPDQVHPTNHKGEIGLLNLRKRLVLLYPGQHTFEYYDESDCFIAELTVQLEKP"
FT   sig_peptide     complement(316521..316580)
FT                   /locus_tag="Lbys_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(316735..317628)
FT                   /locus_tag="Lbys_0296"
FT   CDS_pept        complement(316735..317628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0296"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro
FT                   IPR000005:IPR020449:IPR018060; KEGG: cpi:Cpin_3787
FT                   transcriptional regulator, AraC family; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: Transcriptional
FT                   regulator; PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16080"
FT                   /db_xref="GOA:E4RUS9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUS9"
FT                   /protein_id="ADQ16080.1"
FT                   /translation="MEDILHFKSIKEYNDFNNNETLHPLISVVHLDKAAPRKLRKLRYG
FT                   FYTIFLKKVHCGDLRYGLSHYDYEEGTLIFLAPHQIIGENKEEFYQPQGLALIFHPDFL
FT                   LGTDLGRKISDYHFFSYAVNEALHLSTQERAIILDCINKIEYELQHAIDKHSKNLIISN
FT                   LELFLNYCTRFYDRQFITRDHVNRGVLQRFEVLLNAYFNSAKTQSLGLPTVAWCADQFH
FT                   LSPNYFGDLIKKETGISAQEYIQNKIIQLAKEKIFDPQKTISQIAYELGFRYPQHFSRL
FT                   FKQKTGVTPKGFKVLN"
FT   gene            317806..318765
FT                   /locus_tag="Lbys_0297"
FT   CDS_pept        317806..318765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0297"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR000835; KEGG: fjo:Fjoh_4033
FT                   GCN5-related N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; regulatory protein MarR; SMART:
FT                   regulatory protein MarR; SPTR: GNAT family
FT                   acetyltransferase; PFAM: Acetyltransferase (GNAT) family;
FT                   MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16081"
FT                   /db_xref="GOA:E4RUT0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT0"
FT                   /protein_id="ADQ16081.1"
FT                   /translation="MKKLDFKTLDSTHSASITDMILSIQQKEFGIPITVDDQPDLSDIE
FT                   TFYLRGGGCFLGAFLNGDLVGTIALIKFSSSSGAIRKMFVKKEFRGKEWGIAQKLLERL
FT                   IQFCRAEGISNLYLGTVSVLKAAQRFYERNHFRRLQKEELPSDFPLMSSDDVFYGLKLG
FT                   SAIEEVGFLALSTRLQRLSERIRRDGALIYKAFGRNFDPKWFPVVLSLDRKGELSISEL
FT                   AEEIGYSHPSTIVLLKELQEKGYVSSKKDISDERKRLNFLSENGKQFIKELKPIWEIMS
FT                   TVLEEIGSNSHHLLRAIEQAEDKLEVQTFYQRVLAIRQ"
FT   gene            complement(318907..319680)
FT                   /locus_tag="Lbys_0298"
FT   CDS_pept        complement(318907..319680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_3161 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16082"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT1"
FT                   /protein_id="ADQ16082.1"
FT                   /translation="MNHLRLGIVLMAMLWGCSKDLRILDEEDLPFDSISPVKNEPGFGE
FT                   TDGEHQGTPFTLPAGVRLVDRPHHRFDPDIEKLYGKINTFYVDIHLVRDSTWKGESVVF
FT                   PPGLILTSQGEGRRQHGLLIGRELIPVPYYRQGTSNDTLTYYLGVACINAKKAFPWEDN
FT                   FEDDVKEYVIGKGMYKPTVITQNPQILQFLSLFEDKEHLKVTQHINPWDQFNEGYVRPS
FT                   WQIKYDVIQEMLWKITDEKGLTKRDLSELLIAIER"
FT   sig_peptide     complement(319627..319680)
FT                   /locus_tag="Lbys_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(319881..320204)
FT                   /locus_tag="Lbys_0299"
FT   CDS_pept        complement(319881..320204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0299"
FT                   /product="small multidrug resistance protein"
FT                   /note="COGs: COG2076 Membrane transporter of cations and
FT                   cationic drugs; InterPro IPR000390; KEGG: cpi:Cpin_4003
FT                   small multidrug resistance protein; PFAM: small multidrug
FT                   resistance protein; SPTR: Small multidrug resistance
FT                   protein; PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16083"
FT                   /db_xref="GOA:E4RUT2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT2"
FT                   /protein_id="ADQ16083.1"
FT                   /translation="MNWIILIIAGLFEVGFTFCLSKAKEAIGNESYLWYGGFGICLIIS
FT                   MGLLMKATQSLPIGTAYAVWTGIGAVGTVLMGILFFKEPATFMRMFFISTLIASIIGLK
FT                   LSH"
FT   sig_peptide     complement(320154..320204)
FT                   /locus_tag="Lbys_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(320260..320823)
FT                   /locus_tag="Lbys_0300"
FT   CDS_pept        complement(320260..320823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0300"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="InterPro IPR000595; KEGG: fjo:Fjoh_3294 cyclic
FT                   nucleotide-binding protein; PFAM: cyclic
FT                   nucleotide-binding; SPTR: Cyclic nucleotide-binding
FT                   protein; manually curated; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16084"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT3"
FT                   /protein_id="ADQ16084.1"
FT                   /translation="MVKNAFIHLLQKIHEIPSSAVKLVENKVQMLEVKKGDLLIKSGSR
FT                   NNFVYLIAEGLVRGYDANDVTFWFGETGDVVLSLKTYTEDLSGHESMEALEKTLVYKIS
FT                   IKDLKELYQTNLYWANWGRVMAEKELVKAEKRLLSRQFLSAGERYAELMEQHPNLLQRV
FT                   PLGMIASYLGITQVSLSRIRAEYR"
FT   gene            320804..321172
FT                   /locus_tag="Lbys_0301"
FT   CDS_pept        320804..321172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0301"
FT                   /product="protein of unknown function DUF486"
FT                   /note="COGs: COG3169 conserved hypothetical protein;
FT                   InterPro IPR007437; KEGG: dfe:Dfer_2981 protein of unknown
FT                   function DUF486; PFAM: protein of unknown function DUF486;
FT                   SPTR: Putative uncharacterized protein; manually curated;
FT                   PFAM: Protein of unknown function, DUF486"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16085"
FT                   /db_xref="GOA:E4RUT4"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT4"
FT                   /protein_id="ADQ16085.1"
FT                   /translation="MKAFLTIGLLLVSNVFMTIAWYGHLRLKEYSWFSNMGLFKVILFS
FT                   WGIALLEYMAQVPANKIGYTGNGGPFTLWQLKVIQEVLTLLVFTGFAVFAFKTETLRWN
FT                   HLVAFVFLVLAVYFIFKK"
FT   sig_peptide     320804..320869
FT                   /locus_tag="Lbys_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(321174..322190)
FT                   /locus_tag="Lbys_0302"
FT   CDS_pept        complement(321174..322190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0302"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3503 membrane protein; KEGG: sli:Slin_2897
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF1624)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16086"
FT                   /db_xref="GOA:E4RUT5"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT5"
FT                   /protein_id="ADQ16086.1"
FT                   /translation="MKRFQSIDSLRGLVMVIMALDHVRDFFHTTALTANPTDLNTTTPA
FT                   LFWTRVITHLCAPTFLFLSGVSVYLNKTENKRQYLLTRGALLILFDFTLIAFGLFWSFQ
FT                   SLLFNVLAAIGTGFILLAFLYRVPKKVLLIIGILLVVGNAFLPIPGLTAPTAFLLSKSI
FT                   LFIVGYPPLPWFGIMLIGYAIAPQFLEKKTWIWGIIGLFLFFLLRFWEIKDFDLLNLFN
FT                   VNKYPPALSFTLLTLSVMALLFSYFQRRPSHFLNVFGRVPLFYFIVHWYVMHILLFAYL
FT                   LIEGFTPSQFEFGQNLGRPGSWSGVELPGVYLAWILTVLIMYPLCQLYYKKGRIKYI"
FT   sig_peptide     complement(322134..322190)
FT                   /locus_tag="Lbys_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(322268..324619)
FT                   /locus_tag="Lbys_0303"
FT   CDS_pept        complement(322268..324619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0303"
FT                   /product="peptidase S9B dipeptidylpeptidase IV domain
FT                   protein"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; InterPro
FT                   IPR018195:IPR010916:IPR002469; KEGG: sli:Slin_2851
FT                   peptidase S9 prolyl oligopeptidase active site domain
FT                   protein; PFAM: peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; SPTR: Peptidase S9 prolyl oligopeptidase active
FT                   site domain protein; PFAM: Prolyl oligopeptidase family;
FT                   Dipeptidyl peptidase IV (DPP IV) N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16087"
FT                   /db_xref="GOA:E4RUT6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT6"
FT                   /protein_id="ADQ16087.1"
FT                   /translation="MRRIFTVCLVLLFSLTVQAQLTVEKIMEDPAKWIGTSPSNIFWSE
FT                   DSKTIYFNWNPEQNRADSLYKITLTNRTPQKVSRAEKESLGLSGFGRSAAYSKDFRKKL
FT                   YLKNGNIFIQDTGTLAERQLTNTLDRKGSLSFSKDEKHVIFTMGNDIYTIALADGTLQQ
FT                   WTNFSMENRRPEAKAGEADKVLEKDQLDLFQFLREAKEDKEAREKYEKGAPKTGPKKIS
FT                   LGGKMLQGALASPDLKYVFYRLAEPARDAKRTIVPNYVTASGYTEDIPARTKVGQPTGS
FT                   TEAFVYHIAKDTVFKINLKDIPGIEDEPQYLADYPDRPKSKNKVRSVSFQNPVWSPDAT
FT                   YAVIAIRSNDNKDRWIMKLDGETGKLSPIDRQHDEAWIAGPGIGGGFGGSGIGFIDEHT
FT                   LYFQSEETGYSHVYTYDMRTGTKKALTSGNFEVQTLELSKDKQWFYMTTNEVHPGEKHF
FT                   YKMSVNGGERIKLTSMTGGNEVTLSPDEKMIAIRYSNANTPWELYLQPATPGAVAEKIT
FT                   SSTTAAFNAYAWKMPQVISFTARDGKEIYARVYEPTKKKKNGKAVIFVHGAGYLQNAHK
FT                   WWSQYFREYMFHNLLTDLGYTVMDIDFRASSGYGRDVRTGIYRHMGGKDLTDNVDGAKL
FT                   LVEKYGINPKKIGIYGGSYGGFITLMAMFTTPDVFAAGAALRPVTDWAAYNQGYTANIL
FT                   NEPHLDPIAYRRSSPIFFAEGLKGKLLICHGQVDVNVHIQDTYRLAQRLIELRKENWEV
FT                   ASYPVEDHGFVQPTSWMDEYKRILKLFESM"
FT   sig_peptide     complement(324563..324619)
FT                   /locus_tag="Lbys_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(324709..325218)
FT                   /locus_tag="Lbys_0304"
FT   CDS_pept        complement(324709..325218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fba:FIC_01559 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16088"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT7"
FT                   /protein_id="ADQ16088.1"
FT                   /translation="MNDLIEILKTRFHKYPERHPEFTWEQVEEKLSPKVLQILEVLEES
FT                   EGEPDIVGPELQFIDCSPESPKGRRSLCYDQEALEKRKEHKPNGSAVKWATDLGVRLLT
FT                   EEEYIHLQSRVAVDQKTSSWLQTPKEVRDKGGAIFGDKRYGRVFIYHNGADSYYAARAF
FT                   RCVLKL"
FT   gene            complement(325218..325658)
FT                   /locus_tag="Lbys_0305"
FT   CDS_pept        complement(325218..325658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_3562 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16089"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT8"
FT                   /protein_id="ADQ16089.1"
FT                   /translation="MSTKVLQFCLILLLVNVACKDSAPSIEEKIQKVYTAVSVTQDGLT
FT                   VYTQGGPSNLVPQYSTFKLDLSVPGKAVLKDITAETFTGNYTVTDQVLTLTQLNPEPTG
FT                   TGGTMSYSITSISEDGKSLVLTTTKGQPKTGHTINVYTLKSN"
FT   sig_peptide     complement(325590..325658)
FT                   /locus_tag="Lbys_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            325732..325977
FT                   /locus_tag="Lbys_0306"
FT   CDS_pept        325732..325977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0306"
FT                   /product="cytochrome b5"
FT                   /note="COGs: COG4892 heme/steroid binding protein; InterPro
FT                   IPR001199; KEGG: phe:Phep_3698 cytochrome b5; PFAM:
FT                   cytochrome b5; SPTR: Putative uncharacterized protein;
FT                   PFAM: Cytochrome b5-like Heme/Steroid binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16090"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUT9"
FT                   /protein_id="ADQ16090.1"
FT                   /translation="MENTITKRQLSLRNGVDKPEIWIAYKGQVYDVSSSRLWRGGKHYE
FT                   HWAGQDLTHELEDAPHTEKVFEKFERIGIYEENNSI"
FT   gene            325955..326137
FT                   /locus_tag="Lbys_0307"
FT   CDS_pept        325955..326137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_3269 hypothetical protein; SPTR:
FT                   Phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16091"
FT                   /db_xref="GOA:E4RUU0"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUU0"
FT                   /protein_id="ADQ16091.1"
FT                   /translation="MKKITLFDAVLLFCSFGLLAMFVDQFIYKKNSFADSYFFLMFGFA
FT                   GILYFLYRKGSKKQN"
FT   sig_peptide     325955..326056
FT                   /locus_tag="Lbys_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(326120..326872)
FT                   /locus_tag="Lbys_0308"
FT   CDS_pept        complement(326120..326872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_3077 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16092"
FT                   /db_xref="GOA:E4RUU1"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUU1"
FT                   /protein_id="ADQ16092.1"
FT                   /translation="MKTLKLIYLSSLHVALATGVCAAAFFKLNHGVIDPISLLQIMLGC
FT                   WMVYILDRILDVKREHPDTDRHQFHQEFQYNLQILAVALAAINGFLLFFQSKEVLILGA
FT                   CLGLTTLFYLFYLVPNFPKLKDYAMPLIYVGAVVGVPFVEAPSIQLSSWVLGFLFFMLV
FT                   YQNLATFAYFEERSASRRKRVTFLGSVSLFLFIFLFAGGFEYQNKLAFILAIISITNSF
FT                   VIAKADYFEKSYRWILDGLLFLPLILLF"
FT   sig_peptide     complement(326807..326872)
FT                   /locus_tag="Lbys_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(326875..328296)
FT                   /locus_tag="Lbys_0309"
FT   CDS_pept        complement(326875..328296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0309"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="COGs: COG2027 D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 4); InterPro IPR000667; KEGG:
FT                   sli:Slin_2717
FT                   D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-alanine-
FT                   endopeptidase; PFAM: peptidase S13 D-Ala-D-Ala
FT                   carboxypeptidase C; PRIAM: Serine-type D-Ala-D-Ala
FT                   carboxypeptidase; SPTR: D-alanyl-D-alaninecarboxypeptidase/
FT                   D-alanyl-D-alanine-endopeptidase; TIGRFAM:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   D-Ala-D-Ala carboxypeptidase 3 (S13) family; TIGRFAM:
FT                   D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16093"
FT                   /db_xref="GOA:E4RUU2"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E4RUU2"
FT                   /protein_id="ADQ16093.1"
FT                   /translation="MKYKDTILAGIFVNILMKLICFILLQLNVFSSGINKHIQSFRSAK
FT                   GQEGIQVSVSIRSLNSGEQVYAHASEINLPPASTLKLVTTATALEYLGPTYKFETMIYS
FT                   NGRVSSGKILGDLLIEGIGDPSLGSNRFKNNPFEQVLQSLKDNEIQTIEGQIRVLNNDT
FT                   ARFPLGWLVGDIGNYYGAFASPFNFHENLYTVYFNGGTKIGEPAGIASIKPFDPAWKIK
FT                   NHVTTGPAGSGDQVNILNLPFSNEILMIGSVPLNAKNFAIKGAIPNVNKIFTDSLSSYL
FT                   RQNGISVNNKIYPENLQNEELGSILSPDVFEISKETNFRSVNIFADGLANFMWDAEAPD
FT                   YDTFLKDFWKEKGVDLSTHRFIDGSGLSPMNTLSTQNLSLILFKMKDQNRFLQTIPIAG
FT                   KEGTVSSVAVNTGGKISMKSGSISGCRNYAGYFTSNLGKKYAFSIFVNGFHSDHSKAVR
FT                   TFLEEFFVKMIAIKE"
FT   gene            328323..329744
FT                   /locus_tag="Lbys_0310"
FT   CDS_pept        328323..329744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0310"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="COGs: COG1236 exonuclease of the beta-lactamase fold
FT                   involved in RNA processing; InterPro IPR011108; KEGG:
FT                   dfe:Dfer_5620 beta-lactamase domain protein; PFAM:
FT                   RNA-metabolising metallo-beta-lactamase; SPTR:
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily; RNA-metabolising metallo-beta-lactamase;
FT                   Beta-Casp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16094"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVA8"
FT                   /protein_id="ADQ16094.1"
FT                   /translation="MKLTFYGAAQKVAGSMFLLEFEDGYQALIDCGSEVEGNPRLTEEE
FT                   FRYGNFPFDASRVNVVILTHAHIDHSGQIPNLYQDGFEGQVLCTSPTMDLTEVLLYDAA
FT                   SLNARVVKSVEKSHRKSKKWKSKETQGLYLNRQVEEAMENFVPIAFEQRFKFKDDGFVT
FT                   FYPAGHLLGAAHVVLEVKEGGEWKKIGFSGDIGRKNFTLLVDPKPIPQVDYLVMESTYG
FT                   QRNHEDSGDPAEILGEIIQAACVDVKGRLIVPAFSVGRTQCLLYTLNRLYYDKGISPIK
FT                   VFTDSPLAKASTKIYEKYRNRLNKEAQEFFEETDSLFDFENLHYLESNKESQLVSTHAE
FT                   PCIIISSSGMIKGGRVEYHIEKNIENPYATILMVGYANEDSVGGKLLSGEQRQLHIRNK
FT                   KLEVNAKIKKTDIFSGHGDRDDLLAFAKIQKPELLKKLFLVHGDLNAMLNFKQILNESG
FT                   YEDVELPARYQTFEL"
FT   gene            329754..330707
FT                   /locus_tag="Lbys_0311"
FT   CDS_pept        329754..330707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0311"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR001095:IPR020582:IPR011763; KEGG: dfe:Dfer_5619
FT                   acetyl-CoA carboxylase carboxyltransferase subunit alpha;
FT                   PFAM: Acetyl-CoA carboxylase, alpha subunit, conserved
FT                   region; PRIAM: Acetyl-CoA carboxylase; SPTR:
FT                   Acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   alpha; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: Acetyl co-enzyme A
FT                   carboxylase carboxyltransferase alpha subunit; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16095"
FT                   /db_xref="GOA:E4RVA9"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVA9"
FT                   /protein_id="ADQ16095.1"
FT                   /translation="MRTLLEFEKPIAELEAKLEDMKKLANDNNVDVSDAVRNLNAAIET
FT                   LRTETFQNLTRWQRVQLSRHPDRPYTLDYIERICEEFHELHGDRTVRDDPAIVGGMAKI
FT                   NGKSVMIIGQQKGRKTKERQHRNFGMANPEGYRKALRLMKMAEKFNMPIVTLIDTPGAF
FT                   PGLEAEERGQGEAIARNLKEMMTLKVPVICIVIGEGASGGALGIGIGDRVLMLENSWYS
FT                   VISPENCSTILWRTWEFKEQAAEALKLTATDMKANGLVDGIIPEPLGGAHLKWDEMATI
FT                   LKNTILKEIKDLEKKSPAKRISERIDKFCAMGVVIE"
FT   gene            330709..331335
FT                   /locus_tag="Lbys_0312"
FT   CDS_pept        330709..331335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0312"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR006402:IPR005834:IPR005833; KEGG: dfe:Dfer_5618
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; TIGRFAM: haloacid dehalogenase superfamily, subfamily
FT                   IA, variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16096"
FT                   /db_xref="GOA:E4RVB0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB0"
FT                   /protein_id="ADQ16096.1"
FT                   /translation="MPAKTKAVVFDFGNVIIPIDLERTFQAFADLTFKSKERIKELFAQ
FT                   AELFKKYETGFYSDDEFRDVVRQTLSYPLNDQEIDEAWNALLLEIPKERIDYLERLKFD
FT                   IPIYLLSNTNSLHIEYCQQYFRQAFGIANFTKLFEKAFLSYEMGLWKPDYAIYHQVINE
FT                   IGVKPEEILFLDDNPDNVEAANEVGIRAVQISPHESFTTLLPNLL"
FT   gene            331332..332444
FT                   /locus_tag="Lbys_0313"
FT   CDS_pept        331332..332444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0313"
FT                   /product="peptidase M50"
FT                   /note="InterPro IPR008915; KEGG: sli:Slin_2710 peptidase
FT                   M50; PFAM: peptidase M50; SPTR: Peptidase M50; PFAM:
FT                   Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16097"
FT                   /db_xref="GOA:E4RVB1"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB1"
FT                   /protein_id="ADQ16097.1"
FT                   /translation="MKKYRTHILLFLASVLTTTLAGAEWIYGKAFLNGEMGMDHFKEGF
FT                   KFSIPFLLFLTTHEFGHYFAAQWKKIKVTLPYYIPGWIGIIMSIGTFGAFIRIKDPVYS
FT                   RKDFFDIGIAGPLAGAVVALVCLYFGFQYMPGDEYIYGIHPEYQSYPGDYRELLDKNAS
FT                   AFEAITLGKSMLYSFMENTFGNPDLLPHPYELSHYPLILAGFLGLLFTAINLLPIGQLD
FT                   GGHILYGLVGPKAFRVISPSALVLLVGYSGLGMFQVQEWAAGADYLLYLQFFLYVYFVY
FT                   LCFSKIFTNRTSNWILTLAVVLCQLLLTQWQPGIMGYPGFLAFGFLIGRVLGVYHPPTF
FT                   DVGPLGWGRQILGWLAMLLFVLCFIPYPIS"
FT   sig_peptide     331332..331400
FT                   /locus_tag="Lbys_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            332445..333014
FT                   /locus_tag="Lbys_0314"
FT   CDS_pept        332445..333014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0314"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="InterPro IPR002123; KEGG: gfo:GFO_1494
FT                   phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16098"
FT                   /db_xref="GOA:E4RVB2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB2"
FT                   /protein_id="ADQ16098.1"
FT                   /translation="MEALYIWWFKSKGWKIIGDIDPGLKKAMIAVAPHWKSEDFFVGLA
FT                   SRALLKRRISFFGKAELFKPPFGFIFRALGGIPVDRTRKGNLVEQQIYTIKGLDEALIS
FT                   LAPEGTRKDVGRLRSGFYYIAVGAEMPIIRVGFDYERKEVLIAEPFYPSGDFKKDMMTY
FT                   FVPFYERIGGPQKSWIARYREGIFDH"
FT   gene            333028..334197
FT                   /locus_tag="Lbys_0315"
FT   CDS_pept        333028..334197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0315"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro IPR000277; KEGG: dfe:Dfer_2612
FT                   cystathionine gamma-synthase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: Cystathionine
FT                   gamma-synthase; PFAM: Cys/Met metabolism PLP-dependent
FT                   enzyme; TIGRFAM: O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16099"
FT                   /db_xref="GOA:E4RVB3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB3"
FT                   /protein_id="ADQ16099.1"
FT                   /translation="MKKQTKVIKIQSERTHNRENSTPLYLTSSFCYEDAAQGKDLFDGT
FT                   LEGNIYSRFSNPTVQEFVDKICVLEELEDGVATGTGMAAVFACFGAHLSAGDHLVSSKA
FT                   LFGSSHQIITQILVKWGISYTYVDASAPESEWEAAIQENTKMIYLETPSNPGLEIVDLE
FT                   MIGRLAKKHDLIYCIDNCFATPVLQVPSQFGANLVLHSATKFMDGQGRVLGGVVVGTKE
FT                   LIEKVRFFTRQTGPALSPFNAWVLSKSLETLHLRMERHCSNALALATALEKVEGVKQVN
FT                   YPFLDSFKQKDLAKKQMSAGGALVTFELEGGFERVVRFTKLLTIPSLTSNLGDSRTTIT
FT                   NPFTTTHSKVPTEDKYGLGIYEGSMRVSVGLEDIDDLIQDFTQAILGSK"
FT   gene            complement(334202..334864)
FT                   /locus_tag="Lbys_0316"
FT   CDS_pept        complement(334202..334864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0316"
FT                   /product="Conserved hypothetical protein CHP02453"
FT                   /note="COGs: COG5587 conserved hypothetical protein;
FT                   InterPro IPR015996:IPR012808; KEGG: dfe:Dfer_0426
FT                   hypothetical protein; PFAM: Conserved hypothetical protein
FT                   CHP02453; SPTR: Putative uncharacterized protein; PFAM:
FT                   Conserved hypothetical protein (DUF2461); TIGRFAM:
FT                   conserved hypothetical protein TIGR02453"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16100"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB4"
FT                   /protein_id="ADQ16100.1"
FT                   /translation="MIKASTFAFLRALTDNNTREWFQEHKSEFEAAKDNFTQFSDSILK
FT                   ELKEVEPKYYDTQIKDCIFRIYRDVRFSKDKKPYKIHLAAAFGENGKNSGKIDYYFHLQ
FT                   DQETFLGAGIWNPTAEELATFRQEIDYNPEELKNIIEDSEFKKHFPLVHGEQLKRAPKG
FT                   YAEDHPEIHLLKYKSLFFMKKFTNEEVLSPDFKENLLKHIERLKPFVDYLNEILYEG"
FT   gene            334921..335895
FT                   /locus_tag="Lbys_0317"
FT   CDS_pept        334921..335895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0317"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR002305:IPR002306; KEGG: dfe:Dfer_0423 tryptophanyl-tRNA
FT                   synthetase; PFAM: aminoacyl-tRNA synthetase class Ib;
FT                   PRIAM: Tryptophan--tRNA ligase; SPTR: Tryptophanyl-tRNA
FT                   synthetase; TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   tRNA synthetases class I (W and Y); TIGRFAM:
FT                   tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16101"
FT                   /db_xref="GOA:E4RVB5"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB5"
FT                   /protein_id="ADQ16101.1"
FT                   /translation="MARILTGIQATGRPHLGNILGAIEPAVALSKKPENESYLFIADLH
FT                   SLTTIKDPQVLVENTRAVACAWLACGLDPEKSFFYRQSRLAPYHTELMWYLNCLTPYPM
FT                   LANAHSFKDKSEKLSDVNAGLFTYPVLMTADIILYQADFVPVGKDQKQHLEIAKDIAEV
FT                   FNRVYGEVFKIPAPFINEEVMTIPGIDGAKMSKSYNNYIDIFLPENELNKVVKKIVSDA
FT                   TPLEEPKNPDTDNTFKIFSLVGTPEQVETMRQNYLAGGYGYGHAKKELFETLLTRFAKH
FT                   REIYNYYFNDTEALEKQLRIGEEKVEEVARKTMEEVRKVMKFL"
FT   sig_peptide     334921..335004
FT                   /locus_tag="Lbys_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            335895..336446
FT                   /locus_tag="Lbys_0318"
FT   CDS_pept        335895..336446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0318"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: coc:Coch_0468
FT                   phosphoesterase PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR:
FT                   Phosphoesterase PA-phosphatase related; PFAM: PAP2
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16102"
FT                   /db_xref="GOA:E4RVB6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB6"
FT                   /protein_id="ADQ16102.1"
FT                   /translation="MESLLDWDKQLFIFLNGYHTPFWDKFFLIYTNAKSWIPVVLILLV
FT                   MLFRSFHWKQALVFVALIAIGVGVSDYVASGIMKPNFARLRPCHDYLNEMILVGNCGGK
FT                   YGFASSHAANAFGIFMGFSLVFSENKRLFWVLLAWATLMGYSRIYVGVHHPGDVIVGAL
FT                   IGILVPQIIFYLYKKIKLKS"
FT   gene            336443..336847
FT                   /locus_tag="Lbys_0319"
FT   CDS_pept        336443..336847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0319"
FT                   /product="Protein of unknown function DUF2147"
FT                   /note="COGs: COG4731 conserved hypothetical protein;
FT                   InterPro IPR019223; KEGG: cts:Ctha_1316 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2147; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   protein conserved in bacteria (DUF2147)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16103"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB7"
FT                   /protein_id="ADQ16103.1"
FT                   /translation="MKKYLFFFCVLMAIQVRAQEITQGQWWNEEKEGKIQFYEQGGKLY
FT                   GKVVWLKDGDVKDKNNPDPKLRDKSLVGLTFLKGFTADGQDWKGGQIYDPKSGKTYSAT
FT                   IKWAGKNTLNVRGYIGVSLVGRTTRFTRVE"
FT   sig_peptide     336443..336496
FT                   /locus_tag="Lbys_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            336928..338004
FT                   /locus_tag="Lbys_0320"
FT   CDS_pept        336928..338004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0320"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395:IPR020471;
FT                   KEGG: rlg:Rleg_2612 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16104"
FT                   /db_xref="GOA:E4RVB8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB8"
FT                   /protein_id="ADQ16104.1"
FT                   /translation="MNSRREFIFSSAAIGGVLALGSFCPKDFQYRILGQGKAALKVSPL
FT                   GLGCMGMSYHRSFVPDEKASLKLLRNAYEAGITFFDTAEAYGPLTNERLVGKGVKSFRK
FT                   NIVLATKFGFINGKPSEGLDSRPETIRRVVENSLRSLQTDYIDLLYQHRVDPKVPIEEV
FT                   AGTVKELITEGKVKHFGLSECSAGVLRRAHKEQAVTAVQSEYSLMTRLPEVEILGTCEE
FT                   LGVGFVPYSPLSRGMITGYLNERTKYNALNDNRSTLPRYQKELVVANWPLIDTLKEFGD
FT                   QRGLTVAQVALAWLLHQKPWIVPIPGTTKWAHMQENFAAREIDFSDEEWSSLQSLLDKI
FT                   IIHGDRYTGISAQQTQKE"
FT   sig_peptide     336928..336984
FT                   /locus_tag="Lbys_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            338121..338194
FT                   /locus_tag="Lbys_R0007"
FT   tRNA            338121..338194
FT                   /locus_tag="Lbys_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(338622..339599)
FT                   /locus_tag="Lbys_0321"
FT   CDS_pept        complement(338622..339599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT_0948 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16105"
FT                   /db_xref="InterPro:IPR024353"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVB9"
FT                   /protein_id="ADQ16105.1"
FT                   /translation="MFKMELVKVDRHLVTGEQSSTELPFIVANTSPMNMFELEHEHIIP
FT                   VFVKDNEPVISHQDFINCVQEVSGQVFPHETILKPSIRVSHPIKGRIPEAKDKPAKELL
FT                   EHEKTIYYERMAFVLEIPSISSTINGNKLNLTIGGIKAYNLDNLYNRKGADEHFKVFIG
FT                   FQNKVCCNMCIWSDGYTGTIKARSITELMKQIFALFVEYNIENQLTLLRQFPEYYLTES
FT                   QFVTFLGRTKLYQYLPAQEKKTLPEFMFGENQLSMVARDYLADEDFSRTDTGDISLWNL
FT                   YNLFTGANKMSYIDSFLNRGLNASQVIHHLTESFNKNEPSWFLR"
FT   gene            complement(339577..340416)
FT                   /locus_tag="Lbys_0322"
FT   CDS_pept        complement(339577..340416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: enc:ECL_03598 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16106"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC0"
FT                   /protein_id="ADQ16106.1"
FT                   /translation="MIIELAKREQAKIKIGLQGPSGSGKSYSALLLAHGLTNDWSKIVV
FT                   IDTENKSSSLYSHLGDFNILDLKPPYSPERYIEAINLCVRHGMQAIIIDSITMEWEYIL
FT                   DAHSQLTGNSYTNWARFTPRHQKFIQAILHSDIHIICTLRSKQDYVLTENEKGKLAPEK
FT                   VGMKAIQRDGTDYELTLMFELDIKHNAITTKDRTGLFSGRLPFQITEETGREILNWCQT
FT                   GEIAVRDYETLIKSCNSLQELLSLFESVSKEVQQQFKPDFNQRKLQLTPNYVQNGIS"
FT   gene            complement(340558..341370)
FT                   /locus_tag="Lbys_0323"
FT   CDS_pept        complement(340558..341370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1613 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16107"
FT                   /db_xref="GOA:E4RVC1"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC1"
FT                   /protein_id="ADQ16107.1"
FT                   /translation="MQEIIYKIDNWTITKIIGGFVGVLTILGTIFSKWLLTKLTQAGQH
FT                   NYDKRLEDLRGQINRNNGILSSIIQNYFSSSQKLLDKKIEVYDLLWSSILKIRDELPSG
FT                   ISLLYQISSDDELNKSTAFNYFNDNPKLGPQLKTYKIEKDVMPIVENERTLVPYRPFLS
FT                   DNSYKLYSTYYSLIGRMTFQFIQNYSNSKIYNWKKDDHLIGILAVTLTEKEIEHIKSLK
FT                   VGAFTVLTELLEYKILQDIKNNLSMGETSESTIEHIRDIEKMLNAMTK"
FT   gene            341643..341835
FT                   /pseudo
FT                   /locus_tag="Lbys_0324"
FT   gene            341936..342838
FT                   /pseudo
FT                   /locus_tag="Lbys_0325"
FT   gene            342870..343490
FT                   /locus_tag="Lbys_0326"
FT   CDS_pept        342870..343490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1611 hypothetical protein; SPTR:
FT                   Conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16108"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC2"
FT                   /protein_id="ADQ16108.1"
FT                   /translation="MPCFHRFYDELIPNQNLVEYLFIGTFNPSWNAENENNAEYFYGRE
FT                   TNFFWCICPHAFNRNCLIDKGKPEWLSFCEQNLIGLTDLIKNIENADQENDQHVQLLTN
FT                   GFQDKNLDLRENGQYIFNIDFNTDDIIKYITSRRNSLKGVFFTRRTDNGIRRIWEQWCQ
FT                   ISNHCNELSIYNAVLPTPSLRGGGTLKSTISTWRTEIEKCSQD"
FT   gene            complement(343771..344076)
FT                   /locus_tag="Lbys_0327"
FT   CDS_pept        complement(343771..344076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rbi:RB2501_07085 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16109"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC3"
FT                   /protein_id="ADQ16109.1"
FT                   /translation="MEGRDYYVIQLQSDEIELLVSKNTGRHYATLRKCWMSTTFDEQTC
FT                   KLMLGKKMPGTILKEQCDPYSFVIEDTGEEITLNHRNTYSPVESEEGKVIGELQEA"
FT   gene            complement(344119..344952)
FT                   /pseudo
FT                   /locus_tag="Lbys_0328"
FT   gene            complement(345003..345269)
FT                   /locus_tag="Lbys_0329"
FT   CDS_pept        complement(345003..345269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0329"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: cpi:Cpin_0036 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Transposase IS3/IS911 family protein;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16110"
FT                   /db_xref="GOA:E4RQ52"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RQ52"
FT                   /protein_id="ADQ16110.1"
FT                   /translation="MKKSKHSEHQIVKVLGEYENGRKVEDICRELNIHKATFHNWKKKY
FT                   SGMSGTDLAELKSLQQENARLKKMYADLALDHAVLKDVLSKKF"
FT   gene            345808..346242
FT                   /locus_tag="Lbys_0330"
FT   CDS_pept        345808..346242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0330"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: rbi:RB2501_10797 rrf2 family
FT                   protein (putative transcriptional regulator); PFAM: protein
FT                   of unknown function UPF0074; SPTR: Rrf2 family protein
FT                   (Putative transcriptional regulator); TIGRFAM:
FT                   transcriptional regulator, Rrf2 family; PFAM:
FT                   Transcriptional regulator; TIGRFAM: rrf2 family protein
FT                   (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16111"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC5"
FT                   /protein_id="ADQ16111.1"
FT                   /translation="MFSKACEYGIRAAIYIAQQSLVDRKVSLKDVAKAIESPTAYTSKI
FT                   LQKLSKNSIIKSDKGPTGGFSMDKTELEKVKLCSIVYAIDGDAVYTGCGLGLKKCNENK
FT                   PCPVHNQFKLIREELKKMLETTTVKTLATDFEKGLTFLKR"
FT   sig_peptide     345808..345909
FT                   /locus_tag="Lbys_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            346290..348041
FT                   /locus_tag="Lbys_0331"
FT   CDS_pept        346290..348041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0331"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG3278 Cbb3-type cytochrome oxidase subunit
FT                   1; InterPro IPR000883; KEGG: cpi:Cpin_5783 cytochrome-c
FT                   oxidase; PFAM: cytochrome c oxidase subunit I; PRIAM:
FT                   Cytochrome-c oxidase; SPTR: Cytochrome-c oxidase; PFAM:
FT                   Cytochrome C and Quinol oxidase polypeptide I; TIGRFAM:
FT                   cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16112"
FT                   /db_xref="GOA:E4RVC6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC6"
FT                   /protein_id="ADQ16112.1"
FT                   /translation="MEPKNLFSESGIIITLLLIAIPIIVASILVIIKAKKVLKNFLKKK
FT                   ELEKFNEYIKNLSPEEVQKLELRKKQLEFSLSNNELAGDTTPIDAKGLIDNVREASSLR
FT                   FIEQKKKSQARPYIEPDLTKLILWYLGCATFWLLFGTTVGEYVGIKFVAPDVDHYSWLS
FT                   FGRLRPVHTNAVFWGWASLAMLGLAYYVIPRVSNVPIASIKTGYRTLILVNASVILGSL
FT                   FLMAGINNGGGEYREYIWPVMALFGIAVIISLRNFYKTIAKRTTKEIYVSNWYIISAMM
FT                   FLLVIAVIAYWPSWQNGLGETIIQGYYMHQGVGMWFMLFNLGLMYYFLPQQLNKPIYSY
FT                   SLGILAFWIQILFYTLIGTHHFIFSAIPWWLQTVAIVGSAGMVIPVVAGTTNFLMTFKG
FT                   SWHKLSGSYTLPFYLIGIIFYFTGSLQGTAEAFKFTNLIWHFTDFTVAHSHLTMYGIIC
FT                   FMLWGFIYTVVPRLTGNEPPQITVGAHFWLALIGLLFYTFPLMYGSTLRGLMWMEGTKS
FT                   FIESVELMAPYWLWRAIGGSLMWLSHILFAYNFYVMVKKKEEIEIPSSPKDILNAKVAL
FT                   DNQEVTN"
FT   sig_peptide     346290..346367
FT                   /locus_tag="Lbys_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            348052..349059
FT                   /locus_tag="Lbys_0332"
FT   CDS_pept        348052..349059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0332"
FT                   /product="cytochrome C oxidase mono-heme subunit/FixO"
FT                   /note="COGs: COG2993 Cbb3-type cytochrome oxidase
FT                   cytochrome c subunit; InterPro
FT                   IPR009056:IPR003468:IPR003088; KEGG: dfe:Dfer_1787
FT                   cytochrome c oxidase mono-heme subunit/FixO; PFAM:
FT                   cytochrome C oxidase mono-heme subunit/FixO; cytochrome c
FT                   class I; SPTR: Cytochrome C oxidase mono-heme subunit/FixO;
FT                   PFAM: Cytochrome c; Cytochrome C oxidase, mono-heme
FT                   subunit/FixO; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16113"
FT                   /db_xref="GOA:E4RVC7"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC7"
FT                   /protein_id="ADQ16113.1"
FT                   /translation="MDFFDNHKKLFRTALGLFVGLTIIVAIMPAINNQENNSPLPGYEP
FT                   LSQEAYLGKKVFIANGCVACHTQQVRNVEMDNIWGNRPGIPADYAGISRTDFWTNTATL
FT                   MGTERTGPDLTNIGSRQPSLAWNLLHLFQPRAVVEKSIMPAYPWLFEVKNELGEKDVEV
FT                   VVPDAYRKGINGKIIATQEALHLVAYLQSLKQTPLPDGKTPMEFLYKKKEMPVVINENS
FT                   TKLPDGKLLYTNNCMSCHQANGEGLKGAFPPLKGSPIVLGDDLELFVNIIMLGYDARPE
FT                   YAVMNAVGLDNNLTPEEVTAIINHEKTSWGNNAKTVTPEEVKKIMDFIKLTSNK"
FT   sig_peptide     348052..348150
FT                   /locus_tag="Lbys_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            349064..349324
FT                   /locus_tag="Lbys_0333"
FT   CDS_pept        349064..349324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_3779 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16114"
FT                   /db_xref="GOA:E4RVC8"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC8"
FT                   /protein_id="ADQ16114.1"
FT                   /translation="MKVKYLISVLVIFIAQIAIACPVCEKQQPKITQGLTHGVGPQSNW
FT                   DWVIIAIISLITVLTLIYSIKYLIKPGEKNNDHIKQSILRN"
FT   sig_peptide     349064..349123
FT                   /locus_tag="Lbys_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            349330..349734
FT                   /locus_tag="Lbys_0334"
FT   CDS_pept        349330..349734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0334"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: fps:FP0917 cytochrome c family protein; SPTR:
FT                   Cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16115"
FT                   /db_xref="GOA:E4RVC9"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVC9"
FT                   /protein_id="ADQ16115.1"
FT                   /translation="MEEYKSKIKLFLDDEQQPIAELVPPVQFDLDTSKLTDGEHTLKLI
FT                   SKSPTGREGIRKIKFIVKNGPAISVEGLSDNGVVDGVIPLMINAYDKGNQKKFFIEGSE
FT                   TPQSIPSWLWILLVAFLGWAAFYTITNFSL"
FT   gene            349756..349932
FT                   /locus_tag="Lbys_0335"
FT   CDS_pept        349756..349932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPOA0172 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Hexameric
FT                   tyrosine-coordinated heme protein (HTHP)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16116"
FT                   /db_xref="InterPro:IPR021111"
FT                   /db_xref="InterPro:IPR038125"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD0"
FT                   /protein_id="ADQ16116.1"
FT                   /translation="MENKEIWLETLITNSPQEGRELAIKMARKSIAAIQTDTEISYETI
FT                   MPMILHNSLPLPM"
FT   gene            349999..350385
FT                   /locus_tag="Lbys_0336"
FT   CDS_pept        349999..350385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0336"
FT                   /product="globin family protein"
FT                   /note="COGs: COG2346 Truncated hemoglobins; KEGG:
FT                   gfo:GFO_1394 globin family protein; SPTR: Bacterial-like
FT                   globin family protein; PFAM: Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16117"
FT                   /db_xref="GOA:E4RVD1"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD1"
FT                   /protein_id="ADQ16117.1"
FT                   /translation="MIDIINLDDVKLVVDCFYDKVRNDKQLKDVFNDVIQDRWPAHLEK
FT                   MYRFWQTVLLDEHTYYGSPFLPHAKLPVGIEHFNQWLKLFYETVDENFAGEKAERMKWQ
FT                   GQRMAEMFHSKIEYYKNNPSIPLL"
FT   gene            350382..350825
FT                   /locus_tag="Lbys_0337"
FT   CDS_pept        350382..350825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wch:wcw_0477 hypothetical protein; SPTR:
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16118"
FT                   /db_xref="GOA:E4RVD2"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD2"
FT                   /protein_id="ADQ16118.1"
FT                   /translation="MTVVKMPIALISTFVWIGFICAISFMEAWLKFRAPGITVPLGLGI
FT                   GRLVFNALNKVELVFALAVIINIFWNYSDILKWKNLAFAIPLTLLFIQTFWLLPALDAR
FT                   AELYIQGQIVPPSNLHFYYVGIELVKVASLTFFGLTLFKNTPT"
FT   sig_peptide     350382..350447
FT                   /locus_tag="Lbys_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            350833..351619
FT                   /pseudo
FT                   /locus_tag="Lbys_0338"
FT   gene            351638..352366
FT                   /locus_tag="Lbys_0339"
FT   CDS_pept        351638..352366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0339"
FT                   /product="iron-sulfur cluster repair di-iron protein"
FT                   /note="COGs: COG2846 Regulator of cell morphogenesis and NO
FT                   signaling; InterPro IPR007500:IPR012312:IPR019903; KEGG:
FT                   gfo:GFO_1401 nitric oxide-dependent regulator; PFAM:
FT                   protein of unknown function DUF542 ScdA domain protein;
FT                   Hemerythrin HHE cation binding domain protein; SPTR: Nitric
FT                   oxide-dependent regulator; TIGRFAM: iron-sulfur cluster
FT                   repair di-iron protein; PFAM: Domain of Unknown function
FT                   (DUF542); Hemerythrin HHE cation binding domain; TIGRFAM:
FT                   iron-sulfur cluster repair di-iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16119"
FT                   /db_xref="GOA:E4RVD3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD3"
FT                   /protein_id="ADQ16119.1"
FT                   /translation="MNIQENNIIGELVAQDYRAASVFKKYGIDFCCQGNRTIQDACESK
FT                   EIDASSVVSDLNEVSKATSENTIDYQSWPIDLMADYIEKKHHRYVEEKTREITPYLDKI
FT                   CRVHGDRHPELFEINEHFNATAGELAAHMKKEELILFPFVRKMAKAKQENTKLEAPHFG
FT                   TVENPIQMMMHEHTTEGERFRKIETLSNNYTPPEDACNTYRVTFALLKEFEADLHLHIH
FT                   LENNILFPKAIELEKQLKNA"
FT   gene            352359..352493
FT                   /pseudo
FT                   /locus_tag="Lbys_0340"
FT   gene            352528..352908
FT                   /pseudo
FT                   /locus_tag="Lbys_0341"
FT   gene            complement(352959..353171)
FT                   /locus_tag="Lbys_0342"
FT   CDS_pept        complement(352959..353171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0342"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /note="KEGG: cbk:CLL_A3602 putative inner membrane protein
FT                   translocase component YidC; SPTR: Putative sporulation
FT                   protein/membrane protein insertase, OxaA family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16120"
FT                   /db_xref="GOA:E4RVD4"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD4"
FT                   /protein_id="ADQ16120.1"
FT                   /translation="MSEIIIKIFGSIYIYLTDFIINLANITGGSYYELNFLFFCVLYPL
FT                   IFLTSIVYFLVQKLRLYKVKRKVKR"
FT   gene            complement(353159..353626)
FT                   /locus_tag="Lbys_0343"
FT   CDS_pept        complement(353159..353626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00577100 Kelch motif family
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16121"
FT                   /db_xref="GOA:E4RVD5"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD5"
FT                   /protein_id="ADQ16121.1"
FT                   /translation="MKKETGKVFCIFAILFLIVIAVNEFSRMSINDERFTMYGLKGINP
FT                   NRAIADKCSWVCHFKTNHCRENHVKFLKNHFSVTDKLYMEEIHLLGKFKIIKNDSKLFS
FT                   TGLNQLGVSTEYANYGLANIVFLVILIPFLILYCLVKGLTIQKEIKNLCRK"
FT   sig_peptide     complement(353549..353626)
FT                   /locus_tag="Lbys_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(353644..354225)
FT                   /locus_tag="Lbys_0344"
FT   CDS_pept        complement(353644..354225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcs:Pc20g02960 Pc20g02960; SPTR: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16122"
FT                   /db_xref="GOA:E4RVD6"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD6"
FT                   /protein_id="ADQ16122.1"
FT                   /translation="MKKVILIIICIIGGLYLIGTIFMLVIGTLVFNNILDPCKNPKYSV
FT                   EYEGVLYCEEKTVSLAFGKDTISGKIYYHPFGIEGDNMRVFRLFTKKDTTIFPLPNSLE
FT                   GYTQLTCYSINVGKKRYLWFEDNFGSVALDIDNKKLAKVNSPLKEKINILPNGASHGER
FT                   GIISERYYRKQLSLSKDTRVRILDSLQIDY"
FT   gene            355293..355979
FT                   /locus_tag="Lbys_0345"
FT   CDS_pept        355293..355979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0345"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041:IPR006058:IPR002888:IPR006311; KEGG:
FT                   fjo:Fjoh_4202 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein; PFAM: [2Fe-2S]-binding
FT                   domain-containing protein; ferredoxin; SPTR:
FT                   Oxidoreductase, iron-sulphur binding subunit; PFAM: 2Fe-2S
FT                   iron-sulfur cluster binding domain; [2Fe-2S] binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16123"
FT                   /db_xref="GOA:E4RVD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD7"
FT                   /protein_id="ADQ16123.1"
FT                   /translation="MFRNYYLLIIPLKALGFFFAFFSFISYFENLFLGYAMKDKPHSRR
FT                   FFLKTSMAFAAWAAVPSTAKGFYVDKEELKMMYPLKISINKKIYNLPADTRTTLLDLLR
FT                   EKLDLTGTKKGCDHGQCGACTVHINGERVLSCLTLAATVHEAEVTTIEGLANGDQLHPM
FT                   QEAFMECDGFQCGYCTPGQIMSAVACVNEGRTGSVEEIKEFMSGNLCRCGAYNGIVQSI
FT                   LKVAQA"
FT   sig_peptide     355293..355457
FT                   /locus_tag="Lbys_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            355976..356947
FT                   /locus_tag="Lbys_0346"
FT   CDS_pept        355976..356947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0346"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR016166:IPR002346:IPR005107; KEGG: pst:PSPTO_4651
FT                   oxidoreductase, molybdopterin-binding subunit; PFAM:
FT                   molybdopterin dehydrogenase FAD-binding; CO dehydrogenase
FT                   flavoprotein domain protein; SPTR: Oxidoreductase,
FT                   molybdopterin-binding subunit; PFAM: FAD binding domain in
FT                   molybdopterin dehydrogenase; CO dehydrogenase flavoprotein
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16124"
FT                   /db_xref="GOA:E4RVD8"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD8"
FT                   /protein_id="ADQ16124.1"
FT                   /translation="MRPFTYKKPADIKGALSSFGHQTQYIAGGTNLVDLMKKFVSTPEH
FT                   LIDVQGALSSDISLSAEGLKMGALAKNSAISVHPQVLSDFPLISKAILAGASPQIRNMA
FT                   TLGGNLLQRTRCPYFYDLSTPCNKREKGTGCSAKEGVQRMSAVIGYSDDCIAVHPSDLC
FT                   VALVALDAQVGITSKAGKEGKVLFRDFHKLPGDTPHVDNHLPEGALITYVEVPKNNFAE
FT                   HCAYVKLRDRTSYAFALVSVAAALELKDGKIVNARLASGGVAHKPWRWFSAEKALVGKV
FT                   ANEETFEKAAAMIQKEIKPLEGNAFKSELLYGAVQSALKQCL"
FT   gene            356944..359100
FT                   /locus_tag="Lbys_0347"
FT   CDS_pept        356944..359100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0347"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674:IPR008274; KEGG: cpi:Cpin_2168 aldehyde oxidase
FT                   and xanthine dehydrogenase molybdopterin binding; PFAM:
FT                   aldehyde oxidase and xanthine dehydrogenase a/b hammerhead;
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding; SPTR: Aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; PFAM: Molybdopterin-binding domain of
FT                   aldehyde dehydrogenase; Aldehyde oxidase and xanthine
FT                   dehydrogenase, a/b hammerhead domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16125"
FT                   /db_xref="GOA:E4RVD9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVD9"
FT                   /protein_id="ADQ16125.1"
FT                   /translation="MSRVEALEKVTGRGKYAAEYTVPGVVHSVMVGSTIPHGKIKRINT
FT                   EKAKRAEGVLEIITHEHKPLVHGLSTEALIQETRFGLPVFHTDTIQFKGQPIALVVAET
FT                   LEEARYAASLIQAEYEVLPYEVDFDAARKKVALNPAGKDRGEGWKEAAHSVEAEYHIAT
FT                   EVHHPMEMHATIAHWVDDTHLKLYDKNQGVNNVQRTIGRLFNIPPQNIEVFSEFVGGGF
FT                   GSGLRVWSNALAAVMAAKAVKRPVKLMLTRQQMFSLAGYRPAAWQKVKMSADAQGKLVS
FT                   VHHQAQNATSQYERFSDGITRVTRLIYHIPNVRTEESIVPLHMSTPTWMRGPGDCTGDF
FT                   AIESALDELSYKLKIDPVEFRYRNLALDKHPENGLPWSTNYVKECIEIGARKIDWDKRS
FT                   PEVGKIKEGDWQIGYGMAVGAWNAGRGNASAGMSLDAKGNLIVKTAMTDIGTGTGTGMM
FT                   NMAQEFLGIPTHKIKVELGHSSLPSAGSQGGSTGLSSISGAVNAAANELKGVLLTLAQK
FT                   IDASFGTAQAKDLRLSEAGLVFGDKQISYEKLFAQNNDQAIEVEASSGPGEERRKYAFL
FT                   SSASHFVKLGVHAQTGKVKILQYVCVADGGKIVNTQAAANQMSGAVVGGIGMALMEEAV
FT                   VDPKAGGWIGDDFAGYHFAVNADAPLIEIEFVNKPDVNINPSGAKGLGEVGIIGAAAAI
FT                   SNAIYHATGKRLRSLPITPDKILA"
FT   gene            complement(359230..360759)
FT                   /locus_tag="Lbys_0348"
FT   CDS_pept        complement(359230..360759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0348"
FT                   /product="transposase, IS4 family"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; InterPro IPR002559; KEGG: bfs:BF4052 putative
FT                   transposase; PFAM: transposase IS4 family protein; SPTR:
FT                   MS156, putative transposase; PFAM: Transposase DDE domain;
FT                   Transposase domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16126"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:E4RSY7"
FT                   /protein_id="ADQ16126.1"
FT                   /translation="MASRKPTFKPYDQQQMMLLPPSLEELVPKNHPVRVVNEVINKINL
FT                   APLHASYKLTGASSYHPQMLLKVLVYGYVSNVYSSRKIEAACKESIYFMWISGMSYPDH
FT                   NTINRFRSDRLRESLRSVFEEVVKLLAQEGLLSIEEVCVDGTKIEANANRYTFVWKKAI
FT                   ATNKEKMKQQLKGIWEYAQSVASKEDNLPDPPDFTTITREKVQSTVDKLNEVLGKKKDI
FT                   DKKVKGKLSYATKHFPQNMGKYEEQEQILGERNSYSKTDEGATFMRLKEDHMRNGQLKP
FT                   AYNVQISSSNQFVVNYTIHPNPNDTTTLAAHIAQHEASYQQAPKVITADAGYGSEENYT
FT                   LLEGKKVKAYIKYNLFDRQQNTNNQDPFSTDKLFYNAQEDCFICPMGQQMNFIGESKRK
FT                   TSTGFEQTSRKYQAQNCGHCPLNGTCNKMEGNRIVQVNERLERQRKQAYELLNSEEGIK
FT                   RRKKRCYDVEPVFANIKSNHGFKRFMLRGKHKVEIEFGLLAIAQNIRKKAS"
FT   gene            360928..361440
FT                   /locus_tag="Lbys_0349"
FT   CDS_pept        360928..361440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0349"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182; KEGG: fjo:Fjoh_4884 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16127"
FT                   /db_xref="GOA:E4RVE1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE1"
FT                   /protein_id="ADQ16127.1"
FT                   /translation="MQLRKALESELPQIWNIIQYAIEQRRKDGSKQWQDGYPNPTSIQN
FT                   DYDKGYAYVMEEEGVLFAYGAVIFDIEPAYEEIEGKWLTNGPYLVVHRVAAAPEAKGKG
FT                   IGTQFFKALEDLSLNKGVYSIKVDTNFDNAPMLRILKKLGYTYCGEVYFRGSARKAFEK
FT                   VLLPKSE"
FT   gene            complement(361420..362163)
FT                   /locus_tag="Lbys_0350"
FT   CDS_pept        complement(361420..362163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0350"
FT                   /product="protein of unknown function DUF303
FT                   acetylesterase"
FT                   /note="InterPro IPR005181; KEGG: sli:Slin_2555 protein of
FT                   unknown function DUF303 acetylesterase putative; PFAM:
FT                   protein of unknown function DUF303 acetylesterase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF303)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16128"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE2"
FT                   /protein_id="ADQ16128.1"
FT                   /translation="MKKLILFLCLSITVQAQNNLDLYLLVGQSNMAGRGTLDNYLLPSD
FT                   SLWMLAKDLSWVRAKEPFHYDKSAAGAGLAASFARIILSKDKHPIGLIPAAVGGTSIRY
FT                   WRSGAQDPATGLYPYDDAIRRAKVALKHGKIKAILWHQGESDTESTASYVQEFISLMDN
FT                   LHRDLDLPLGSIPVIIGETGEFGDRSNSRQRINAVIREIPNRLPFVKVVTSEGLTHNGD
FT                   LTHFDTPALRELGKRYAEVLLRFRQ"
FT   sig_peptide     complement(362116..362163)
FT                   /locus_tag="Lbys_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(362160..364268)
FT                   /locus_tag="Lbys_0351"
FT   CDS_pept        complement(362160..364268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0351"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="COGs: COG2273 Beta-glucanase/Beta-glucan synthetase;
FT                   InterPro IPR000757; KEGG: sus:Acid_0712 hypothetical
FT                   protein; PFAM: glycoside hydrolase family 16; SPTR:
FT                   Agarase; PFAM: Glycosyl hydrolases family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16129"
FT                   /db_xref="GOA:E4RVE3"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE3"
FT                   /protein_id="ADQ16129.1"
FT                   /translation="MKKLLGLILIGHALLAQESLRVESKAWVSGNPNTPWKFYDTRSIK
FT                   TLASFSPKSEEKLNKYGSLPHKKVQGSGYYRTEKIDGRWWVVDPEGHLNIQTVLNSVRP
FT                   GTSERNETYLKSLYGNKENWLRATADSLSKFGFTGTGSWSEDVREINKQREKPLSYTPN
FT                   LNFMSTYGKKRGGTYQLPGNVGYPNQTIFAFDPDFEEFCKEHAKSLKDRINDPNLFGVF
FT                   SDNELPIGLGNLEGYLKLANDQDPGKQEALRWLAARRKTIDEIADDDRADFAGHVAETY
FT                   YRKVAQALKEVLPHHMYLGSRLHGGAKFIIPVLKAAGKYCDIVSFNYYGVWTPEEIRME
FT                   QWQYYTGKPFMITEFYTKAMDAGLANTTGAGFTVRTQKDKALAYQHFTLALLESKACVG
FT                   WHYFKYQDNDPTAKGVDPSNIDSNKGIVNNEYVYYSDLMKGMKEMHLNRYALIEYFDQN
FT                   QEAKEWKLVWSDEFDYKGLPDPKKWSHDTRGNSYGWGNRELQWYTIAKTENTLVSDGTL
FT                   KIIARKEETKGKNYSSGRLMTKYKGDWLYGKIEIRAKVPKGKGTWPAIWMLSTENHYGT
FT                   WPKSGEIDIMEHVGANPDTVFSTTHTESYNHILKTQKKGITGLSGLTDDFHTYTLEWEQ
FT                   SKYQVYFDGKLLFTFENEGTGSKTWPYDRPFHLILNLAIGGGLGGPVDDSLFPHTFEID
FT                   YVRVYQKK"
FT   sig_peptide     complement(364185..364268)
FT                   /locus_tag="Lbys_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(364270..366849)
FT                   /locus_tag="Lbys_0352"
FT   CDS_pept        complement(364270..366849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0352"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="COGs: COG3250 Beta-galactosidase/beta-glucuronidase;
FT                   InterPro IPR006104:IPR006102:IPR006103:IPR006101; KEGG:
FT                   sli:Slin_0624 beta-galactosidase; PFAM: glycoside hydrolase
FT                   family 2 sugar binding; glycoside hydrolase family 2
FT                   immunoglobulin domain protein beta-sandwich; glycoside
FT                   hydrolase family 2 TIM barrel; PRIAM: Beta-galactosidase;
FT                   SPTR: Beta-galactosidase/beta-glucuronidase; PFAM: domain;
FT                   Glycosyl hydrolases family 2, TIM barrel domain; Di-glucose
FT                   binding within endoplasmic reticulum; Glycosyl hydrolases
FT                   family 2, sugar binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16130"
FT                   /db_xref="GOA:E4RVE4"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021720"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE4"
FT                   /protein_id="ADQ16130.1"
FT                   /translation="MKFQSKSGLAILFFALSPLLLYAQNYSINEGWTFKTEDTKEQKVS
FT                   FPHTWNAMDAQDETPGYSRTIGTYTRKLSTPASYAGKVVYLQFEGANQITEVFLDEKRV
FT                   GKHQGGYTRFNFDLTPYLRPGRTQELRIVVDNRHHVDIAPLSADFTFFGGIYRDVYLDV
FT                   REDLHISPLDFASSGVYVKTPKVSTSEAILEISTLINNHSSEKKEIQVLHTLKDPDGKV
FT                   ITSLTLKVDPEANTSNQRVEGKIQVPKPRLWTPGTPFLYTVETKILEKGQLRDECTTKT
FT                   GFRWFEFHADTGFHLNGKPLKLIGTSRHQDFKDKGYALEDAHHIRDIELLKNMGGNFLR
FT                   IAHYPQDPLILEMCDKLGILASVEIPIVNAVTESAAFSNQSIFMAEEMVKQNTNHPSLI
FT                   VWSYMNEVMLRPPYKNTEAAYGPYCQEVYKQAKAIQDKIKQLDPSRPTMIAFHGNVKAY
FT                   EDANLFTVPDIIGWNLYQGWYSDRPEQLDTFLKKYREKYPSKPTILSEYGADVDVRIHT
FT                   YSPERFDYSVEYGDLYHEHYLKTILNSPFLAGAAIWNLNDFYSEVRKNTIPHVNSKGIS
FT                   GLDRKPKNTYFLYQAHLLKQAFVRFASKEWQQRPEGNHEIKIYSNASQVTLYLNNKKWG
FT                   KLKVNAGIAKTHLNLPAGTHTLRAHISGAEDSFEIHTLPSQNFNELNVALGSKRFFWDE
FT                   NTKTLWQPEKAYEPGSYGFIGGQALRPKTRYGELPTAEVRIKGTDLSPLFLTQRIGIEK
FT                   FKADLPAGKYAVYLYWAELNGTEPADAIAYNLGNDAIQELAGKRSFNVKANGVSFLENY
FT                   EIDKEAGIQQAAVKKFNIDVKENGLTIEFIPIEGTTLLNAIKIIKRD"
FT   sig_peptide     complement(366781..366849)
FT                   /locus_tag="Lbys_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(366895..368682)
FT                   /locus_tag="Lbys_0353"
FT   CDS_pept        complement(366895..368682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0353"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: rmr:Rmar_1078 RagB/SusD
FT                   domain protein; PFAM: RagB/SusD domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16131"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE5"
FT                   /protein_id="ADQ16131.1"
FT                   /translation="MKNLSKLIAIFLTIGSLISCKDYLVEKSENSFTTATLFETAEGIN
FT                   KMVESLYSYERQLGRKGNSNGFLASHLWGERTTDLSIFTTGDDANLSRFTSPGPTSNIR
FT                   SLIYSPYWTHRYYIIGRTNEIIYYGAKFGDETKKSVAEAKFWRAYSYYGLWSRFGKLYL
FT                   STEPVTKENMDALKYTPADSAAVFQLLYTDLDEAIEGLPIEDRQDGKITQDAARHLKAL
FT                   VAAWSKNWTEVLKQVEAIEQNKAHSLSPTVAEIFDRKDFYNLPEALFSLNYSLERGGGE
FT                   GHRLGTQYINIIAETDYTHKLVNGTLVKYHEDNLGRSWGLAFPNSYLMSLYPENDKRIS
FT                   AYYKTDYTYQNPNKLITIPVAKEVVDSQTGLTYTTTTNKGPDPVKVSVGSRIYGRDIYA
FT                   ATNAKIDRRNILPSSIKMYDRWDKQIDADGPASYKDVMIYRLAETFLLGAEAALQLGDQ
FT                   AKAIKYFNMTWVRAGNAPFNGTLTFDMLKDEHARELAFEGRRYEFLKRNGIWYKQMKSY
FT                   AGDFTKYPASSVPYNKATYGISDGRDPKFGPNPNYYIDFNGSDNDVLVRFNVQPFHVNW
FT                   PIPQDQIDAMGNFPQNTGY"
FT   sig_peptide     complement(368623..368682)
FT                   /locus_tag="Lbys_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(368687..371680)
FT                   /locus_tag="Lbys_0354"
FT   CDS_pept        complement(368687..371680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0354"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   fjo:Fjoh_2077 TonB-dependent receptor; PFAM: TonB-dependent
FT                   receptor plug; TonB-dependent receptor; SPTR: Putative
FT                   uncharacterized protein; PFAM: TonB dependent receptor;
FT                   TonB-dependent Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16132"
FT                   /db_xref="GOA:E4RVE6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE6"
FT                   /protein_id="ADQ16132.1"
FT                   /translation="MNLNIRMLRIHLIWSLTFLLLFQVKGQVAPLIGHVKSSTGEALIG
FT                   VSILDLNGGSGAMTDADGNFTIALSKPDTRLRFSYIGYKEQTISVGGRTRLEVVLEEDQ
FT                   ASLDEIVVIGYGTTKKSDLTGSVASIKSESLEKFPATNVTEMLRGQAAGLNVTLDNSQP
FT                   GGASRVLIRGVRSLSGGQTPLFIVDGMIVPHINDLNSNDVASIEVLKDASSQAIYGSRA
FT                   SNGVILITTKRGKEGKTSVDFSVYTGVQDYKRNFDLYTPEEFAKLRFWAKYNEGMSGVG
FT                   TPDNPNYATVMDDAIMFQNLTNQQYTDWEDLLMTNAPQTKYDVSVRGGSGKIKYSASAG
FT                   YLDQQGLVQGSDFSRANIRSNLDFTPNKRVDVGVNFSFSRSLTNSVDGNFSDILTMPQL
FT                   SQAYDANGNLMREANTSGDINPLWRVKEYKANQENDYLNLAGHITFKPFKNFSYRINAN
FT                   LRTNNRESGNYKTKLYPNSTGTGELTNFTRSTFLVENVLNYSYTKDAHRLQATLIQAFD
FT                   EDLQKTLGMNFINSTTDIFDWNVVGDSEISNAIRSITRTRSQSYAARLQYTLMDRYLLT
FT                   ASVRRDGASVFGADNKWANFPSMALAWRINEEEWLKETPWLSELKARISYGVVGNWAIP
FT                   AYRTLGLSNSYEYLFGTQFSIGYLPSNQLINPNLKWETTHSFNYGVDFGFLKNRLRGTV
FT                   EYYKTNTKDLLIQRTVPSITGYNTMWDNLGETQSSGFEFSLQADIVNKKNIDWASGLTF
FT                   STQDSKILKIDGRTDENGQLINDLTNNWFIGQPINVTYNYVFAGIWQEGEVAEPHQYLP
FT                   GDAQPRPGDVKILDYNGDGKITVEDRKVYNLMPKWYATWNTSLRYKKFDFQAEFYTVQG
FT                   VTKNNPYLYAFNQGGSLNGKKNGIKVDYWTAENPSNTAPRPQFTASVPYMGLMGLQDAS
FT                   YLRLRTVTLGYSLPKSVLNKISASKARIYTTATNLFTLTDYKSYSPEKEPGAYPEARTF
FT                   ILGLNLSF"
FT   sig_peptide     complement(371603..371680)
FT                   /locus_tag="Lbys_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            371905..375771
FT                   /locus_tag="Lbys_0355"
FT   CDS_pept        371905..375771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0355"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR018060:IPR005467:IPR001789:IPR018062:IPR
FT                   011110:IPR011123:IPR003661:IPR003594:IPR000005:IPR004358;
FT                   KEGG: bth:BT_3334 two-component system sensor histidine
FT                   kinase/response regulator, hybrid ('one-component system');
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; Two component regulator three Y
FT                   domain-containing protein; Two component regulator
FT                   propeller; response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein;
FT                   Helix-turn-helix, AraC domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Y_Y_Y domain; Two component
FT                   regulator propeller; Response regulator receiver domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain; Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16133"
FT                   /db_xref="GOA:E4RVE7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE7"
FT                   /protein_id="ADQ16133.1"
FT                   /translation="MLKRSVGWTLLFIFLSLGIRAQSLIFEHLGVKEGLSQFTVHDFYQ
FT                   DEYGQMWIATSDGLNRYDGKKMQSFRPAVGDTTGLLGSNILAVTGNAQGKIYLICLSGL
FT                   LAYDLKTQKFEILAKKGVNTLAYAPGKVWIGSENVLKYYDETSRTFIDYKTFPKGVLIK
FT                   TILKGEDGALFIGTNEGLYEMDQNGKVREMLREVFTMCLFEGRDKSLWVGTLENGLYRI
FT                   NNRNEITHFKHSEQDPQSVSDDFIRAICQDDLGGYWIGTFKGLDYFDPETRTFRNFKHS
FT                   PVESHSLSDMSVWCIKKDSQGSLWIGTYFGGVNIFNPEYSFSRFYRPTGQQTGPNSAIL
FT                   GRVTEDSKGNLWICSDYGGLNYFDIGKNTFKYFKSAPGSLSSNILKDLYLDKEVLWIGS
FT                   HLGGLDKMDLKSGKITRIGLNTGNRSIDKYVRRITPYGKLLLLGTHDGIQVFDPNDNSI
FT                   RPLLPAQSTYGKGQVWDMMIDRRGVLWFSIRGLVGKYDLKKGELLPVKDNLQFHNAVFF
FT                   EDSRGQVWMGGAGKGLFCIKGEEVISYHTGNSGLADNYILDIEESNAGYILISTNKGLS
FT                   RFNITNQVFYNYNNHQFFPFEALNEKSIYVKKSGEIILSSLSGLMMISEKDLLYHPKPH
FT                   EILFTNLSLNNQDVRPGEGILSSALTSLNRIDVSEKYSSLKIDFAVTNYIKMLQPKVEY
FT                   MLEGFDDKWLSVPPDYSLNFTNLSSGTYTLKLRSLYGGKEMASSALEIHIQPRFYKTWY
FT                   AYLFYLCVIGGILFLLYSQVRLKDSLKNADIQAKHLEEVNQSKLRFFMNVSHEIRTPVT
FT                   LIMAQLDMLLNSSTPLSPSVLNRLQNIKKNAANLKKLITELLDFKKQEEGLVKLKCREE
FT                   DLVKYLHTVFVSFQDYANSLNIHLAFYSSEEQIMANFDVMQMEKVMYNLFSNAMKFTPP
FT                   GGEVRLQVGIQGSQAEIILSDTGIGISESSISQIFDRFYQAEDIAVQPLDPGTGIGLSL
FT                   VKDIVEQHQGSISVSSRLGKGTRFRILLPLREKKVTVPAREMGASKQKKLHKLFIAEDN
FT                   SDLQGVLSDLFSPMYDVLTEGDGKAVFERVKAGKPALVLLDVMLPNVSGFEICKRIKSD
FT                   LSTKEIPVVLLTAAASGDKKIEGLQMGADDYVTKPFDARELVIRCNSLINNRQELKAGL
FT                   NKEKVYGSNELHELFIKEATEVVTRNIDNADFSVGQFAEQLNVSRSSLFSKMKEITGQT
FT                   PNDFIQEVRLKKGLELLNKDDSVNQIAFAVGFNDPSYFIKQFRKYYGVTPGQYKAGKRK
FT                   IKPA"
FT   sig_peptide     371905..371967
FT                   /locus_tag="Lbys_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(375844..376605)
FT                   /locus_tag="Lbys_0356"
FT   CDS_pept        complement(375844..376605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0356"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COGs: COG1349 Transcriptional regulators of sugar
FT                   metabolism; InterPro IPR001034:IPR018356:IPR014036; KEGG:
FT                   dfe:Dfer_3128 transcriptional regulator, DeoR family; PFAM:
FT                   regulatory protein DeoR; SMART: regulatory protein DeoR;
FT                   SPTR: Transcriptional regulator, DeoR family; PFAM:
FT                   Bacterial regulatory proteins, deoR family; DeoR-like
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16134"
FT                   /db_xref="GOA:E4RVE8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE8"
FT                   /protein_id="ADQ16134.1"
FT                   /translation="MTITERHQFILEELHNKGKIHIQDLSEQLEVSGVTLRKDLKILEE
FT                   KKLLYRTHGGASLQNPYAIERPIHEKQHFNSVEKQNIGKAALRIIGNNDSLMIGSGTTV
FT                   FEFARQLKPSHRVTVITPALKVGMELANTPNVEVLQLGGLIRPNSSSVAGNFAEFMLAQ
FT                   ISCGILFLGVDGIDLDFGFTISNLTEAGLNQEMIKTAQQVAILADHTKFGRRGIAKICD
FT                   IETVNFVITDSLAPKESIKALEEAGVQVIIA"
FT   gene            376859..379930
FT                   /locus_tag="Lbys_0357"
FT   CDS_pept        376859..379930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0357"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR012910:IPR000531; KEGG:
FT                   cpi:Cpin_6448 TonB-dependent receptor; PFAM: TonB-dependent
FT                   receptor plug; TonB-dependent receptor; SPTR: Putative
FT                   uncharacterized protein; PFAM: TonB dependent receptor;
FT                   TonB-dependent Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16135"
FT                   /db_xref="GOA:E4RVE9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVE9"
FT                   /protein_id="ADQ16135.1"
FT                   /translation="MMKALYAPKVFQYWKAGLLIISLLFCHGVGLAQNRISGVVLDDAK
FT                   QPIIGANVLEKGTLNAASTDLEGKFTITVAPGATLTISFIGYLSKEVTVGNQTSFTITL
FT                   EEDSQSLEEVVVVGYGTQKKVNLTGAVSAIGGEQLERRPIVSTSNALQGVAPGVTVTSQ
FT                   TGAPGADEGQIRIRGINSFGGSDSNPLVLIDGVPGLINQVDINLIESISVLKDAASAAI
FT                   YGSRAANGVILITTKRANKGKTEMNYRGYTGWQSATNIPKVTDGLTYMRVFNEANMNDN
FT                   GYVLYDDAAIRDFEQKYKANPDNFDWQKAILDGSGFTQNHFVSLSANSDKIRVMPSFSY
FT                   ISQDGIIKNTGFERYILRNNMDVQVNRKLSLKLDLSYTKGDRKQIANEGTVWNYLGRMP
FT                   TNIPIRRNGLWSEGWVNINPVANIEEGGNRKVTNIEFQGNISATYKPVSWLSFTGLVSP
FT                   RYRTTNSHNFIKSIMTYNDDGSEAGASNTFTELTETAYRYTFGNYQFLTSAYKTYGKHN
FT                   FNLLLGASRETYDEKYLMGYRRDFTYDTYEVLAAGANNETRDNNGTHAQWLLVSTFGRL
FT                   NYDFDSKYLFEANLRYDGTSRFIAANRWAAFPSFSAGWRITEEEFMSGLRNSINQLKLR
FT                   VSWGKLGNQNIGSSYYPFADALAIGSISMAEKIYQLVTQNTMSNPDLKWEETTMKGIGV
FT                   DATIFNHFNITADYYDKVTDGILLTLYTSQLTGLNAPYQNAAKVSNKGWELGINYDDTF
FT                   GDFKLGLGFNISDVKNKIIDMKGQTSGTLLRQQEGYPVNSIFGLIADGLYQSQEEINAG
FT                   PTQFGTLKPGDIRYRDIAGAFDANGNPIPDGKITDDDKVVIGSTLPRYTYGMNLDLGWK
FT                   GFSANVFFQGVGKADGYLNSHYVIPTVNSSAVKTWQLDYWTPENTDASLPRLSTTSANN
FT                   TQNSSFWMKDASYLRLKNVQLGYTLPKSWTQKLNLNSAMIYVNGQNVFTKTKFWKGYDP
FT                   EIAYDAGASDGVSLGGGNYYPQVKVYSVGLDIKF"
FT   gene            379937..381682
FT                   /locus_tag="Lbys_0358"
FT   CDS_pept        379937..381682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0358"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: dfe:Dfer_1849 RagB/SusD
FT                   domain protein; PFAM: RagB/SusD domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16136"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF0"
FT                   /protein_id="ADQ16136.1"
FT                   /translation="MKKVLISISLLFLLNSCELDRFPLNGPTTGTFPATAQEAEMGLLG
FT                   AYKGLTLLSAADTPWLHVMDNITDIGYARPGVNYTSPITSSLTTTNALAIKPWEIHYKT
FT                   IARCHSVLDNLESIKDKMQESTYYMIDAELRVIRAYAYSQLIELYGDVPLVKNGLKLGE
FT                   TDVPRTSKKEIQQWIIDEMTAVADKLPAAQTSYGNVRVGAVAAYMLKARVALYAQQYTV
FT                   AADAAAKALALSEGIYELTPFNSTKQFVGKDHSAGEPESSNIFGYEGYKSSKEWIWVME
FT                   YNKSISGNTHNQGYYMGSRLGKGVCYWGPTQNLIDSFQAIDGLPIDQSPLYDAANPFAN
FT                   RDPRLDLYCVRPHSRLLGIQFEPHSSFARVNNYWPVINGTSATPTQVSNTDATNAYRSF
FT                   SGYLWRKHQDVSDYNNNSVSGNSDLNCGIFRFAELLLLYAEAKIESNSIDASVYEAINK
FT                   VRRRAGMPEIKNGLSQAQLRTALRYERKVELANDGLRWYDIRRWGIAQEVMNGVLYLNR
FT                   AATPWTKSVLVRIDENYSPIYNTTEANKYFNTQDVIYKIGKDEYWPIPFAELNANKNLT
FT                   QNPGY"
FT   sig_peptide     379937..379993
FT                   /locus_tag="Lbys_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            381732..382832
FT                   /locus_tag="Lbys_0359"
FT   CDS_pept        381732..382832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF0974 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16137"
FT                   /db_xref="GOA:E4RVF1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF1"
FT                   /protein_id="ADQ16137.1"
FT                   /translation="MKRLLTLTLFLFHTVLVFGQYQKPQLEDQKSWSMIVIPDIQNYVK
FT                   WTRNQPVLDLMMAWIEENLDSLNVKMVMCAGDLVELDDILVPGIDGNTPAPRQWATPAQ
FT                   AFKRLDGKVPYIAASGNHDYSINAKGERTTNYPTYFPIDKNPLNFKYLVQNTRNVQGIH
FT                   TLENAVLEMKGLNGKDYLFMTLEYAPRDTVINWAKRVSSLEQYKNHRIILMTHAYLNTK
FT                   NERTTGENRWFMYEPYYVNSVVEKSARIPLPQSNNGEQIWEKLIYPSSNFAMVLCGHIS
FT                   GEGYRMDKNIAGKPVHQMLFDAQDYGGGHRNGNGGDGWLRILEFKPDNKTVKVKTFSPL
FT                   FAISPSTQHLAWKRDAKNEFVLNYED"
FT   sig_peptide     381732..381788
FT                   /locus_tag="Lbys_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            382822..384045
FT                   /locus_tag="Lbys_0360"
FT   CDS_pept        382822..384045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0360"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2271 Sugar phosphate permease; InterPro
FT                   IPR011701; KEGG: phe:Phep_0456 major facilitator
FT                   superfamily MFS_1; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16138"
FT                   /db_xref="GOA:E4RVF2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF2"
FT                   /protein_id="ADQ16138.1"
FT                   /translation="MKIEPQKRRWLIIAVIFLAIVFNYVDRQLVSILKPMLKGEFGLDD
FT                   AGYALIVNVFTVCYAVMYPVTGWLVDRFGEKMVMFYGVIIWSLACIGGGLASTVKQFSF
FT                   FRGLLGVAEPTNFPAQLKVVTVWFPGKLRATANSFCVAGSSIGAIIAPPLIAWLALTYN
FT                   WKVAFIAMGAVGILIAILWKIVYVSPPASVSESEGIKDDGIKFSWPQLWKTRSLWGVIL
FT                   IRFVSDPVWYFCLFWLPGYLQESSGLTLAQIGMFGWIPFLVADLGAIGTSSWSDKMVRG
FT                   GKEPLKARMIMLSTVAALGPLCAFTPFATSPWVTLLLFSLVAVACLSWLFSISVVIAEA
FT                   FPVGNVASVLGIAGGFGAVGAVVFNYFVGQLMGSIGSEKIFLTMAVMHPLAVLLLWTMI
FT                   RKEKPNVE"
FT   sig_peptide     382822..382902
FT                   /locus_tag="Lbys_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384045..385424
FT                   /locus_tag="Lbys_0361"
FT   CDS_pept        384045..385424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0361"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR003953:IPR001613; KEGG: phe:Phep_0457 hypothetical
FT                   protein; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16139"
FT                   /db_xref="GOA:E4RVF3"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF3"
FT                   /protein_id="ADQ16139.1"
FT                   /translation="MKTIQEPAREIKVRKEVDVLVVGGGPSGITAALAAAEDGLKVLLV
FT                   ESRSFVGGNMTIGLPILGFLGQKGNQIIKGIPQKFIDRLKAVDAASEHRPCPLHMSLTL
FT                   VEPEAVKTVALEMLMEAGVEVMFYSFFSEAIVEGDELKGIIIESKSGREAILAKTVIDC
FT                   SGDADVAYRAGVPTEYGNAEGGVQPPTLMFCLGGVDTEKLRLSIAEEPRTYLTDFIPAE
FT                   YFGQNNQFIVVGLRSLIQKAAEDGLKLPVERTIIITGLRKGEAWINMTRINGVNGTDPE
FT                   SLTYGETEGRKQMADIQKYLIEYVPGFENAYFVKTAPFVGIRETRRIGGKYTMTQEDVL
FT                   SCKHFEDAIAVASYPLDIHHPQGGGCTLVWCGDCYDIPFRSLVPQNIKNLLVAGRSISC
FT                   THEAMSAIRVMAPCMAMGEAAGRAAKQAVRKGISVDQISVKELQDELLEKGAYLREYVE
FT                   A"
FT   gene            385421..386302
FT                   /locus_tag="Lbys_0362"
FT   CDS_pept        385421..386302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0362"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="COGs: COG3568 Metal-dependent hydrolase; InterPro
FT                   IPR005135; KEGG: phe:Phep_0458
FT                   endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR:
FT                   Endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16140"
FT                   /db_xref="GOA:E4RVF4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF4"
FT                   /protein_id="ADQ16140.1"
FT                   /translation="MKRRNFIQLSVGALPLLSFKFPVSAGHRIMTCNIRVALDEDEEKG
FT                   VGWSSRKKICLDIISKYKPDIICLQEVLKGQAADFKKHFSGYQLLGFDGPEMDANPVGY
FT                   HGIAKNPILYSTKKYELISAGTYWLSETPLVAGSKSWDTARARHANWIRLKDKSTGKEF
FT                   RVINLHLDHVSNDAKFHQLKMVIEEAGQYLPAFPQILCGDFNSRFQSKVFSTPRNAGWK
FT                   EGMEILYGEKEMGFTGHAFKGLQYEKGPSGGRIDFIWYKGDIEVKRAEILRDEVKGVYP
FT                   SDHFFVLNDFQL"
FT   sig_peptide     385421..385495
FT                   /locus_tag="Lbys_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            386299..387501
FT                   /locus_tag="Lbys_0363"
FT   CDS_pept        386299..387501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0363"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: dfe:Dfer_3129 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily; TIGRFAM: polyol
FT                   permease family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16141"
FT                   /db_xref="GOA:E4RVF5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF5"
FT                   /protein_id="ADQ16141.1"
FT                   /translation="MMQRIGLPKPLAWGYLGILIFMMGDGMEQGWLSPYLIDRGLAMEH
FT                   SATLFSLYGVTIAISSWFSGVLTESLNPRKTMWLGLLLYLLGTVLFIGIGLKDLDLGVL
FT                   YLTYALRGFGYPLFAYSFLVWISYVVPQNALGRAVGWFWFVFTGGLNVLGAFYSSWAIE
FT                   HLGHIPALWSAVAWVLVGAIFALVLNKATFPKLETQGKLDNLLRGLTIIKSEPKVALGG
FT                   IVRIINTAAQFAFPVFLPVYMAEQGIDTKHWLYIWGTIFSSNIIFNLIFGFVGDRLGWR
FT                   QTIMWFGGVGCGLTTLLFYYSPQWFEGNYSLVLACGVLWGACLAGYVPLSALVPSLVEK
FT                   EKGAAMSILNLGAGLAVFAGPAIVWATFGAVGAEGVVWILAGLYFVSAVLTHQIKLSAK
FT                   N"
FT   sig_peptide     386299..386376
FT                   /locus_tag="Lbys_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            387513..388514
FT                   /locus_tag="Lbys_0364"
FT   CDS_pept        387513..388514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0364"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006139:IPR006140; KEGG:
FT                   phe:Phep_3505 D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; SPTR: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16142"
FT                   /db_xref="GOA:E4RVF6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RVF6"
FT                   /protein_id="ADQ16142.1"
FT                   /translation="MKVLVTSPYNEGGLKELNQHVGETVYRPWKDNGRAFNEDELIQLL
FT                   KESEADALITEHDHVTEKVIQSFPDLKFIGVCRGTPSNVSIKEASAHRIPVFYTPARNA
FT                   QAVAELFVANVITFLRDTLFANEWLKAGKWDEGAHTSYLIFKGNELAGKKVGFVGFGAI
FT                   GQLIASMIASYPCEISYYDPYVKAEDFPLYQKQSVEEVFANNDIVSVHLPVTEETKGLI
FT                   SRELFSVMKPDALFVNTARAVVVDRNALLEVIEQKKIKGAILDVFDHEPPDELDYRLIR
FT                   AKNVLATPHIAGATHEVEDHHVRIMNETLVNWLSKGIINERRIANRQILVNA"
FT   gene            388511..389938
FT                   /locus_tag="Lbys_0365"
FT   CDS_pept        388511..389938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0365"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: dfe:Dfer_3131
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Carbohydrate kinase FGGY; PFAM: FGGY
FT                   family of carbohydrate kinases, N-terminal domain; FGGY
FT                   family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16143"
FT                   /db_xref="GOA:E4RW00"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW00"
FT                   /protein_id="ADQ16143.1"
FT                   /translation="MKTAYLVLDIGTGNVRAALVTPEGEILNVARADIKYYRDELFPDA
FT                   IYFKPSELIEELKELTQAVLSPDVEVKAVTSTSQREGIVLVNKEGKATWGLPNIDHRGR
FT                   EWENSFGDKTEVYLTSGRYPTSLFSVYKCIGMRERRGEEWKNTQFFLSISDWALWELSG
FT                   KAVYEDSQASETLLYDVAEGNWSSTMLQKFGIAKEVLPELVKSGSVLGEILPTIAQEWN
FT                   LPSTAVCVVGGGDTQMAIKSTVPSNGDVILVSGTTTPVVKLEDHYLTDDEQRTWTSRDI
FT                   EAGRFVFEANAGVTGLNLQRLKEVFYPNESYEVMQRELEETDPGYCFASLGSLVAYEKA
FT                   PITTGGFVFPVPVSHELKRSHFVWAILVDIAFSIVENYKVLAACSSHTSGYLWACGGGL
FT                   QSEVLRQLIADISGLEVRIRKGYQQATVIGSALLCNEALGINVGGSEGSYEVAKPMKDR
FT                   TALYEKWLEVRNSFRKA"
FT   sig_peptide     388511..388561
FT                   /locus_tag="Lbys_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            389935..391359
FT                   /locus_tag="Lbys_0366"
FT   CDS_pept        389935..391359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0366"
FT                   /product="Carbohydrate kinase, FGGY"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484:IPR018485; KEGG: dfe:Dfer_3132
FT                   carbohydrate kinase FGGY; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Carbohydrate kinase FGGY; PFAM: FGGY
FT                   family of carbohydrate kinases, N-terminal domain; FGGY
FT                   family of carbohydrate kinases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16144"
FT                   /db_xref="GOA:E4RW01"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW01"
FT                   /protein_id="ADQ16144.1"
FT                   /translation="MKQFLGIDIGTQGVRVVVLNQEGNTLAAGDQAFQFSGDLRIEQDP
FT                   LHWWEILDQLLIQVLNALGDKSKIHAIGVTSTSGTIIPIDWKGNPLHSAIMYSDQRSAE
FT                   QGYRCQALAKERETVGYTAFNSSSGLPKMIWFLENFPEKRHDLYKFIHASDFITGTLSG
FT                   NFGVTDYTNVLKSGYNLHEEVWPSYIMDLGVHLAWLQDVVPSGYPIGKILPAWAERYGL
FT                   SPESLVTAGMTDGCVSQVASGAVAPGEWNTTIGTTLVIKGVSTEEIKDLSGAIYNHRHP
FT                   QGYWMPGGASNTGADWVSHYFGGQNLKELGEKAEALVPTGDVAWPLLQHGERFPFFSPQ
FT                   ARGFMPEGKEDAYVFACGMEGVAYIEKMAYDRIEELSGQKVNKVFSAGGGSNSDLWMKI
FT                   RSTVLQVPIQKMANTTGAAGAAILAASGTFYEDLPTAARKMIKVEKVIEPETRWIEKYQ
FT                   EGYKRFLGELKSRNIC"
FT   gene            391353..391940
FT                   /locus_tag="Lbys_0367"
FT   CDS_pept        391353..391940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0367"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR001345:IPR013078; KEGG: phe:Phep_3502 phosphoglycerate
FT                   mutase; PFAM: Phosphoglycerate mutase; SPTR:
FT                   Phosphoglycerate mutase; PFAM: Phosphoglycerate mutase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16145"
FT                   /db_xref="GOA:E4RW02"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW02"
FT                   /protein_id="ADQ16145.1"
FT                   /translation="MLKIYLLRHGQTDYNAQGNKYCGRTDIPLNAKGLEQAEAVRKQLE
FT                   GIPFDGVYSSPLQRAVHTARIASGQDPITDERLIELDFGQWEGKTREEFVKEDPDAWDL
FT                   WEKAPEQNKAGRTGESGEEVVWRMESFFKSLTNGTYMVVAHNGVNRLFLARQLGMPLKN
FT                   YRKLVQENSRITLIIYDPQKGWTLEMLNANIK"
FT   gene            391937..392800
FT                   /locus_tag="Lbys_0368"
FT   CDS_pept        391937..392800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0368"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COGs: COG0584 Glycerophosphoryl diester
FT                   phosphodiesterase; InterPro IPR004129; KEGG: pdi:BDI_3922
FT                   glycerophosphoryl diester phosphodiesterase; PFAM:
FT                   glycerophosphoryl diester phosphodiesterase; SPTR:
FT                   Glycerophosphoryl diester phosphodiesterase; PFAM:
FT                   Glycerophosphoryl diester phosphodiesterase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16146"
FT                   /db_xref="GOA:E4RW03"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW03"
FT                   /protein_id="ADQ16146.1"
FT                   /translation="MRKIFLLGLLLWCSNTYAQKHKLHFRTFDDIKKYFSYEPGKKIIS
FT                   GHRGTHIAKYPENSIEGFQHVLNHTPAFFEIDPRLTKDSVIVLMHDATLDRTTTGSGKV
FT                   SDFTWAELQKLYLKDGEGNVTKYKIPTLEQAMDWAKGKTVLNLDKKDVPLERIAALIKR
FT                   KKAERYMMVTVHTAEQALFYHQQVPELMMSAFVKTEEALKSYENAGVPWNKMIAYIGSD
FT                   MKPDNQKMYELLHARGVSCMISAAPKYDKLKTLEERAEAYRAIFSEGADVLESDLPIEV
FT                   SRAIRK"
FT   sig_peptide     391937..391990
FT                   /locus_tag="Lbys_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            392837..393781
FT                   /locus_tag="Lbys_0369"
FT   CDS_pept        392837..393781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0369"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="COGs: COG1957 Inosine-uridine nucleoside
FT                   N-ribohydrolase; InterPro IPR001969:IPR001910; KEGG:
FT                   gym:GYMC10_4824 inosine/uridine-preferring nucleoside
FT                   hydrolase; PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; SPTR: Inosine/uridine-preferring nucleoside
FT                   hydrolase; PFAM: Inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16147"
FT                   /db_xref="GOA:E4RW04"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW04"
FT                   /protein_id="ADQ16147.1"
FT                   /translation="MKKITLSLAGVFLVIGSSFAQLLERLSHIPAKANVVIDTDAFNEV
FT                   DDQFALVYAILAQEKLNIQAIYSAPFINKRAKSVEDGMEKSYQEIQKILELMKVKFPVY
FT                   KGSTDFLKDKKTPVKSAAAEDLVDRAMKAKEPLYVLALGAPTNVASALIMKPEIKDKIV
FT                   LIWLGGKAPHFNTAREYNLLQDMHSSQILFDSGVPMIQIPTEPVTSHLVTTVAELQANI
FT                   GGANKISDYLIEIVKGYSPDHFAWSKVIWDIAVIAALVEPSALSYEMRSTPILTDQMTY
FT                   SYDGSRQIYKVATFINRNKVFKDMFTRFKAFKD"
FT   sig_peptide     392837..392935
FT                   /locus_tag="Lbys_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(393998..395488)
FT                   /locus_tag="Lbys_0370"
FT   CDS_pept        complement(393998..395488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT_2802 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16148"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW05"
FT                   /protein_id="ADQ16148.1"
FT                   /translation="MLQSDALILLIHNLSPAEKKKFKSGRKTADYTRLYDIIENSGTAS
FT                   SEEIKKKFKDEVGSSFSASVSYLYRVLQDLLLHMREEQDSHYLLFNQILKARVLFEKSL
FT                   YEEALSMLALAKKKAKHHQNPIAHLYASRLEMEFLLFLNFPQLTERELLNKHFQINETL
FT                   KEIRKVNEHSSLYELLRHRLLYKGSIRSQKQKESLNDLVISEMSINSNHKDNFEIKKNH
FT                   LLFQSNYLIGTGDYKSALHSFRELNALFEKNPLFWASQPFYYVNVLEGILDNLRGMKIY
FT                   EDIPYFIERLRSIASKTEALQNQVEALTFIYTLIPFLDTGDFESASKIASQYEDFTALN
FT                   LSTRAEISLYLSLLYLGFKNYKKAQKTLLSEIIRGNDLYILPTYRTMRLLHLIIHEKLG
FT                   NTDVVHFEGRSIKRELAKADKAYRVEKLMISYLVSEKKIMLSKDREKLWKKYQPLLIEI
FT                   RGDVYERQLLKTFDFTAWLEADIRRVDLREVLKTRSKS"
FT   gene            395765..396679
FT                   /locus_tag="Lbys_0371"
FT   CDS_pept        395765..396679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0371"
FT                   /product="ribokinase"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002173:IPR011611:IPR011877:IPR002139; KEGG:
FT                   pdi:BDI_1657 ribokinase; PFAM: PfkB domain protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: ribokinase;
FT                   PFAM: pfkB family carbohydrate kinase; TIGRFAM: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16149"
FT                   /db_xref="GOA:E4RW06"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW06"
FT                   /protein_id="ADQ16149.1"
FT                   /translation="MQNVSKSKIVVVGSSNTDMVIKASRLPVPGETVIGGEFMMNPGGK
FT                   GANQAVAVARMGGQVTFITKTGNDLFGRQSMELYNSENINTDYVFSDEDHPSGVALISV
FT                   DVYGENCILVAPGANAALTTADIEKARKEIEEAEILLMQLEIPMETVEYAAKIAAEKGV
FT                   KVALNPAPAQTLSNELLKCLYIITPNKNEAEILSGIKVRDWDSAQKSADRISEKGVDIV
FT                   VVTLGGLGALIKEGSSYYRVEAEKVEAMDTTAAGDTFCGTLCVGLSEGMSIEEAVRMAC
FT                   KASAITVTRMGAQASLPYRHELT"
FT   gene            396687..397703
FT                   /locus_tag="Lbys_0372"
FT   CDS_pept        396687..397703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0372"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="InterPro IPR001910; KEGG: bth:BT_2808 putative
FT                   inosine-uridine preferring nucleoside hydrolase; PFAM:
FT                   Inosine/uridine-preferring nucleoside hydrolase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Inosine-uridine
FT                   preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16150"
FT                   /db_xref="GOA:E4RW07"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW07"
FT                   /protein_id="ADQ16150.1"
FT                   /translation="MKKSILLIASLFFAACEKPSEPEVPVIIFETDMGNDVDDALALDM
FT                   IYKYLDKEKVKVLAISSNKQSPYSTEYIHLMNHWYGYPDIPIAKVINGIDSENDARKYA
FT                   EFVSLQKDSTGAPLFQRPDFDYDQVPEAVSLYRGILAKQPDHSVTLVSVGFSTNIYRLL
FT                   NSLPDEYSPLSGKELIAKKVKLLSMMAGSFGEKKIPEYNVVKDIPAAQNITKEWPTPIV
FT                   FTPFEAGIAVTYPATSIENDFTWAPYHPVVEAYKHYLDMPYDRPTWDLIALLYVVENSP
FT                   EYFTLSEAGAITVDDKGYTSFTASKDGKHRYLTVDSVQALKTRQHFVELITAKPNLK"
FT   sig_peptide     396687..396737
FT                   /locus_tag="Lbys_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            397705..398709
FT                   /locus_tag="Lbys_0373"
FT   CDS_pept        397705..398709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0373"
FT                   /product="sugar transport family protein"
FT                   /note="InterPro IPR010651; KEGG: pdi:BDI_1654 putative
FT                   integral membrane protein; PFAM: sugar transport family
FT                   protein; SPTR: Integral membrane protein; PFAM: Fatty acid
FT                   elongase 3-ketoacyl-CoA synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16151"
FT                   /db_xref="GOA:E4RW08"
FT                   /db_xref="InterPro:IPR009834"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW08"
FT                   /protein_id="ADQ16151.1"
FT                   /translation="MFIVDNYALAVVFCVITMICWGSWGNTQKLAGKSWRYELFYWDYV
FT                   IGILLFSLISAFTLGSMGEQGRSFLPDLAQADAANLRSAFIGGIVFNAANILLSAAISI
FT                   AGLSVAFPVGIGLALVLGVLINYFGSAKGDPVLLFSGVALVTVAIILNAIAYGKQAKES
FT                   KKVSSLGLILSLVAGLLMSFFYRFVAAAMDLEDFVNPAVGKMTPYTAMFIFALGIFVSN
FT                   FLFNTLIMKKPFVGEPVDYKAYFKGGFNIHLVGILGGLIWGLGNAFNLIAAGKAGAAVS
FT                   YGLGQGATLVSALWGVFIWKEFKNAPKEANKYLYLMFILFLIGIALIIQAGSN"
FT   sig_peptide     397705..397779
FT                   /locus_tag="Lbys_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            398733..401756
FT                   /locus_tag="Lbys_0374"
FT   CDS_pept        398733..401756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0374"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910:IPR000531; KEGG: bvu:BVU_2227
FT                   hypothetical protein; PFAM: TonB-dependent receptor plug;
FT                   TonB-dependent receptor; SPTR: Putative uncharacterized
FT                   protein; PFAM: TonB dependent receptor; TonB-dependent
FT                   Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16152"
FT                   /db_xref="GOA:E4RW09"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW09"
FT                   /protein_id="ADQ16152.1"
FT                   /translation="MNFSMFFTKRKAWQRPLYSLLCMMCCCSLAFGQISGRVTDEAGEA
FT                   VIGASVREKGTSNAAATDVDGKFSLNVKTGAILEVSFIGYEKAEVKVDGRSFYEIILSQ
FT                   DQTALEELVVIGYGTVKKKDLTGAVSVINTQALRDRNSKDIVSSLQGLASGVTVTSSGL
FT                   PGQQASVRIRGLGSLTNNNPLFIVDGMIGGEAHLNPADVESIQVLKDASAAAIYGSRAA
FT                   NGVIIITTKKGQEGPMKVQFDANLSITDLPRYDLMDAATWKKYDDMAYDEAIRSGVAGV
FT                   VRRQNHFDGNTDWQDEMLSTGVLQNYNLAFSGGSKSGKYFVAFNRMEDKGALYSTGYDR
FT                   YGFRVNTSGQKGIFSYGENISFTRTNRKNLNGNPWANFIGISPTIPVRDENNPGGYGYG
FT                   NPDRANNYGLNMVAMQDLRPQDNPENILKSNVFGQVVLFKDLTAKTNLAYTWYHGVTNT
FT                   LRKTGNWTMGQGSDAAYLGYESYRSDDFLVEQTFNYKKQVGKHDIDAVAGATYNTFKGF
FT                   TNWITKLNPLMVGDDYITSLDAATGNTSAGGSYQQARIMSYLGRINYSYDDKYLFQFTL
FT                   RRDGTSRLPESTRWGNFASYSGAWRISKESFFQVPFISDLKIRASHGTLGNSSIGYWDY
FT                   QAVINTAPRAVFGSPEIRVLGMTQSRLTNTDLVWERKTTTNVGFDAAFLNNKLTLSAEY
FT                   FDAKSKDLLVYLPILMSSGNEGGNPAVNAGSLSNKGVEIDLGWRDQLTPDFQYSASLNL
FT                   TKVKNKVLDLGYGRVEYFESLSKAEIGQPLGAFYLYKMLGIFQNEAEIQNYKNAAGKVI
FT                   QPNARPGDIKYDDYNGDGIISSEDRQLVGNPWPKFELGLNLGASYKSFDLSINGYGRFG
FT                   QDVWNGAAAAAGDFANNQNNFNGIVPWTAENPVNDRPRIVFGDSRNSRGDQDRWLEKGS
FT                   FFRVSQIALGYSLPQKWVGTLGLDQVRAGVTLQNMLTFTKYSGLDPEFRDSGIFTIGAD
FT                   HMSFPNPRSVMFSLSLSF"
FT   sig_peptide     398733..398828
FT                   /locus_tag="Lbys_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            401762..403327
FT                   /locus_tag="Lbys_0375"
FT   CDS_pept        401762..403327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0375"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: fjo:Fjoh_2021 RagB/SusD
FT                   domain-containing protein; PFAM: RagB/SusD domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16153"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW10"
FT                   /protein_id="ADQ16153.1"
FT                   /translation="MKKYIIGLTSLLSVGLSSCDDSKLDLVNENTISTGNFWKTEKDAE
FT                   AGVIAVYGMFYRQGTWTRNIYTQMHGLADEGVSLAGWTELNEYAKFIYTNYNFSEVNTK
FT                   IWREHYTAIFRANQVLDKINDIPFQSEQRKQDLIGQVKFLRSFYYFYMTTLWENLPFVL
FT                   KTSSASDMPEQKTPKEIFDQLEVDLKEAIEKLPATRNNTEYGRPTKGAAYGLLAKVLMQ
FT                   NGKYADAIKCFEWLVDGEGKSYYDLTADYSDNFNNKTENNKESLFEIQFSLMNYVGFDQ
FT                   TDNYLDPNAQLGTQIEMNQAPAGIGWNNIEARRWLVDYYKREKTVDGKNDIRLFHTVWY
FT                   DDAGKDFPERADTLIYGNRWRNDWGQRVFIKKYSTTANPLFYWNDNNFRSLRYADMLLL
FT                   YAEALNEVNGPNAKAVELVNRVRSRVQLPNLQNSTYYNYANIMSSKEAFKSHLKIERGL
FT                   ELSLECVRWIDLKRWGLEDQKTIDELKSRDADFNNFIIGKSARMPIPQSEVDNNVNLKQ
FT                   NPNY"
FT   sig_peptide     401762..401815
FT                   /locus_tag="Lbys_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            403402..404385
FT                   /locus_tag="Lbys_0376"
FT   CDS_pept        403402..404385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_4192 carbohydrate binding family 6;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16154"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW11"
FT                   /protein_id="ADQ16154.1"
FT                   /translation="MSQVMAFAQKTVSPEINYEFSGGAGYYNYAPSVIQDEYGIRYAFV
FT                   CQNLEPFKIVDYIYLYKGIPTSKGYVWQPGTRIMDPSSSGWDINHVCDPDVRQFKTKYN
FT                   GETYNYIMTYLGTDQWDNFHNQIGLALSKNIEGPWIKFDRNPIIGSASKTTWGVGQSTS
FT                   IVLNDSTIRIFYSNSAGGFTYRDGILSDLNNIRWSEEKYIKNMPGNNYPAFSKKNVYMV
FT                   SERRENMDKLIPTWVGNVAQLSYLPLSEDLSTDGSKWIKIGAVTPQGSGFPRNHNPGIL
FT                   TDPKGYMLNDDELIMYFTPAMTGENWLWSYDLYSAKFDLKKYFAHE"
FT   gene            404378..405517
FT                   /locus_tag="Lbys_0377"
FT   CDS_pept        404378..405517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_4525 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Inosine-uridine
FT                   preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16155"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW12"
FT                   /protein_id="ADQ16155.1"
FT                   /translation="MNKTFFLFFLLAFTSVLGKDVIVITDCYHPYQDPGDNLDLLHSYG
FT                   LKDIRTKGIILDITDAFRKDTADHPTLWKDPRGPREAGIIPLLQLEYIFGKKIPYAIGP
FT                   ISMMQHERDEMRSLRAFEEEGILLFLQLLRDAQEPIEVLSFGSARVLAVAFNREPELLK
FT                   AKIKMIHLSAGTASQNHELGKDVGANMIPGGEWNVALDVHAFNRILKSDLPLILYPCAG
FT                   KDGGFVKDVHNTYFTLKSLDFLKELRAPIQNFIHYAFTTSTRKDFLRAMDEEGAYSRGE
FT                   ETPFKSFHFWETPIWIMVRELVIVVDGNHSYSLKKSASKGERVVSNQILPIRFTEIRED
FT                   GRFQFEKVKTSRQFIFYREDLEESERALNAIVPQVLKEI"
FT   sig_peptide     404378..404449
FT                   /locus_tag="Lbys_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            405514..406641
FT                   /locus_tag="Lbys_0378"
FT   CDS_pept        405514..406641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0378"
FT                   /product="carbohydrate binding family 6"
FT                   /note="KEGG: kfl:Kfla_4192 carbohydrate binding family 6;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16156"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW13"
FT                   /protein_id="ADQ16156.1"
FT                   /translation="MIKYCWVLVFLCACSKSAPVPDLPEPPPVPTYQWVGQERVFGFYN
FT                   QYRYSYCPSVVKDGSGFTHMFFCGNPEQTIMVDNIYHVKWQEGQALTEAKSVLQPGVLG
FT                   SWDDHHTCDPSVVQGDFSMGGERYTYAMFYLTNPYSAYYNEVGVAFSNSLDGDSWVKYP
FT                   KQIVSKPWTYEGDELLPNGGKSWGVGQPSAFTLDKKGKVILTYTVGDIQGTRIEWAELD
FT                   LSDMDKFQKRNGNRMVQNGLVNIGYTGQDYTCNSDFAVDIEKNKIVMVRPVQPHPSTYP
FT                   AFLNESLEVNYMDLSDFMAGSGKWEVMLRISPYMTGFARNHNAGLERNGFGEISKWEEP
FT                   TVYFTVSKAAPEVSAGTTTHAEWTYHIYRGKIVKQ"
FT   sig_peptide     405514..405567
FT                   /locus_tag="Lbys_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            406674..407348
FT                   /locus_tag="Lbys_0379"
FT   CDS_pept        406674..407348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0379"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG0637 phosphatase/phosphohexomutase;
FT                   InterPro IPR005834:IPR006402:IPR006439:IPR005833; KEGG:
FT                   vex:VEA_000391 2-deoxyglucose-6-phosphate hydrolase YniC;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   Possible phosphoglycolate phosphatase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM: haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 3 with
FT                   third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16157"
FT                   /db_xref="GOA:E4RW14"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW14"
FT                   /protein_id="ADQ16157.1"
FT                   /translation="MPIAAVIFDMDGVLVDSEKYWSEAEEVVFGELGVDVKPEYRKITQ
FT                   ILTAPEVIHFWYEKSPWTGVSFDEVEQRVIRYVQSCIVRDDCETPGAAAFIRKLKTEGY
FT                   LLGLGTNSPLPLAKIVLQKLEVEDCFSAVVTADQVSKGKPDPEIYQLVADRLQINPSEC
FT                   LVIEDSFYGMEAAKAAGMQVAAYLPQQSPSSVQVDYFLRSFDPPQFFVSSVPEKIFQLT
FT                   AL"
FT   gene            complement(407274..407900)
FT                   /locus_tag="Lbys_0380"
FT   CDS_pept        complement(407274..407900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0380"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="COGs: COG0819 Putative transcription activator;
FT                   InterPro IPR004305; KEGG: cat:CA2559_10853 putative
FT                   transcriptional activator (TenA family); PFAM: TENA/THI-4
FT                   domain-containing protein; SPTR: Putative transcriptional
FT                   activator (TenA family); PFAM: TENA/THI-4/PQQC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16158"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW15"
FT                   /protein_id="ADQ16158.1"
FT                   /translation="MNWFEEADKSSAAILEKIYNHPFIQDLQSGTLDKDIFQYYMEQDA
FT                   VYLKGFAKVLQKIAENLPNEKDTFSYAKFSENAIAAEQSLHSNYITHKEIQAQPACHHY
FT                   LLFLQHHLSQLENALAAVLPCFVVYEKVGNYILKHTDLEGHPYASWIQLYGGEEFSLSV
FT                   QEAIRITNQYAHLNGSMKEIYLQGCELEYLFWDGAYKKLRWIKTS"
FT   gene            complement(407887..408714)
FT                   /locus_tag="Lbys_0381"
FT   CDS_pept        complement(407887..408714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0381"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="COGs: COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   InterPro IPR013749:IPR004399; KEGG: zpr:ZPR_1974
FT                   phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; PRIAM:
FT                   Phosphomethylpyrimidine kinase; SPTR:
FT                   Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16159"
FT                   /db_xref="GOA:E4RW16"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW16"
FT                   /protein_id="ADQ16159.1"
FT                   /translation="MKKYYSVLSIAGFDGSGGAGIQADIKTISALGAYATTVLTALPVQ
FT                   NTTGVKSIHPIPEEVVANQLDCISEDIPPMAIKIGMVHTPALARVIGDWLKNNPKVPVV
FT                   FDPVMVASSGDHLIEEETIESIKEHILPFATVLTPNMDEAAILAQKSVKTREEMHSAAS
FT                   YILNQYSFALLMKGGHLDTETLTSYLYLRPNQYVAYDFPKIETRNTHGSGCSLSSALAT
FT                   YLAFGETIENATKKAQDYVHQAILNGKDISTGKGHGPLNHLFNPQKMKIYELV"
FT   gene            complement(408711..409316)
FT                   /locus_tag="Lbys_0382"
FT   CDS_pept        complement(408711..409316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0382"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /note="COGs: COG0352 Thiamine monophosphate synthase;
FT                   InterPro IPR003733; KEGG: zpr:ZPR_1975 thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase;
FT                   SPTR: Thiamine-phosphate diphosphorylase; TIGRFAM:
FT                   thiamine-phosphate pyrophosphorylase; PFAM: Thiamine
FT                   monophosphate synthase/TENI; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16160"
FT                   /db_xref="GOA:E4RW17"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW17"
FT                   /protein_id="ADQ16160.1"
FT                   /translation="MQLYLVISQDACGSRDFLEVAKEAILGGVDIIQLREKKLQEEEFL
FT                   YRAQALHKITQLHKIPLVINDNLNVALEVGAEGVHVGLNDMPPVQVRKKWKGMMGWSIE
FT                   YLDQLTSPEIHAVDYIAASPVFSTPTKEDTVTEWGIEGIKKIKSLSKLPLVAIGGVNIK
FT                   NARKILEAGADSLAVVSAICQAKDPKGAAYQLKSFFNP"
FT   gene            complement(409298..410089)
FT                   /locus_tag="Lbys_0383"
FT   CDS_pept        complement(409298..410089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0383"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="COGs: COG2145 Hydroxyethylthiazole kinase sugar
FT                   kinase family; InterPro IPR011144:IPR000417; KEGG:
FT                   zpr:ZPR_1976 hydroxyethylthiazole kinase; PFAM:
FT                   hydroxyethylthiazole kinase; PRIAM: Hydroxyethylthiazole
FT                   kinase; SPTR: Hydroxyethylthiazole kinase; PFAM:
FT                   Hydroxyethylthiazole kinase family; TIGRFAM:
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16161"
FT                   /db_xref="GOA:E4RW18"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW18"
FT                   /protein_id="ADQ16161.1"
FT                   /translation="MKLWKHIEHLRNTAPLVHNITNFVVMNNSANALLAIGASPIMAHA
FT                   KEEVPEMVKISNALVINIGTLDPTFIEGMLLAAKTAHELGKPWILDPVGAGVSHLRNST
FT                   IQKLLEYHPTVIRGNASEVVAVSSATGIKSKGVDSSMNSSDAVESGKELHKNLGTIVCI
FT                   SGATDYLISKGQIFEIQNGDPMMTKVTGLGCSLSAVLGAVLGASGADPEAIASVVAYFG
FT                   ISGELAKGLGPGSLQVQLLDHLYSIDQSTFENRLKICSYTW"
FT   sig_peptide     complement(409955..410089)
FT                   /locus_tag="Lbys_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(410318..420679)
FT                   /locus_tag="Lbys_0384"
FT   CDS_pept        complement(410318..420679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0384"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000601; KEGG: chu:CHU_2225 gliding
FT                   motility-related protein; adhesin AidA-related; SPTR: CHU
FT                   large protein; gliding motility-related protein; possible
FT                   adhesin AidA-related"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR025667"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW19"
FT                   /protein_id="ADQ16162.1"
FT                   /translation="MKKNLLLLLFNLFTVILVKAQSVETFETESIGSTTFTDNGKTFNI
FT                   TSLSSSIFRINSETGAGWNGYNSDNQFIDNYGTYTPNETISFKISSADGSTFGLRGIYL
FT                   YLSTVDYDLNVLGSLNIEGYRNGNRKYSNSREGSFARNPITNNGYIYFDFSNISGYNLS
FT                   DIFIDEFIITTSGSIEYIALDAMNWVKCSNISVSAQSLTNVACHGATTGSISVLAAGGK
FT                   APYSYSWSPSGGTASTASNLAAGTYTVTVTDDNGCYGSQSFSITQPNTLNVTPSQTNVS
FT                   CNGATNGTATVNVTGGSGPYTYSWAPTGGTAATATGLSAGTYTVTITDANGCEKTQSFI
FT                   ITQPNTLNVTASQTNVSCNGATNGTATVNVTGGSAPYTYSWAPSGGTASSATGLAVGTY
FT                   TVTITDANGCEKTQSFIITQPNTLNVTASQTNVSCNGATNGTATVNVTGGSGPYTYSWS
FT                   PAGGTAATATGLAVGTYTVTITDANGCEKTQSFIITQPNTLNVTASQTNVYCSGAANGT
FT                   ATVNVTGGSAPYTYSWAPTGGTAATATGLSAGTYTVTITDAIGCETTKSFTITQPNTLN
FT                   VTASQTNVSCNGATNGTATVNVTGGSGPYTYSWAPTGGTAATANGLSAGTYTVTITDAN
FT                   GCEKTQSFIITQPNTLNVTASQTNVSCNGGANGTATVNVTGGSAPYTYSWAPTGGTAAT
FT                   ATGLAVGTYTVTITDANACQATRSFTINQPSVLNATISKTDVSCNGESDGTATANVTGG
FT                   TAPYTYYWYPYGGTTATATGLAAGSYTLFISDANGCQVTKNVVIMQPSALNVTASQTNV
FT                   SCFGETNGTATVIVTGGSAPYTYSWAPTGGTAATANGLSAGTYTVTITDANGCEKTQSF
FT                   IITQPNTLNVTPSQTDVSCNGGANGTATVNVTGGSAPYTYSWAPTGGTAATATGLSAGT
FT                   YTVTITDAIGCETTKSFTITQPPLLQVNTNFQNNITCYGESNGSAMVNATGGTGSYSYS
FT                   WSPTGATSASVVGLSAGSHYVTVTDDNGCQATRILTFTQPPALVANPVMMGNVSCNGGS
FT                   NGFAIVNATGGSGSYSYAWTPSGATTATATGLSATAHKVTVTDINGCKATHTFLITQPA
FT                   TQLTATAAGQVNVTEYGAANGQAMVSATGGVLPYTYNWAPTGGNAATASGLAAGTYTVT
FT                   VTDAYGCEVTQSFTITQPAAPLQASVSAQTNVSCNGGSNGSATVTASGGTAPYTYSWSP
FT                   TGGTGATANGLSAGMYIVTITDANQVSRTVNVFIYQPTTLVANSGSITHVYAYGAATGS
FT                   ATVVASGGIPPYTYSWTGSSSTTATASNLAAGTYAVTVTDANGCTTSQSFTITQPSSAL
FT                   EASISAQTNVSCNGATNGSATVTATGGTAPYTYSWSPTGGTNATASGLSAGTYTVTVTD
FT                   ANGISTSAQVTITQPTALVASQGAITHVYAFGASTGSATVMVNGGTAPYTYSWSGSAST
FT                   TATASNLAAGTYAVTVTDANGCTATQSFTITQPSSALEASISAQTNVSCNGATNGSATI
FT                   LASGGTAPYTYSWSPTGGTSATASGLAAGTYTVTVTDANGIFTTTSATITQPTALVASS
FT                   GTITHVYAFGASTGSATVMVNGGTAPYTYSWSGSNSTTATASNLAAGTYTVTVTDANGC
FT                   TTSQSFTITQPASALEASISAQTNVSCNGGTNGSATVTATGGTAPYTYSWSPTGGTSAT
FT                   ASGLSAGTYTVTVTDANGISTSAQVTITQPTALVASSGTITHVYAFGASTGSATVMVNG
FT                   GTAPYTYTWSGTNSTTATASNLAAGTYTVTVTDANGCTTSQSFTITQPSSALEAFISAQ
FT                   TNVSCNGGTNGSATVTATGGTAPYTYSWSPTGGTSATASGLAAGTYTVTVTDANGISTT
FT                   TSATITQPTALVASSGTITHVYAFGASTGSATVMVNGGTAPYTYSWSGSNSTTATASNL
FT                   AAGTYTVTVTDANGCTTSQSFTITQPSSALQASISAQTNVSCNGATNGSATILASGGTA
FT                   PYTYSWSPTGGTSATASGLAAGTYTVTITDANGIFTTTSIVINQPSALIASQGAIQHVI
FT                   QKYYSTGSATVEVSGGTAPYTYSWSGNSYVTVPTANFLPAGNHTATVTDANGCTASHTF
FT                   TITEPDEELRATVTSKTDITCSGDNNGSITIQASGGTAPYTYSWYPNVSSNNTATGLSG
FT                   GQYTITVTDANGVTTNTYADIIEPGEIFPLHETITHVTEYGQATGAINSWIVGGTFPYT
FT                   STWPLTNYSDLIANNLPAGNYNVTITDANGCVFDYSFTINQPSAPFVASIAAQNNVTCN
FT                   AGSNGSATITATGGTAPYTYSWSHDNSTNASATGLAAGTYTVTVTDANQVTRTVSVTIT
FT                   QPAPLVASSGTITHVYAYGASTGSATVIVNGGTAPYTYSWSGSNSTTATASNLAAGTYT
FT                   VTVTDANGCTTSQSFTITQPSSALQASISAQTNVSCNGATNGSATILASGGTAPYTYSW
FT                   SPTGGTSATASGLAAGTYTVTVTDANGIFTTASVSITQPQTLTLSSSVTPALTCGGNSG
FT                   TAAVVATGGTAPYTYLWSNNATASSVSGLLSGTYSVLVTDAGGCSSSTSVVITEPTPIA
FT                   ASITVNGPTQLCENETTVLTATPAAAYLWSNGATTQSITVNTADTYTVTLTSAQGCTST
FT                   ADQTITQIICNVPPVAVCKEVVVLVAKDNCYATLRPEDIDAGSYDANGDWFNRSFDIQP
FT                   DLKVGTYYVNFTVQDIYGTSGSCATRVEVVDHTAPVVRTKNISVELNAYGRASISPADI
FT                   DNGSYDACSSLNFSLSRSEFDCSHLGDNQVILIVTDASGNKATEVATVTIVDRIKPEFT
FT                   QKSITLSLDAQGMAELTESMIKGISRDNCAVWEVQFDRNSFTCQDLGSNKVNVTLVDVY
FT                   SNKHSEQIEVIIRDTLAPVIAGKEVTVYLDQKGQAKLSDIRLLDNCSTVTLSADKTTFT
FT                   CEDLGTQTLWVKATDANGNSTNDTLRVIVRDTMAPTLVSKTATVYLDANGKALLTPEMI
FT                   DGGSTDNCGIKTRLLSKTEFHCGEIGTHVINYTLVDASGNETTEVVHITVIDNVAPTVK
FT                   TRTVTLELSSSGTGNLTAEMVNDGSFDACGIASMQVSQSTFTCEQLGTRTVLLTVTDVN
FT                   GNVATATAEVWVTDPDAICPCTFGIIAENNITMKDNAVLSGGVGSISGKVILRNTLLYE
FT                   EGTFAKAKESDFDEASRNSSFIKGSAPQPQKFVANPDKKKGRKTIKGSETLAPGKYGKL
FT                   ILKKDADLKLSGDIYVRKVKMNKNATIDFTQEGRLIVRNRASLGKNSKFNPTGLNAKLY
FT                   AGRGISVKQDALVKAYVHTASVLKTKASKMEGFFAAHTVKAGSNTTWSGGGLLCKDENP
FT                   AQTLVKKEDAKAREEVQISVEPQIHLQISPNPASNYVQVKVENPNGKGTLRLLDMNGKV
FT                   RAEVKVNAFIFTHTFELKNLLPGTYIIRYQDENLSRTLRLVKEDF"
FT   sig_peptide     complement(420620..420679)
FT                   /locus_tag="Lbys_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(421116..421652)
FT                   /locus_tag="Lbys_0385"
FT   CDS_pept        complement(421116..421652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fps:FP0281 M36 fungalysin family
FT                   metalloprotease precursor; SPTR: Probable M36 fungalysin
FT                   family metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16163"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW20"
FT                   /protein_id="ADQ16163.1"
FT                   /translation="MKAYVHRASVLKTKASKKEGFFAAHTVYTIWSGGGLLCKDENPTQ
FT                   TLVKKEDAKAREEVQMSVKPQIHLQISPNPASNYVQVKVENLKSKGTLRLLDMNGKVQA
FT                   EVKVNAIHFKYTFDLTKLVPGTYIIRYQEGSVNRTIRIFLTKWNKGVMQPASWFLNTNN
FT                   YLKNTLLTCSLLKLF"
FT   sig_peptide     complement(421584..421652)
FT                   /locus_tag="Lbys_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(422365..422604)
FT                   /locus_tag="Lbys_0386"
FT   CDS_pept        complement(422365..422604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4090 protein of unknown function
FT                   DUF303 acetylesterase putative; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16164"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW21"
FT                   /protein_id="ADQ16164.1"
FT                   /translation="MITAPTPIATTINGPTQLWKNEATVLAATPAVAYLWNHGANTQSI
FT                   TIIAATTYIYIDLCKRLYINGESDTIYNFPPVKQ"
FT   sig_peptide     complement(422506..422604)
FT                   /locus_tag="Lbys_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(422782..423222)
FT                   /locus_tag="Lbys_0387"
FT   CDS_pept        complement(422782..423222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0387"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="InterPro IPR002059:IPR011129; KEGG: cpi:Cpin_5168
FT                   cold-shock DNA-binding domain protein; PFAM: Cold-shock
FT                   protein DNA-binding; SMART: Cold shock protein; SPTR:
FT                   Cold-shock DNA-binding protein family protein; PFAM:
FT                   'Cold-shock' DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16165"
FT                   /db_xref="GOA:E4RW22"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW22"
FT                   /protein_id="ADQ16165.1"
FT                   /translation="MAETYSKKENRDKKAKKRANKAEKMEDRKFNNKKGKSLEDMMAYV
FT                   DENGNITNTPPNPGKPKKEIALEDILLGAAPIEGEDPRKKGVVAYFSDKGYGFITEERT
FT                   KERIFVHTNDLKVELREGDKVTFETERSDRGLKAINVEKVGA"
FT   gene            complement(423222..424343)
FT                   /locus_tag="Lbys_0388"
FT   CDS_pept        complement(423222..424343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0388"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterProIPR014021:IPR001650:IPR014014:IPR000629:IPR
FT                   011545:IPR014001; KEGG: bvu:BVU_0398 ATP-dependent RNA
FT                   helicase DeaD; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; SPTR: ATP-dependent RNA helicase
FT                   DeaD; PFAM: Helicase conserved C-terminal domain; DEAD/DEAH
FT                   box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16166"
FT                   /db_xref="GOA:E4RW23"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW23"
FT                   /protein_id="ADQ16166.1"
FT                   /translation="MNFENLNLSAPLAQALQEYGYTSLTPIQEQAIPKVLQGQDLLGCA
FT                   QTGTGKTAAFAIPILERILQNPKNKRQIRVLILTPTRELAIQIGDNFKAYSKHIKISHA
FT                   VIFGGVNQNKQVNQLKQGVEILIATPGRLLDLMSQGFVRLNGLDTLVLDEADRMLDMGF
FT                   VHDVKKILTKIPTERQTLFFSATMPQSIRKFAASILTNPAYVEVTPVSSTAETVKQGVY
FT                   FVDKKEKTPLLINILKDQSTDRTLIFTRTKHGADKLVKQLGKVGIPAAAIHGNKSQNAR
FT                   QRALEDFKSSRLNVLIATDIAARGIDIEELPYVINYELPNVPETYVHRIGRTGRAGAEG
FT                   VAVSFCDQEELNDFKNIQKLTGIRIEVLSPITA"
FT   gene            424486..425556
FT                   /locus_tag="Lbys_0389"
FT   CDS_pept        424486..425556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0389"
FT                   /product="lipase class 3"
FT                   /note="InterPro IPR002921; KEGG: sli:Slin_0221 protein of
FT                   unknown function DUF306 MetA and HslJ; PFAM: lipase class
FT                   3; SPTR: Putative uncharacterized protein; PFAM: Lipase
FT                   (class 3)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16167"
FT                   /db_xref="GOA:E4RW24"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW24"
FT                   /protein_id="ADQ16167.1"
FT                   /translation="MRFIALLLIATSSFAQNLTPGFNSQEYRELMHIFAETSLDSSGKY
FT                   PPYPGWTRLIRSQEVGLDNLWELWSHTSGKHLICVRGTTMKGESWLENFYAAMVPAQGT
FT                   LKLNSSTEFNYDLAQNERAAVHVGWLLGMSYMALDLDPKIDSLMQAGVKDLLVMGHSQG
FT                   GAISYLLTSYLKRKQAKGLLPTDLVIKTYCSAAPKPGNLFYAYEYESSTAGGWSFNVVN
FT                   PADWVPETPISIQTLNDFTPVNPFIHAKSAIKKMKFPQNLVLKRVYKKLDKPTRKAQKN
FT                   YERYLGKMASNLIRKSQPEYLPPAYFTSNHYVRTGQMIVLYPDEKYYELYPADPNKPFG
FT                   HHGLGQYLYLLDQLAK"
FT   sig_peptide     424486..424560
FT                   /locus_tag="Lbys_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            425589..425969
FT                   /locus_tag="Lbys_0390"
FT   CDS_pept        425589..425969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_3340 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16168"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW25"
FT                   /protein_id="ADQ16168.1"
FT                   /translation="MKKLVGAAIVVLGLIFYNFFKLPNRADLPGKFEEKAFVRNENNLG
FT                   TVLLYYAFTVGDTLNADYQALGKTLPFNKTNGITTAFFFHGEAPDNLSLEPPHFDTTRY
FT                   EVLKTLTIDKVGNRVLTDGLSL"
FT   sig_peptide     425589..425666
FT                   /locus_tag="Lbys_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(425947..427020)
FT                   /locus_tag="Lbys_0391"
FT   CDS_pept        complement(425947..427020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_3301 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16169"
FT                   /db_xref="GOA:E4RW26"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW26"
FT                   /protein_id="ADQ16169.1"
FT                   /translation="MKELDELFKKTLGEAHYAFREEDWELLEPRLPKKRNKLILLPWAA
FT                   AIILIGAFLWLRIPHQTTSKKEEFVTNKTEEKEGNQAPTIGPKELDLNKVISKSAAKID
FT                   RKPERKIIERSVTWEGPKDISVPATQLALKPLEPKSFPFPVYIHPNFPELLNFTESTFI
FT                   EVNDLPKKRTNWGHLGLIAGPDLTSVRGAGQNSLSANVGLAYTYPLTKRWSVSAGAFYS
FT                   RKNYKSPYSFYSTSSKGYYDPTDVKAICEVLSVPVGINYTLWNKKDQSFQLNAGASSYF
FT                   MLKEKYTMQYEHSPDKEYVIKGENQHYFGVIDLAVTYSKKNWGIRPFYQIPITGIGYGN
FT                   IPLQSGGVALIIGLTHQ"
FT   gene            complement(427004..427549)
FT                   /locus_tag="Lbys_0392"
FT   CDS_pept        complement(427004..427549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0392"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627:IPR013249:IPR014284; KEGG: dfe:Dfer_4134 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16170"
FT                   /db_xref="GOA:E4RW27"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW27"
FT                   /protein_id="ADQ16170.1"
FT                   /translation="MEIDLQQILEGCKKNDRRSQKELYKLFYSAAMGVCLRFTQNRDDA
FT                   VMVMNDGFYKVFTKLDSYDPKYPFVAWLKRIMTNTAIDFYRSSLRFQTVELSSVEQEEV
FT                   HWNLENLQYEDLMKMIESLSPAYRTVFLLHVVEGYSHEEIAEMLQISVGTSKSNLSKAR
FT                   SKLVEKTSPKLDDYEGIR"
FT   gene            427573..427701
FT                   /locus_tag="Lbys_0393"
FT   CDS_pept        427573..427701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16171"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW28"
FT                   /protein_id="ADQ16171.1"
FT                   /translation="MYVYTMRYEIKLQKVALEIFIFFKQPYHGSFSYLLLKEYSRK"
FT   gene            428086..428451
FT                   /locus_tag="Lbys_0394"
FT   CDS_pept        428086..428451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rbi:RB2501_00261 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16172"
FT                   /db_xref="GOA:E4RW29"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW29"
FT                   /protein_id="ADQ16172.1"
FT                   /translation="MKRKLLIVGIAVMVLACSSDKAEEVPPVTNPPSGGNNVTAENVSY
FT                   KNFAGTFFANKCNACHANGGAGSSHWVFSGYASVQNNAEKIRNAVLVNRIMPQGGSLTE
FT                   QERTLLDAWFKRNLPEE"
FT   sig_peptide     428086..428205
FT                   /locus_tag="Lbys_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428448..428987
FT                   /locus_tag="Lbys_0395"
FT   CDS_pept        428448..428987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0395"
FT                   /product="YceI family protein"
FT                   /note="InterPro IPR007372; KEGG: cpi:Cpin_0225 YceI family
FT                   protein; PFAM: YceI family protein; SPTR: YceI family
FT                   protein; PFAM: YceI-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16173"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW30"
FT                   /protein_id="ADQ16173.1"
FT                   /translation="MMKCGLMLGVLWVVCLPLWGQTLTCKSAEVSFFSSAPMEDIEAKS
FT                   LTAVAALNASTGDVVFKVKNTSFQFAKKLMREHFNENYMESEKFPISEFRGKLADASIL
FT                   QKPGKYTVPVTGSLQVHGVTKVYEVKVDLTVEEGAIQSHASFPVKVADHNIKIPALLGK
FT                   NIAETVKITIKARFTP"
FT   sig_peptide     428448..428531
FT                   /locus_tag="Lbys_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428984..429886
FT                   /locus_tag="Lbys_0396"
FT   CDS_pept        428984..429886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_0224 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16174"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW31"
FT                   /protein_id="ADQ16174.1"
FT                   /translation="MRYFFFFIVICLGAQAQEIGFDEDRKEKVSATFKSGYLINLKTTE
FT                   TIHKKELDFRVDHRFGDIAGKAGGAKTFFGLDQSTDIRIGFDYGLTDNLTIGIARAKGA
FT                   GTAIQLLEASVKYKFLEQGLNQGSPISAAFFGSAVSSGMDPSDDPYSPVAFQKGIHRLQ
FT                   YVSQLILARKFSSSFSLEVLPTYVHRNFTAFGDQNGFFSLGVGGRLKMTKRMALVADYQ
FT                   LPFRDTEYLEKVWGNKYYNALGLGLELETGGHVFHLNFTNATAIQESQIITETTRSWGK
FT                   GEFRWGFSIARRFSFDKSK"
FT   sig_peptide     428984..429031
FT                   /locus_tag="Lbys_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            429918..430739
FT                   /locus_tag="Lbys_0397"
FT   CDS_pept        429918..430739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0397"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR003006; KEGG: dfe:Dfer_2881 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16175"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW32"
FT                   /protein_id="ADQ16175.1"
FT                   /translation="MGAFFFILLSEMTYPINWRIVSKRHEQVFGNTYIYCEMKETDFFR
FT                   CIAVHASESELSYVEKAVSPVRLFVAAHRGISRKLISMEEILGFPCQWTLDRLVRVYAL
FT                   TQMSEMEMESLWDTAEINESVALYSSLMYLKSPEKWVYRGTEAVRSNIGDVFDAIAFEN
FT                   LYPSKHFSEAQWNQLVLKCIFNDKGIHRILGLNERKNMLLASSISDFAHERWAAGRQVP
FT                   AQVWRLVDGFEYEGKMEDLRELKKSGRVEDQIALAILENDEKYTWSDLEKE"
FT   sig_peptide     429918..429962
FT                   /locus_tag="Lbys_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            430744..431742
FT                   /locus_tag="Lbys_0398"
FT   CDS_pept        430744..431742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0398"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="COGs: COG1099 metal-dependent hydrolase with the
FT                   TIM-barrel fold; InterPro IPR001130; KEGG: dfe:Dfer_2882
FT                   TatD-related deoxyribonuclease; PFAM: TatD-related
FT                   deoxyribonuclease; SPTR: TatD-related deoxyribonuclease;
FT                   PFAM: TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16176"
FT                   /db_xref="GOA:E4RW33"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012022"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW33"
FT                   /protein_id="ADQ16176.1"
FT                   /translation="MCQKEGNFPSHFEGTEEERMIAGKLDADFRDYIKDMRFFDPHIHM
FT                   TSRTTDDYQALAEAGVRAIIEPAFWLGQPRTGVSTFKDYYNSLIGWERFRSSQFGIKHY
FT                   CTIGLNSREANNEALAEQVMEILPLYIYKEGVVGVGEIGFDDQTEAEERYYRLQLELAK
FT                   EAALPVQVHTPHRDKKKGTERSMAIALEHGLDPGMVIIDHNNEETVKSVLDQGFWAAFT
FT                   IYPFTKMGNERMVEIVKKYGSERIMVNSAADWGISDPLAVPKTAALMKIKGIQEDDIIK
FT                   VTYQNAIDAFAQSGQILVSEFEDGMKIDQSLKFNGNTILRGGQSPDNILIR"
FT   gene            431742..432602
FT                   /locus_tag="Lbys_0399"
FT   CDS_pept        431742..432602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0399"
FT                   /product="UbiA prenyltransferase"
FT                   /note="InterPro IPR000537; KEGG: phe:Phep_0429 UbiA
FT                   prenyltransferase; PFAM: UbiA prenyltransferase; SPTR: UbiA
FT                   prenyltransferase; PFAM: UbiA prenyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16177"
FT                   /db_xref="GOA:E4RW34"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW34"
FT                   /protein_id="ADQ16177.1"
FT                   /translation="MVRTYLQLIRPANVVTAFSDVLAGAAIVGALMEPSMLWLCLSTAC
FT                   LYAGGIVFNDFFDAELDAIERPERAIPSGKVSLKAAFVLGSLLFIIGVISAYQVSLLSG
FT                   HLAVCIVILCLLYDKFSKHNGLIGPLNMGLCRGFNFILGMSVWPEGLSEYYYLAIFPVV
FT                   YIAAITMVSRGEVHGSSRGVLILASILYLIVGASQLSFAFIQDTWFMAFPLVSIHSYLI
FT                   FKPLVLAYQDPIGPNIGKAVKAGVLSLIVMNAAWIGASGQIYMAILVLLLLPLSLFLSK
FT                   YFAVT"
FT   gene            432602..433708
FT                   /locus_tag="Lbys_0400"
FT   CDS_pept        432602..433708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0400"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="COGs: COG0337 3-dehydroquinate synthetase; InterPro
FT                   IPR016303:IPR002658; KEGG: dfe:Dfer_2884 3-dehydroquinate
FT                   synthase; PFAM: 3-dehydroquinate synthase; PRIAM:
FT                   3-dehydroquinate synthase; SPTR: 3-dehydroquinate synthase;
FT                   PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16178"
FT                   /db_xref="GOA:E4RW35"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW35"
FT                   /protein_id="ADQ16178.1"
FT                   /translation="MKVINQSFQVSYEYPVVFTRNLFGTSTLREFLENYGEKAYRKKVL
FT                   FVVDEGVFNAHPHISFKEYWPGAGLLVVPGGERVKNHSDSLEKVLAAINEYGIDRHSFV
FT                   LAVGGGAVLDMVGYAAAIAHRGVKLVRIPTTVLSQNDSAVGVKNSINYFGKKNFLGTFV
FT                   PPVAVFNDFDFLRTLSPRDQISGIAEAVKVALIKDLDFFEWLEKNAKNLREGVESIMEE
FT                   QIIRSAEHHLAHIRSGDPFELGSARPLDFGHWAAHKLEYLTGFEVRHGEAVAIGIALDV
FT                   CYSQLMGFIKEEDRDRVLQVLQSIGFSLYHPVLDNKNHLWEGLNEFREHLGGMLTITLL
FT                   EKLGKGIEVHEVDFNKVILALDHLATIK"
FT   gene            433708..434859
FT                   /locus_tag="Lbys_0401"
FT   CDS_pept        433708..434859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_2885 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16179"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW36"
FT                   /protein_id="ADQ16179.1"
FT                   /translation="MKHIGYCTNIHPGVSWEEHFSILRSSIPVIKKAVSPDMPFGLGLR
FT                   LSHAASLTLDIDAFSAWLKAEGCYVFTMNGFPYGEFHGAVVKDQVHAPDWTTKERRDYT
FT                   IRLFEILAKLLPDFLDKGGVSTSPLSYRYWWKDEVALKQAVELSTQHILDVVEALVKIK
FT                   EETGKSLHLDIEPEPDGVLENSEEFIDWYMNTLIPSACKRWAGGEALVKEHVQLCFDIC
FT                   HFAVEFEEPEAAVRRLGELGIKTGKIQVSSALKVDLKTRAEEKLAVLKRFDEPVYLHQV
FT                   VAKRLDGSFESFRDLGEAFEAYENYKFEEWRIHYHVPLFADEYSELQSTQGEIIKTFQV
FT                   LKDTNFTDQLEIETYTWGVLPPALQVPLNDSIIREIAWVKRQL"
FT   sig_peptide     433708..433806
FT                   /locus_tag="Lbys_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            434838..436208
FT                   /locus_tag="Lbys_0402"
FT   CDS_pept        434838..436208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0402"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="COGs: COG1524 Uncharacterized protein of the AP
FT                   superfamily; InterPro IPR002591; KEGG: dfe:Dfer_2886 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; PFAM: type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; SPTR: Type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; PFAM: Type I
FT                   phosphodiesterase / nucleotide pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16180"
FT                   /db_xref="GOA:E4RW37"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW37"
FT                   /protein_id="ADQ16180.1"
FT                   /translation="MGKKTVVIDIVGLSKSVIGEHTPFIKTFMEKNCHATVEPVFPAVT
FT                   TTAQSVYLTGKLPREHGIVGNGWFDRKENEVKFWKQSNGLVEAEKIWERAKLIDPDFTC
FT                   SVMFWWYNMYLSADYSVTPRPQYHSDGLKLPDCYSFPPELRDELQDRIGTFPLFHFWGP
FT                   NADIRSSRWIADASLYVDQKFDPTLTLIYLPHLDYGLQKFGPDLAKISKELREVDQLVE
FT                   ELVNYYQKKGAHIVLLSEYGINPVSRPIHINRILRTEGYIKVRLESGRELLDAGASDAF
FT                   SVSDHQVAHIYIKDQRKKEELRGLFEKIDGVAQVLDSKEKEEMGLDHERAGDLVLMADT
FT                   DAWFTYYYWLEDGKAPDFARSVEIHKKPGYDPAEMFLDPHQPLVKLKAAYKLIRKKLGF
FT                   RYRMDVIGLDATVVKGSHGAIHAGEQFDPVFISDFPIAERRLKCTQVYDKIWATLAL"
FT   gene            complement(436455..436859)
FT                   /locus_tag="Lbys_0403"
FT   CDS_pept        complement(436455..436859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0403"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="InterPro IPR009959; KEGG: pgi:PG1451 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1486; SPTR:
FT                   Putative uncharacterized protein; PFAM: SnoaL-like
FT                   polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16181"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW38"
FT                   /protein_id="ADQ16181.1"
FT                   /translation="MEHNLALVSAYFEAVAQGNFPKVAELLSQDVIWHQPGQGVQSGTY
FT                   QGQEKVFQHLGNLMKWSEGSFSIDQIDYLTANDNLVTASIHFKAEKKDKTLSMKGIDLL
FT                   KVENGKITEVWLFSEHIEQEDQFWNLASEN"
FT   gene            436975..437307
FT                   /locus_tag="Lbys_0404"
FT   CDS_pept        436975..437307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0404"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: pgi:PG1450 hypothetical protein;
FT                   PFAM: helix-turn-helix HxlR type; SPTR: Transcriptional
FT                   regulator family protein; PFAM: HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16182"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW39"
FT                   /protein_id="ADQ16182.1"
FT                   /translation="MKINISDENCPLRRTLELISGKWTLLIIYQINERVVRYGELKRNI
FT                   VGISEKILISQLKFLVEKGLVQRTVYPEIPPKVEYTLTEVGKELLPIVYSIIDFGLEHV
FT                   LGGKKD"
FT   gene            complement(437490..437873)
FT                   /locus_tag="Lbys_0405"
FT   CDS_pept        complement(437490..437873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_3p00340 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16183"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW40"
FT                   /protein_id="ADQ16183.1"
FT                   /translation="MSARTVVDEMFSAFEAKDLERIVNTFSEDATLIYHGTQKMPAAKF
FT                   KGTDGARGFFSFNLNAFEIIYFQRDEYIETENKIVVLGKEHFKKDGADLKNTWVQIYTV
FT                   KDQKITRMEEFATSAAPEEYGGM"
FT   gene            437991..438338
FT                   /locus_tag="Lbys_0406"
FT   CDS_pept        437991..438338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0406"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: dfe:Dfer_1562 transcriptional
FT                   regulator, HxlR family; PFAM: helix-turn-helix HxlR type;
FT                   SPTR: Transcriptional regulator, HxlR family; manually
FT                   curated; PFAM: HxlR-like helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16184"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW41"
FT                   /protein_id="ADQ16184.1"
FT                   /translation="MEFCHFRKSSVKDGMDLLSGKWKIHIIGTLLYGGKMRFMDLQREV
FT                   KGIGAKMLSKELQDLEANQLLIRTVVSSKPITVEYELSEFGRSLEPVIDAIAEWGMKYR
FT                   SVMMDREIPHP"
FT   gene            438864..439634
FT                   /locus_tag="Lbys_0407"
FT   CDS_pept        438864..439634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_00650 conserved hypothetical protein;
FT                   SPTR: Putative histone-lysine N-methyltransferase PFF1440w"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16185"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW42"
FT                   /protein_id="ADQ16185.1"
FT                   /translation="MPIQHKFYQTNFGNGFETHNAIFDITPYKPEVMIVGTFNPDTPNA
FT                   NFADFFYGRNFFWTAFKNLFIHNAVVILNRRMPPNGIPPAILNPTLQEIFQLCLRLKLT
FT                   FSDLVLEVLHNNNPNYQLLPNDNVIFNGVEYNLIQDGQNGNVGGLQQLNALGQVIWNTQ
FT                   NIINYLCDNPQIKAIYFTRRPTGIWAAQWNLIVNHHCMAGRFLTNIFSPSGQGLAGNPR
FT                   MNALLHHWVHNNNPNFGQLDNNWLLNNGVNLNNF"
FT   gene            439609..439779
FT                   /locus_tag="Lbys_0408"
FT   CDS_pept        439609..439779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0408"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="KEGG: eat:EAT1b_0629 DNA internalization-related
FT                   competence protein ComEC/Rec2; SPTR: DNA
FT                   internalization-related competence protein ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16186"
FT                   /db_xref="GOA:E4RW43"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW43"
FT                   /protein_id="ADQ16186.1"
FT                   /translation="MVLTLTIFKMTIRTPVHNIVLAIVGLTVVNSTFVFLLGISANVGM
FT                   TFFKCPTIANM"
FT   sig_peptide     439609..439731
FT                   /locus_tag="Lbys_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            439964..440173
FT                   /locus_tag="Lbys_0409"
FT   CDS_pept        439964..440173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0409"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: pdi:BDI_2133 hypothetical
FT                   protein; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16187"
FT                   /db_xref="GOA:E4RW44"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW44"
FT                   /protein_id="ADQ16187.1"
FT                   /translation="MSRKAINRIKVVLVEKNLSSKWLAEQLGKNEATISRWCTNDVQPT
FT                   LNTLASIAELLGVQITDLINNEQK"
FT   gene            440178..442496
FT                   /locus_tag="Lbys_0410"
FT   CDS_pept        440178..442496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0410"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG2205 Osmosensitive K+ channel histidine
FT                   kinase; InterPro IPR005467:IPR003594:IPR004358; KEGG:
FT                   wsu:WS1927 signal transduction histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16188"
FT                   /db_xref="GOA:E4RW45"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW45"
FT                   /protein_id="ADQ16188.1"
FT                   /translation="MDNATQILELKKKLSEEIQKESSDNNVILALSSEIAKLDDSQVRF
FT                   SVDAGIINRLGKELVGKHETAVSELVKNAFDADATEVNLVFENAWNAGGTVTIEDNGTG
FT                   MTKDQLINGFMRLSSSDKIHNPVSDKYKRTRAGRKGIGRFATQRLGSRLTIITHTAKSE
FT                   SSIKISINWNDFETDKDLLSVSNNIEVIPKSKVEGTTLIIENLRDGWSDAMIRRVFRYT
FT                   SELLQPFPLSKKNKDEAESSIDPGFKSYYFRQEGQELIPIIDEEEAIFKHALAEIEGYV
FT                   LDDGQGCWALKSDKLNFPQEVFLIGNDDKNRENTDAKFNLIKGLHFKTHYFIYEPSLFA
FT                   PGTYTFIRDLSYETGGIRLYRNGFRVLPYGEQGDDWLGLDKSNNRQIILARHMNRSFFG
FT                   FVELQDKEGLFEETSSREGLIENDALKELVDFVYRSIISAVIKVAELRDRKATASQKNF
FT                   KRKEVDPTEKADNAVKELEEFFTEEETKENSSEKSGTGKSKEKAKQVFEEFKQAREEEK
FT                   RKNQALIDENNMLRILAGLGLVIGEFIHEVHRFLPGFDAEISFLKNAVKDIKGVYERVE
FT                   LLGTNIKSFTSYTSYFDKAISRNVIRELQPIELRDVVKDFSIVIDNNLKRANIKLEKPI
FT                   FDGYDLFTTPMHPSEWASILFNLYTNSKKAIVRKKVDGKILIHCGKDEKNVFLEFSDNG
FT                   DGIPKENEDVIFNAFFTTTSAANHSGNDAESLVGTGLGLKIVKDIVEFYGGDVYVTNSP
FT                   ESYSTTIRIEIPKNQKEDE"
FT   gene            442477..443608
FT                   /pseudo
FT                   /locus_tag="Lbys_0411"
FT   gene            443614..444315
FT                   /locus_tag="Lbys_0412"
FT   CDS_pept        443614..444315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS1929 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16189"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW46"
FT                   /protein_id="ADQ16189.1"
FT                   /translation="MKNEAFISKRKKDVTDFLSILSNLSISYGSVDFKNHLPNGFWGYT
FT                   ISNIKFKVDQSTLKHISPTGFTNVEVIIELDVESKISEWDKLNDPFCSLNFRSLIRGTN
FT                   SKTGKVHYLGFHIDRHNGGKTNEIHPLYHLQYVQNSKIKPKEEFDHGETLQLDVPRMMH
FT                   LPMELILGVSTILSNFSPSTYSKLIENRQFVNLCKDYQEKIWRPYFNSLENFWIKNPME
FT                   WDPKLNCPYLV"
FT   gene            444312..446150
FT                   /locus_tag="Lbys_0413"
FT   CDS_pept        444312..446150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0413"
FT                   /product="N-6 DNA methylase"
FT                   /note="InterPro IPR002052:IPR003356:IPR002296; KEGG:
FT                   wsu:WS1930 hypothetical protein; PFAM: N-6 DNA methylase;
FT                   SPTR: N-6 DNA methylase family protein; PFAM: Eco57I
FT                   restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16190"
FT                   /db_xref="GOA:E4RW47"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW47"
FT                   /protein_id="ADQ16190.1"
FT                   /translation="MRNAFKYLSQYSTTPKDVDRLIISAFLEINKLELKKNKLLKSYSI
FT                   SSKSQDEHSSLLKFISAICTDTKAFGFEELIELFEFVISPADRIINGAIYTPQKIRTFI
FT                   VEEAFKKNNAIDNSIKISDIAMGCGGFLFNASIELKKRTGKTFSEIFRDHIFGLDIQEY
FT                   SVNRTKLLLSLLALQSGEDIEEFQFNLFQGDSLDFDWNTAIANFNGFSIILGNPPYVCA
FT                   RNLEKETKEKLKNWEVCQSGNSDLYIPFFQIAIENLAENGTLGFITMNSFFKSLNGRAL
FT                   RDYFQRNELAISIIDFGSEQVFKSKNTYTCICFIENKEQQFISYTESATKKLAGKLTFK
FT                   KIKYNILDSKKGWNLKDNKTISKIESTGIPFGELYQTRHGIATLKNDIYIFRPVDEDEN
FT                   FFYLQNGSLYKIEKGICKDIVNSNKLSREISLNRLKEKVIFPYDQQEKPKLLDEKLMKE
FT                   SFPEAYKYLQNKRKILAERDKGKGNYENWFAFGRTQSLEKIKNKMFFPKYSDRTPNFII
FT                   NSDDDLLFYNGLAVIGSSETEMKIIKKIMESNIFWYYIKTTSKPYSSDYYSLNGNYIKN
FT                   FGVCELTDKEKKFLIKETDQNILNEFFEDKYKLKVK"
FT   gene            446462..447043
FT                   /locus_tag="Lbys_0414"
FT   CDS_pept        446462..447043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0414"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595; KEGG: dfe:Dfer_2568 putative
FT                   transcriptional regulator, Crp/Fnr family; PFAM: cyclic
FT                   nucleotide-binding; SPTR: Putative transcriptional
FT                   regulator, Crp/Fnr family; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16191"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW48"
FT                   /protein_id="ADQ16191.1"
FT                   /translation="MDEFNIFKYWLTQVSFLTEKDCSLFEPFLKTKRLKTKDHFLSAGK
FT                   VCQQIGFVNKGCFRTYYIADGKEINTHFTFENEFVTDYDSFLQSKPSRYFIQTLEDTEI
FT                   VTFNLPALQDAYNQSQNWERFGRMIAEQSYKMTTQRVESFLFLDGEQRYLDLLKNQPHI
FT                   FDRIPLYHIASYLGLERESLSRLRKKIAGK"
FT   gene            447170..447763
FT                   /locus_tag="Lbys_0415"
FT   CDS_pept        447170..447763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avn:Avin_00100 glycyl-tRNA synthetase subunit
FT                   beta; SPTR: Phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16192"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW49"
FT                   /protein_id="ADQ16192.1"
FT                   /translation="MVLTSCSTSKQVTVPLSRSIEQDDTYTMIWNGISKAYRYENGQWL
FT                   RAESYDYQFDVVQKRYDNHWKSVKSLHRIHPDYDGKAGDRDQTMYFEVAYKNLIDGKVQ
FT                   ATINSSLGNGTGTTDIEFRKSVLTMYVPNASKFMPYNKFRITQHYDYEKGILTETVELI
FT                   KEKDGKEIPFMKNEETALIFIKSKLDKAPTTFKQ"
FT   gene            447769..448194
FT                   /locus_tag="Lbys_0416"
FT   CDS_pept        447769..448194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_6978 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16193"
FT                   /db_xref="GOA:E4RW50"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW50"
FT                   /protein_id="ADQ16193.1"
FT                   /translation="MTSEARKISGYILLSVPTIIYGGYFLLTVLSGQQEQLQLTDFQKS
FT                   MFRAGHAHAGALVILALLVQLFADHIALSNTWKWIARLSFPISAITISLGFFAAAIGRE
FT                   ITEPTGLIFILYVGIVILTLGLLTLGIGLIRQKKGSL"
FT   gene            448360..448719
FT                   /locus_tag="Lbys_0417"
FT   CDS_pept        448360..448719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_1127 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16194"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW51"
FT                   /protein_id="ADQ16194.1"
FT                   /translation="MKITIPVDCDNAPKRRIIKDFIVSVYQKKWQEVGEILDENFSLIS
FT                   FGENSIDLFDVLKEHFSRISKIEELVIEEILSHGKLGACNGKIKLKNQIINFAYFIEFK
FT                   SAGKNTITKITEYKI"
FT   gene            448866..448991
FT                   /pseudo
FT                   /locus_tag="Lbys_0418"
FT   gene            449364..449645
FT                   /locus_tag="Lbys_0419"
FT   CDS_pept        449364..449645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0419"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: cpy:Cphy_3216 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Putative transcriptional regulator,
FT                   Fis family protein; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16195"
FT                   /db_xref="GOA:E4RW52"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW52"
FT                   /protein_id="ADQ16195.1"
FT                   /translation="MEEKEKIVLHSIQHGVSYSSREFGVSTVSIYNWKEKFEKLGKSGL
FT                   EAGAMTDAERELKQLRRENEALKRIVAEKELAIQIKDSLLKKSQSLKK"
FT   gene            449810..450541
FT                   /locus_tag="Lbys_0420"
FT   CDS_pept        449810..450541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0420"
FT                   /product="Integrase catalytic region"
FT                   /note="InterPro IPR001584; KEGG: sli:Slin_6766 integrase
FT                   catalytic region; PFAM: Integrase catalytic region; SPTR:
FT                   Putative transposase, ISSmu1; PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16196"
FT                   /db_xref="GOA:E4RQU6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E4RQU6"
FT                   /protein_id="ADQ16196.1"
FT                   /translation="MDYILQETKTLLEGEFVDYGYYKTYRYLNQEKGLRIGAYRTYKLM
FT                   KENNLLKFQRSNTKRISRNWVKELVPIVQREFAFLEFDIKYVYIQGKRTNAQVLTILDV
FT                   FSRWQLGQYIANSIKSEDVINLFEQILQTYPMPKQFIVRNDNGSQFEALIVQEYLKQKG
FT                   ITQEFTKPATPQQNGHIEAYHSILESAVCQRFEFESLQEFKQVMIRWKKFYNFERIHGG
FT                   LHYKSPRKFLESIGVKIDPNW"
FT   gene            complement(451401..451946)
FT                   /locus_tag="Lbys_0421"
FT   CDS_pept        complement(451401..451946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0421"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="COGs: COG0262 Dihydrofolate reductase; InterPro
FT                   IPR002734; KEGG: fjo:Fjoh_0157 deaminase-reductase
FT                   domain-containing protein; PFAM: bifunctional
FT                   deaminase-reductase domain protein; SPTR:
FT                   Deaminase-reductase domain protein; PFAM: RibD C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16197"
FT                   /db_xref="GOA:E4RW54"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E4RW54"
FT                   /protein_id="ADQ16197.1"
FT                   /translation="MRKVILDLAVTLDGYIEGPNGEIDWCILDNDMEFDKFIESVDTIF
FT                   YGRVSYDAWGNYQPENDANDSVKAIWKAIHSKNKIVFTRQIRNDNNVTYINSDITQSVE
FT                   QIKAKDGKDIWLYGGAKLIETFVDRKLIDIYRLSVHPVVLGNGKPLFENLKQRLNLELL
FT                   SVKKFRSGVVQLIYKNEK"
FT   gene            complement(452164..452868)
FT                   /locus_tag="Lbys_0422"
FT   CDS_pept        complement(452164..452868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0422"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="COGs: COG4430 conserved hypothetical protein;
FT                   InterPro IPR014922; KEGG: gtn:GTNG_1580 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1801; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DU1801)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16198"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWM9"
FT                   /protein_id="ADQ16198.1"
FT                   /translation="MKIELNPQVDKYLIDGCMRCKFGGTPQCKVNTWREELETLRQIVL
FT                   ETGLKEEIKWGVPVYTHNGKNVLSVAALKDFATIGLFKGVLLTDSNKILQQQGSLQSDR
FT                   IVRFTKTTDIIKLEEVLKSYIKEAITIEEQEKKVEFKKNPEPIPEELLQAFEQDPAFKK
FT                   AFYALTSGRQRGYIIHFSQPKQLQTRIGRIEKYKPQIFDGVGLNDKYSCSQKTSTSNSG
FT                   LAQWRVKSKIEV"
FT   gene            complement(452865..453248)
FT                   /locus_tag="Lbys_0423"
FT   CDS_pept        complement(452865..453248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0423"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR016944; KEGG: phe:Phep_2123 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16199"
FT                   /db_xref="GOA:E4RWN0"
FT                   /db_xref="InterPro:IPR016944"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN0"
FT                   /protein_id="ADQ16199.1"
FT                   /translation="MKKRDKIIYWVASIWLAVAMIASGIQQIFTIGGFVEIMERLEYPT
FT                   YFSVILGVWKIAGVVTILIPKFPLLKEWAYAGFFFVMSGAIFSHLAVGDEAVELFTPIF
FT                   LLVLTVVSWYFRPNDRKISINQQ"
FT   sig_peptide     complement(453159..453248)
FT                   /locus_tag="Lbys_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(453255..453719)
FT                   /locus_tag="Lbys_0424"
FT   CDS_pept        complement(453255..453719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0424"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="COGs: COG3832 conserved hypothetical protein;
FT                   InterPro IPR013538; KEGG: phe:Phep_2122 activator of HSP90
FT                   ATPase 1 family protein; PFAM: Activator of Hsp90 ATPase 1
FT                   family protein; SPTR: Activator of Hsp90 ATPase 1 family
FT                   protein; PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16200"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN1"
FT                   /protein_id="ADQ16200.1"
FT                   /translation="MEQLTKVNAEDGKQEIVITREFDLPLELLFKAYEEPELFEQWMGT
FT                   KVLKMENKKHGSYAFETSYNGNVVFRANGTIHEFVPNQKITRTFEMENTAFPVQLEYLE
FT                   FEKLTDETSKLTMHIVFKSIEFRNQLLQMPFAQGINMAHNKLQEIVNKLR"
FT   gene            complement(453724..454044)
FT                   /locus_tag="Lbys_0425"
FT   CDS_pept        complement(453724..454044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0425"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; KEGG: cpi:Cpin_4829
FT                   transcriptional regulator, ArsR family; PFAM: regulatory
FT                   protein ArsR; SMART: regulatory protein ArsR; SPTR:
FT                   Transcriptional regulator, ArsR family; PFAM: Bacterial
FT                   regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16201"
FT                   /db_xref="GOA:E4RWN2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN2"
FT                   /protein_id="ADQ16201.1"
FT                   /translation="MNLRRDVFQAIADPTRRTILLLVASQSMTAGAIASNFDTARPTVS
FT                   KHLQILTECDLLKQEQSGREVYYHINAKKMKEVADFIEPFRKMWDDRFNKLEAVMKNYK
FT                   NQ"
FT   sig_peptide     complement(453949..454044)
FT                   /locus_tag="Lbys_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(454401..455132)
FT                   /locus_tag="Lbys_0426"
FT   CDS_pept        complement(454401..455132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0426"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2230 Cyclopropane fatty acid synthase and
FT                   related methyltransferase; InterPro IPR013216; KEGG:
FT                   str:Sterm_0996 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: SAM-dependent
FT                   methyltransferase; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16202"
FT                   /db_xref="GOA:E4RWN3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN3"
FT                   /protein_id="ADQ16202.1"
FT                   /translation="MKENKYDDLIFFEQYEQMNRSQKGLEAAGEWHVLKDMLPDFSEKD
FT                   ILDLGCGFGWHCRYAIEKGARSVVGVDISEKMLEKAKKINSLQGIEYVNKPLEDVDYPD
FT                   EKFDIVLSSLTFHYIESFDVICKNVYNWLKPKGCFVFSVEHPIFTAFGNQDWIYGDTRE
FT                   KLYWPVDNYFKEGKREAVFLGEKVIKYHKTLTNYINTLLRNGFKINELIEPQPSEEMLK
FT                   DFPEMKDEMRRPMMLLVSAEK"
FT   gene            complement(455303..455983)
FT                   /locus_tag="Lbys_0427"
FT   CDS_pept        complement(455303..455983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pru:PRU_2457 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Abi-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16203"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN4"
FT                   /protein_id="ADQ16203.1"
FT                   /translation="MRYSDFASVMTNARMNRYLLACGGNTRKTMTLYRKNLQLTQELFT
FT                   VISCFEVALRNAIDAVVSPLLGNDWLRNAAATGGIFDTPRCRLTRDNINDAIKKLHTYS
FT                   HYKLVAELGFGFWRFMFAQNQFNATGRILLRVFPSKPTSTPAIQYNNIYIFNQLAQLND
FT                   IRNRMAHHEPICFLPGQPIKDTTYARQHYNLILQLFQWMQIDEAALLYGLDHINTVCNE
FT                   IDNL"
FT   gene            complement(456456..457350)
FT                   /pseudo
FT                   /locus_tag="Lbys_0428"
FT   gene            complement(457353..457661)
FT                   /locus_tag="Lbys_0429"
FT   CDS_pept        complement(457353..457661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0429"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: sli:Slin_6765 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Putative transcriptional regulator,
FT                   Fis family protein; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16204"
FT                   /db_xref="GOA:E4RQU5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RQU5"
FT                   /protein_id="ADQ16204.1"
FT                   /translation="MSKHRKTWSLEEKEKIVLHSIQHGVSYSSREFGVSTVSIYNWKEK
FT                   FEKLGKSGLEAGAMTDAERELKQLRRENEALKRIVAEKELAIQIKDSLLKKSQSLKK"
FT   gene            457860..458822
FT                   /locus_tag="Lbys_0430"
FT   CDS_pept        457860..458822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0430"
FT                   /product="beta-lactamase"
FT                   /note="COGs: COG1680 Beta-lactamase class C and other
FT                   penicillin binding protein; InterPro IPR001466; KEGG:
FT                   lin:lin1811 hypothetical protein; PFAM: beta-lactamase;
FT                   SPTR: Beta-lactamase; PFAM: Beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16205"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN6"
FT                   /protein_id="ADQ16205.1"
FT                   /translation="MSKLSDQTLELLSKEYLNISGLAIAKDGKIAYEYFARDSEKDAKI
FT                   HVASVTKSVFSILVGIALEKQYIKSIHEKIISYFPDLKISSRNKTLSQLEIKHLLTMTA
FT                   SYKFRSEPYSKVFSTQNWGWTALQLLGGIKPIGEFHYTTIGIQVLSSILEQTTQMNINA
FT                   FATKYLFTPLRIIPPETLPIDSRETYFKFIKNHYSNGWAADPQGTNTSGWGLMLSVHDL
FT                   LKIGQLYLQNGQWEGKSIVSSQWVEESTTTHSFWENKPYGYLWWILDDETFAAIGDGGN
FT                   IIYVNRSKNLVIGIVSHFVPRSKDRIDFIENHLIPVYNL"
FT   gene            459012..459371
FT                   /locus_tag="Lbys_0431"
FT   CDS_pept        459012..459371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_1127 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16206"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN7"
FT                   /protein_id="ADQ16206.1"
FT                   /translation="MKITIPIDCDNAPKRRIIKDFIVSVYQKKWQEVGEILDENFSLIS
FT                   FGVNSIEVFDVLKEHFSSIPKIEELVIDEILSHGKLGACNGKIKLKDQIINFAYFIEFK
FT                   SAGKNTITKITEYKI"
FT   gene            459840..463451
FT                   /locus_tag="Lbys_0432"
FT   CDS_pept        459840..463451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0432"
FT                   /product="putative type IIS restriction/modification
FT                   enzyme"
FT                   /note="InterPro IPR002052:IPR002296; KEGG: mar:MAE_63060
FT                   putative type IIS restriction/modification enzyme; SPTR:
FT                   Putative type IIS restriction/modification enzyme; PFAM:
FT                   Eco57I restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16207"
FT                   /db_xref="GOA:E4RWN8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN8"
FT                   /protein_id="ADQ16207.1"
FT                   /translation="MILKELKPRKALNKAFLKVKPNRTEIEGFKTNLITLLDRTNDTES
FT                   EEFHKNLVSDFLKKTYYDPNHFINTKGRNDLVIHNGQNANSTVGVILEAKKPTNKAEMI
FT                   TTQKLNAKAFQELVLYYLRERITHKNLEVKHLVATNINEWFIFDATLFDRLFAQNKNLV
FT                   KQFNDFEGGRLADTKTDFFYKQIAEPFIDTITSEIEFTYFNIQDFQKPLRNTDKADDNS
FT                   LIALFKLLSPEHLLKLPFTNDSNSLDKRFYSELLHIIGLTETKEGSKKLIQRNKDGERH
FT                   TGTILEDAIIQLDSLDKLSRLEKPNQFGNTQQERLFNVALELSITWINRILFLKLLEAQ
FT                   LITYHKGDKSYSFLNLDKIKNYDDLNSLFFQVLARKYDERNEDVKKAFEKVPYLNSSLF
FT                   EPTDIEQVTLFISNLKDDKTIPIFSQTVLKDQQGKKRTGNISTLQYLFEFLDAYDFGAE
FT                   GGEEIQEDNKTLINASVLGLIFEKINGYKDGSFFTPGFITMYMCRETIRKAVVQKFNET
FT                   KKWNCTTLEELYDKIEDRKEANQIVNSIKICDPAVGSGHFLVSALNEIIAVKNDLKILQ
FT                   DRDGKRLKEYQVEVVNDELIVTDEEGELFEYNPGSTGSPTNRESQRVQETLFHEKQTII
FT                   ENCLFGVDINSNSVKICRLRLWIELLKNAYYKNATELETLPNIDINIKCGNSLVSRFAI
FT                   DADLAHGLNRGLKSKWNIDTYKIAVSTYRNAESKEQKREMERLIADIKSDFRSEISRND
FT                   PKVKKLNKLEGELVKLTTQQSLFEMSKKEKADWNKKVQQISAEIKKLETEIEEIKANKI
FT                   FENAFEWRFEFPEVLNDEGDFVGFDVVIGNPPYGVKPNEIGKEYFNSLYSATDDIYTLF
FT                   IELGLKIISENSNISFINPITWLTGSKYKNTRNLFTGKNSLVKAINLPYDIFADAYVDT
FT                   GIYFFQKKTIEQSSVYEFNPKDKIQIQDLLNIEFKALDRKVWTAKPDLKINLNESDNSI
FT                   FSKLDSIQSKLSDFSETARGILADKSNYKSEFENGLKKVFTGNLNRYVIDETFSFIQYD
FT                   DSLKEKPKSYSFFTGERILVRRIISRQFRMMATYTNEEFVCKKDIYIIKLNDENISYKY
FT                   VLALLNSKLLSFYKTKNSGSAKKDDFTQITLGDIRQLPIPKIETSKQQKFIKLVDEILT
FT                   AKEKNKDTTIAENELDQLVYQLYELTEEEIKIVEGNG"
FT   gene            463444..463572
FT                   /locus_tag="Lbys_0433"
FT   CDS_pept        463444..463572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16208"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWN9"
FT                   /protein_id="ADQ16208.1"
FT                   /translation="MDKSIQISLLTNHSPRFKPGAMEMRETTAKPFQRFKKQELKN"
FT   gene            463575..464009
FT                   /locus_tag="Lbys_0434"
FT   CDS_pept        463575..464009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0904 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Transposase IS200
FT                   like"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16209"
FT                   /db_xref="GOA:E4RWP0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP0"
FT                   /protein_id="ADQ16209.1"
FT                   /translation="MPHSYNKIWIHAIWATKARIPLVHQNIEQNVYQFISNQLREQGCP
FT                   VRIINGMPDHIHCLFLLNPQKSIAEVIKQIKGSSSHFINQNNLIPEKFAWQTGYAAYSV
FT                   SESGIEKVFQYIKCQKMHHRKKSFQEEYDAFIKLYGLNEH"
FT   gene            463999..464847
FT                   /locus_tag="Lbys_0435"
FT   CDS_pept        463999..464847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0435"
FT                   /product="TIR protein"
FT                   /note="InterPro IPR000157; KEGG: set:SEN1975 hypothetical
FT                   protein; PFAM: TIR protein; SMART: TIR protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: TIR domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16210"
FT                   /db_xref="GOA:E4RWP1"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP1"
FT                   /protein_id="ADQ16210.1"
FT                   /translation="MSIDYITRQIANVDRDINSIERIIHPIDANITRKQKEAHSLLDKI
FT                   AREKDLKRMIGYQKDLTKKNEEINKLEKDKSSKSKSLADKQKKKLELLSKLNKEEQKER
FT                   DKTKKEQKEMLTLQQQITREMEKQKMQSLHSFDVLKPQPIIQTTYDVFVSHASEDKDDF
FT                   VRDFVKCLQQNGLKVWYDEFTLRVGDSLRRSIDNGLRNSRYGIVVLSEAFFSKEWPQRE
FT                   LDGLFAREVNGEKVILPIWHKISKNEVMKFSPIIADMLALNTSSFTIEEIAKEISDRVL
FT                   N"
FT   gene            complement(465327..465413)
FT                   /locus_tag="Lbys_R0008"
FT   tRNA            complement(465327..465413)
FT                   /locus_tag="Lbys_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(465432..466478)
FT                   /locus_tag="Lbys_0436"
FT   CDS_pept        complement(465432..466478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0436"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /EC_number="3.1.1.47"
FT                   /note="COGs: COG0252 L-asparaginase/ Glu-tRNAGln
FT                   amidotransferase subunit D; InterPro
FT                   IPR020827:IPR006034:IPR006033; KEGG: dfe:Dfer_5475
FT                   L-asparaginase, type I; PFAM: Asparaginase/glutaminase;
FT                   PRIAM: 1-alkyl-2-acetylglycerophosphocholine esterase;
FT                   SPTR: L-asparaginase, type I; TIGRFAM: L-asparaginase, type
FT                   I; PFAM: Asparaginase; TIGRFAM: L-asparaginases, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16211"
FT                   /db_xref="GOA:E4RWP2"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP2"
FT                   /protein_id="ADQ16211.1"
FT                   /translation="MTFNPVQIKEGEERILIIYTGGTLGMVFDENKRTLVPFRFRETLL
FT                   KLPELNLLSSAIHLVSFEKPIDSSDVNAEIYLTIAGIIQKHYHEFDGFVIIHGTDTMAF
FT                   TASALSFLIHNPKKPIVFTGAQLPIGIPRTDARENLITSIEIAGARLNGKAVVPEVCIY
FT                   FNGRLLRGNRARKRESSQFDAFDSENYPYLAEIGVSIEYNFRHIRYVEGETRFYDEMSD
FT                   QVSVLTLFPGISKEILKKHVLNENTRGIIMMTYGSGNAPSADWFIDILAEGISSGKTVL
FT                   NITQCTGGKVTMGKYASSKRMKDIGVISGSDMTLEAAVGKMMWGLCQEDQKLEEIFAQN
FT                   LAGEISLP"
FT   gene            complement(466468..466839)
FT                   /locus_tag="Lbys_0437"
FT   CDS_pept        complement(466468..466839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_1239 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16212"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP3"
FT                   /protein_id="ADQ16212.1"
FT                   /translation="MHNIYKTTLHHQRMQAQRIKYLQDEIENFPDDPFNHYALALEYIS
FT                   AGDLRAEEIFRHLLKEFPDYLPTYYKAANYFFDRDLWDEAEAIFIKGIALAEAQGNEKA
FT                   HRELNSSYALFKTETQDDF"
FT   gene            466885..467619
FT                   /locus_tag="Lbys_0438"
FT   CDS_pept        466885..467619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0438"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2086 Electron transfer flavoprotein beta
FT                   subunit; InterPro IPR012255:IPR014730; KEGG: dfe:Dfer_1240
FT                   electron transfer flavoprotein alpha/beta-subunit; PFAM:
FT                   Electron transfer flavoprotein alpha/beta-subunit; SPTR:
FT                   Electron transfer flavoprotein alpha/beta-subunit; PFAM:
FT                   Electron transfer flavoprotein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16213"
FT                   /db_xref="GOA:E4RWP4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP4"
FT                   /protein_id="ADQ16213.1"
FT                   /translation="MKILVCISSVPDTTSKIAFEEGNTRFSKAGIQYIIGPYDDYALAR
FT                   GVELKEATGGSLTVLNVGQADAEPQIRKALAIGADTAVRIDAEPTDSYFVAAEIANYAK
FT                   DKGFDLILMGRETTDYNTGVVHGMVGEMLGIPSFSPVMELNVEGSKVVLSKEIEGGKEK
FT                   LETSLPLVLGCQEPIAEWKIPSMRGIMGARTKPIEVISPSSSANTAVMNYDLPPAKGAV
FT                   KMIPAEQAETLIELLQKEAKVL"
FT   gene            467639..468589
FT                   /locus_tag="Lbys_0439"
FT   CDS_pept        467639..468589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0439"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="COGs: COG2025 Electron transfer flavoprotein alpha
FT                   subunit; InterPro IPR001308:IPR014730:IPR014731; KEGG:
FT                   dfe:Dfer_1241 electron transfer flavoprotein alpha subunit;
FT                   PFAM: Electron transfer flavoprotein alpha subunit;
FT                   Electron transfer flavoprotein alpha/beta-subunit; SPTR:
FT                   Electron transfer flavoprotein alpha subunit; PFAM:
FT                   Electron transfer flavoprotein domain; Electron transfer
FT                   flavoprotein FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16214"
FT                   /db_xref="GOA:E4RWP5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP5"
FT                   /protein_id="ADQ16214.1"
FT                   /translation="MSVLIFVELGEGSIKKNSREAIVYGSKVAAQVGGTAISLAIGEAS
FT                   ESELAKAGNYGASKVIYVKKEENIMAYAKVLKDVIQSTGSKIVVASKSSLSDAVLARAA
FT                   GALNAGFVANAVELPDTSSGFVVNRSIFSGKAFAKTSISSEVKFLTIKKNIIAVEESGS
FT                   SASVENLDIATAAEDGSAKTIAVEKASGTVSLPEADIVVSGGRGMKGPEHWQPLLDLAD
FT                   ALGAATACSKPVSDLDWRPHHEHVGQTGVKVAPNLYIACGISGAIQHLAGVNSSKVIVV
FT                   INKDPEAPFFKAADYGIVGDVFEVLPKLTAAVKAL"
FT   gene            468659..470776
FT                   /locus_tag="Lbys_0440"
FT   CDS_pept        468659..470776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0440"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro
FT                   IPR006665:IPR011659:IPR006664; KEGG: sli:Slin_2542
FT                   OmpA/MotB domain protein; PFAM: OmpA/MotB domain protein;
FT                   WD40-like beta Propeller containing protein; SPTR:
FT                   OmpA/MotB domain protein; PFAM: WD40-like Beta Propeller
FT                   Repeat; OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16215"
FT                   /db_xref="GOA:E4RWP6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP6"
FT                   /protein_id="ADQ16215.1"
FT                   /translation="MVKGLIKTFVLLFLTWASFAQEVQWASKVLEKSSETVDEKFSPKH
FT                   RAIQVLGPPSVLPQTISSACSWRPTGTSFGEDYIKVAFDKPQKVKQIIVGETVGPGAVG
FT                   RIFGYTTKNKEVLLYESQGDNFRKQPGIWNQFIPETEEEIAALKLVIVHSLNKGIKEYD
FT                   CIGISSSSEPYVATVNVAQNLPKDLKKENLGPSVNTKYSEVAPLVSPDGKYLYFSRWDH
FT                   PKNFKPAGSNESTLDVWVSTLAANGTWEPAKNMSTSIHHSAKNGAATIAMDGKSIYALN
FT                   VEVGRGKFDAGLTKVSLKNNKWVNKRPIKIANFEALSYYNSQDRQLKKETEFSMSSDEK
FT                   FLVMGLVRKDSYGDKDLYVSFKTGEDSYSKPVNLGPVINTAGNEGSPFLAADNKTLYFN
FT                   SNGHPGYGDMDIFMSTRLDDTWTNWTEPVNLGPQINSPEFDGYISIPASGEYAYFSSAK
FT                   NSMGLDDLFKVKLFPSIQPESVVLMEFSFVDEISGQSIEPKVSISPQVEWVWDEETKIF
FT                   KTIFQPGQTYELKAESSGYPSFSQSLDFREVKEYLEKKEVYKWRKIGQESIAQTAPKTV
FT                   NAEPESVKDMVIEAGKKIVLREVYFDQSKAELRQESFVELDRIKKIMMEHPDMVILLEG
FT                   HTDNQGDANLNFKLAEQRILNVKNYLIEDGQIKEERIQLKSWGQYRPLVKNTTEEERRK
FT                   NRRVEFTILKM"
FT   sig_peptide     468659..468733
FT                   /locus_tag="Lbys_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            470802..471755
FT                   /locus_tag="Lbys_0441"
FT   CDS_pept        470802..471755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0441"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: dfe:Dfer_4680
FT                   ribonuclease III; PFAM: glycosyl transferase family 2;
FT                   SPTR: Ribonuclease III; PFAM: Glycosyl transferase family
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16216"
FT                   /db_xref="GOA:E4RWP7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP7"
FT                   /protein_id="ADQ16216.1"
FT                   /translation="MIPKLLLVLPCYNEEAILHLTDAKLNTFYDELISQGLISAESKIC
FT                   YVNDGSRDATWNIIDRLTKSNSRILGVKLSKNFGHQNALLAGLFEYKGLFDCYISIDAD
FT                   LQDDIYAIPPMIEKFKEGASIVYGVRDDRSTDTFFKKFTAESFYKVMQWLKVPVVFNHA
FT                   DFRLIDNRVLTELEHYREVNMFIRGIIPTIGFKNDKVFYKRLEREAGETKYPLKKMLTF
FT                   AWNGVTSFSTMPMRFVLYFGAFSFVLSLLLAVYVLYTKFAGVTTSGWASTLLMMAFFNG
FT                   SNMMAIGLIGEYVGKIYEEVKARPRYIVEKSTPLEA"
FT   gene            471752..473467
FT                   /locus_tag="Lbys_0442"
FT   CDS_pept        471752..473467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0442"
FT                   /product="glycosyl transferase family 39"
FT                   /note="COGs: COG5305 membrane protein; InterPro IPR003342;
FT                   KEGG: sli:Slin_2543 membrane protein-like protein; PFAM:
FT                   glycosyl transferase family 39; SPTR: Membrane protein-like
FT                   protein; PFAM: Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16217"
FT                   /db_xref="GOA:E4RWP8"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP8"
FT                   /protein_id="ADQ16217.1"
FT                   /translation="MRKYILLFFLGVIALSFRLYRLDARGLITDEKFTLLNANGFWVGG
FT                   ANQSAFKKTYFTAQDFWEKKGPQDFMDASANADFGTHMVHNVILHYWMKVFGNSDFSVR
FT                   MPGLIFNVLTVLLIYLLVLKYFRSYSMAFLAGLLFAIDPLNIAQSHIARSYPLSFFLIT
FT                   LATAYFVKLVSGENSKKNFVIYAVLIGLAMLNHYMNFFVPLLHVLIFLVIRNKSHLWTG
FT                   FILAALANALLLFYWFNWGGGKGAMGFLKDKNEIHKKIAENLQDELSQTIQLASPDVIA
FT                   KKGIALYYDISVITHGLFEDIKGVKVFLSSLLLAIGILLSVQGHKYKRYAGLFLSLLIL
FT                   ALERIYLGSILASAALFVAFYYAVKYLLETRRYEAEKQEFVWLCMGLGMLILPLIFVVR
FT                   DAYLSGNTTSLTHRYIGNASPFVVILVSIGVIRAAQEKVILGALMLFLMIFQWTNIQKG
FT                   IQDYFADRSVYNAYFVPERVPNPYAALAKEIQEKAALGDTLVIPGAYKDKYEERFDKGG
FT                   TVSYKDAQFLNLYFPKDYALIQYVDPKERERLYLKKKDGERVLLFDFKGEEYRY"
FT   sig_peptide     471752..471829
FT                   /locus_tag="Lbys_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            473472..474398
FT                   /locus_tag="Lbys_0443"
FT   CDS_pept        473472..474398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0443"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: dfe:Dfer_3529 glycosyl
FT                   transferase family 2; PFAM: glycosyl transferase family 2;
FT                   SPTR: Glycosyl transferase family 2; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16218"
FT                   /db_xref="GOA:E4RWP9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWP9"
FT                   /protein_id="ADQ16218.1"
FT                   /translation="MKIKIILPVFNDWEALRLLIEKTYQLYHGKPYHISFLAVDDCSSI
FT                   PYNKEDFKDYDLEVLHLISNQGHQRAIAIGLSYFADHNDADKVIVMDSDGEDQPEHIEA
FT                   LLEKAEQEPEKIIFAQRKKRTESLLFRVFYKIYKFVFKLLTGNIITFGNYSLIPAKQVK
FT                   KLANVSELWNHYPGAIIRSRLPFDSIPLDRGTRLAGKSKMNFSSLVLHGMSAVSVFVDV
FT                   TAVRIVMFAAFMIISSVVGVLIVLYFKYVLGQATPGWATSVISGLFIVFIQGFFIAMFI
FT                   LFMVLSSRRYTSFIPYFGYKKFIDFVE"
FT   gene            474398..474598
FT                   /locus_tag="Lbys_0444"
FT   CDS_pept        474398..474598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2675 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16219"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ0"
FT                   /protein_id="ADQ16219.1"
FT                   /translation="MEEFLSYLQKKKIDAHAFKQHEPEIFAEWAEEFGQMHPESFTSRK
FT                   KYFINPIRRKYLLKSPSEALG"
FT   gene            474641..475021
FT                   /locus_tag="Lbys_0445"
FT   CDS_pept        474641..475021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0445"
FT                   /product="glycine cleavage system H protein"
FT                   /note="COGs: COG0509 Glycine cleavage system H protein
FT                   (lipoate-binding); InterPro IPR002930:IPR003016:IPR017453;
FT                   KEGG: cat:CA2559_01205 glycine cleavage system protein H;
FT                   PFAM: glycine cleavage H-protein; SPTR: Glycine cleavage
FT                   system H protein; TIGRFAM: glycine cleavage system H
FT                   protein; PFAM: Glycine cleavage H-protein; TIGRFAM: glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16220"
FT                   /db_xref="GOA:E4RWQ1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ1"
FT                   /protein_id="ADQ16220.1"
FT                   /translation="MNFPEGIKYTQEHEWIRLEGDVATVGITDFAQSELGDIVFVEVET
FT                   VGESLGENEVFGTVEAVKTVSDLYLPISGEVLEVNEKLSDEPELINNDPYGDGWIIKLK
FT                   VDNVADVEKLMDAETYKSSVGH"
FT   gene            475078..476337
FT                   /locus_tag="Lbys_0446"
FT   CDS_pept        475078..476337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0446"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro IPR006680:IPR004722; KEGG:
FT                   dfe:Dfer_4467 dihydroorotase, multifunctional complex type;
FT                   PFAM: amidohydrolase; SPTR: Dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16221"
FT                   /db_xref="GOA:E4RWQ2"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ2"
FT                   /protein_id="ADQ16221.1"
FT                   /translation="MERLVKNIKVIDKNSPYHGQKVDLLVSGGKIVGINTESKAEVFDG
FT                   TDLCVSPGWTDGGTHFKDPGYEWLDDLNSIHEAAAYGGFTRVIGFPNTTPVIQTKEAIT
FT                   YFEHFNRTKPVQLLNLAAVTRECKGEDFTDMIDLHKGGAVGFSDGKEAIQNSDIFLKTL
FT                   LYLQPLNAVLVVKSEDKYLSMYGQMHEGVTSTLLGMKGIPSAGEELMIMRNLKLLEYSG
FT                   VQSSLPVLHFSTISTKGSVELIREAKAKGLPVSCDIAAHHLVFKDEDLMGFDTHYKVYP
FT                   PFRSTEDIEALLEGLKDGTIDMVISDHNSWDAEHKTLEFDVAEFGAVGLQTVFSVCVEK
FT                   LGLDLAMEKLVYNPRNIFRLPTSSIKEGEEADLTIFSVEEEYECSEDYLKSKGKNTPFL
FT                   GKVLKGRAKAVVNNRQFKSL"
FT   gene            476334..476840
FT                   /locus_tag="Lbys_0447"
FT   CDS_pept        476334..476840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_6625 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16222"
FT                   /db_xref="GOA:E4RWQ3"
FT                   /db_xref="InterPro:IPR025250"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ3"
FT                   /protein_id="ADQ16222.1"
FT                   /translation="MNPIVRKSLIFGSIAGGVCFLFFLVMYFLNPNPLALRRPDLGINI
FT                   IFIGVAIWYYKRENGGYLHFYEGFSLGFLTNIIAALLTGVLIFLFLQYVDVRPFEEWTA
FT                   WSKNLLLTDRERSKELMNEQTFQQLLKSFEEKSPAVIIGDELIFKQIAIVACTLFSMGM
FT                   RKIKP"
FT   sig_peptide     476334..476390
FT                   /locus_tag="Lbys_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            476842..477357
FT                   /locus_tag="Lbys_0448"
FT   CDS_pept        476842..477357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4469 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16223"
FT                   /db_xref="GOA:E4RWQ4"
FT                   /db_xref="InterPro:IPR025250"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ4"
FT                   /protein_id="ADQ16223.1"
FT                   /translation="MEKVSTARIALKWGLIFGLVSIVINTIVYTFNLLEHQMLNGLISL
FT                   VLSFAILYFAFKEFRDLNNGFMKFGQGVGLGSLLFVTAGVLASTYDLVYKRVIDPTVIE
FT                   KQLDLIQQQNEKMGMSPEMIEQAMEKSRPFIEGPFAFVIMVLSLAFIGLLCSLIMAAIM
FT                   KKNPPVFE"
FT   sig_peptide     476842..476931
FT                   /locus_tag="Lbys_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            477361..478086
FT                   /locus_tag="Lbys_0449"
FT   CDS_pept        477361..478086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0449"
FT                   /product="protein involved in gliding motility GldF"
FT                   /note="InterPro IPR018073:IPR019860; KEGG: dfe:Dfer_4470
FT                   ABC transporter permease; gliding motility-associated
FT                   protein; SPTR: ABC transporter permease; gliding
FT                   motility-associated protein; TIGRFAM: gliding
FT                   motility-associated ABC transporter permease protein GldF;
FT                   TIGRFAM: gliding motility-associated ABC transporter
FT                   permease protein GldF"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16224"
FT                   /db_xref="GOA:E4RWQ5"
FT                   /db_xref="InterPro:IPR019860"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ5"
FT                   /protein_id="ADQ16224.1"
FT                   /translation="MWSIFRKEVASFFNSLIAYIVIGVFLLLNGWLFWIYPETSILDYG
FT                   YAEMDTFFQLCPFILLFFIPAVTMRTFSEELRSGTMEYLLTRPVSLWGIILGKYLSCLL
FT                   IFCLALLPTLIYYFSLYVLGNPAGNIDSAAVAGSYFGLMLLAGVYAAIGVFLSSLTKNQ
FT                   VVAFLVSALVCYVVFVGLDQFSQLFSGSVQYLIAQVGLSIHYNSLGKGVLDSRDIIYMG
FT                   SVSVLFLLLTYQSLNNIRK"
FT   gene            478083..478874
FT                   /locus_tag="Lbys_0450"
FT   CDS_pept        478083..478874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0450"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="COGs: COG0384 epimerase PhzC/PhzF homolog; InterPro
FT                   IPR003719; KEGG: ckr:CKR_0845 hypothetical protein; PFAM:
FT                   Phenazine biosynthesis PhzC/PhzF protein; SPTR: Phenazine
FT                   biosynthesis protein PhzF family; TIGRFAM: phenazine
FT                   biosynthesis protein PhzF family; PFAM: Phenazine
FT                   biosynthesis-like protein; TIGRFAM: phenazine biosynthesis
FT                   protein PhzF family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16225"
FT                   /db_xref="GOA:E4RWQ6"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ6"
FT                   /protein_id="ADQ16225.1"
FT                   /translation="MISLKIFHINTFSSEDFKGNPAGVVPMDFWISDDLMQKIANQNGL
FT                   SETAFFVKTVRGFAIRWFTPEVEVPLCGHATLASGYVLTEFMNHPDERILFESKSGDLE
FT                   FVKKDGLFYLDFPAFESHEISLDFPFQKALGVQPQKVYQANEDIMAVFRNEEEIAQIRP
FT                   DFHALLKLKGRGLIVTAPGKKVDFVSRFFAPSLGINEDAVTGSSFTKLFPYWSKELGKT
FT                   EFQAMQISERTGKVTGQVLNGRVLIGGEAMPYLKGEIYIKS"
FT   gene            478979..480031
FT                   /locus_tag="Lbys_0451"
FT   CDS_pept        478979..480031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0451"
FT                   /product="S-adenosylmethionine--tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="COGs: COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase); InterPro IPR003699; KEGG:
FT                   sli:Slin_1175
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; SPTR:
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase;
FT                   TIGRFAM:S-adenosylmethionine/tRNA-ribosyltransferas
FT                   e-isomerase; PFAM: Queuosine biosynthesis protein; TIGRFAM:
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16226"
FT                   /db_xref="GOA:E4RWQ7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ7"
FT                   /protein_id="ADQ16226.1"
FT                   /translation="MKLSSFKFDLPDSLIAQHPYEDRDGARMMVLHRKTGKIEHKQFRD
FT                   IIEYFGDGDVMVANDTKVFPARLYGSKEKTGAKIEVFLLRELNREMRLWDVLVDPARKI
FT                   RVGNKLYFGDSDLVAEVIDNTTSRGRTIRFLFDGNHEEMMQAIYELGETPIPKDILQRE
FT                   VADYDEERFQTIFAKNEGAVAAPIAGIHFTKNIVRRMEINGVDFAPLTLHIGIGTFRQV
FT                   EVEDLTKHKTDSENFFIPEATCNIVNRALDENKRVCAIGSTSLRAMESSVSANNRLKPL
FT                   DNAWTDKFIFPPFDFKIANALLTNFHLPESILLMTTCAFGGYDTVMEAYQVAIKEKYKF
FT                   FTYGDAMLII"
FT   gene            480031..480711
FT                   /locus_tag="Lbys_0452"
FT   CDS_pept        480031..480711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0452"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="COGs: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; InterPro
FT                   IPR001228; KEGG: cpi:Cpin_1530 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; SPTR:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM: Uncharacterized protein family
FT                   UPF0007; TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16227"
FT                   /db_xref="GOA:E4RWQ8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ8"
FT                   /protein_id="ADQ16227.1"
FT                   /translation="MSQKIAVIVASGTGSRMGSEIPKQFLPLNGKPVLVHTLEKFLSIH
FT                   DCHIILVLSEAGKAYWQPISEQFFPDTYIPVITGGDTRYQSVKNALNSLDTDVPTIVAI
FT                   HDAVRPLVPLNVILNAYVVAEQFGSAVTCVDSKDSVRLITEDRNQALERKKVKLIQTPQ
FT                   TFQWDILKKAYELPYIDSFTDDASVVEAAGYTIHLVEGSYANLKITTPEDLFLAEHLLH
FT                   ESAH"
FT   sig_peptide     480031..480084
FT                   /locus_tag="Lbys_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            480695..481621
FT                   /locus_tag="Lbys_0453"
FT   CDS_pept        480695..481621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0453"
FT                   /product="LAO/AO transport system ATPase"
FT                   /note="COGs: COG1703 Putative periplasmic protein kinase
FT                   ArgK and related GTPase of G3E family; InterPro IPR005129;
FT                   KEGG: gbr:Gbro_2421 LAO/AO transport system ATPase; PFAM:
FT                   ArgK protein; SPTR: LAO/AO transport system ATPase;
FT                   TIGRFAM: LAO/AO transport system ATPase; PFAM: ArgK
FT                   protein; TIGRFAM: LAO/AO transport system ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16228"
FT                   /db_xref="GOA:E4RWQ9"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWQ9"
FT                   /protein_id="ADQ16228.1"
FT                   /translation="MKALIDGIIRGERPSLAKAITLLESSLPQDRQNAAELLRSLPSND
FT                   RPTLRIGVTGVPGVGKSTLIESLGLSFIQDGHKVAVLAIDPSSTVTGGSILGDKTRMQQ
FT                   LSQEMDAFIRPSPSKGTLGGLSEHTLQLIKLVEAAGFDRIIVETVGVGQSETDVKQVCD
FT                   LVLLLTMPTVGDELQGVKRGIMERVDLVVVNKIDLYSEKMVQAFSQGIRQSMHLYQQDL
FT                   PVFQVSAESGRGMEELVEYLRRQEAGDRKEADLLEFRLRLNQLQKELWDEMVGGLQKEW
FT                   EEKVLQGGMLPEEAAWELLNTFKQSLQ"
FT   sig_peptide     480695..480796
FT                   /locus_tag="Lbys_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(481602..483110)
FT                   /locus_tag="Lbys_0454"
FT   CDS_pept        complement(481602..483110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0454"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="COGs: COG1866 Phosphoenolpyruvate carboxykinase
FT                   (ATP); InterPro IPR001272:IPR015994; KEGG: cpi:Cpin_6930
FT                   phosphoenolpyruvate carboxykinase; PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); PRIAM:
FT                   Phosphoenolpyruvate carboxykinase (ATP); SPTR:
FT                   Phosphoenolpyruvate carboxykinase [ATP]; TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   Phosphoenolpyruvate carboxykinase; TIGRFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16229"
FT                   /db_xref="GOA:E4RWR0"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR0"
FT                   /protein_id="ADQ16229.1"
FT                   /translation="MTAISTQIHQNLKPELLIEQAVKLGLASHCETGAPVVRTGKFTGR
FT                   SPKDKFFVKEGAEHVDWNDFNLPIDEKHFLQLRTDLISYLNTKPEIWSKEVYVGADPEY
FT                   RIGLTCYTEWPDSSLFVDNMFIEKDENFTSEWTIYQAPGFHANPDIHGTRQGNFAIISL
FT                   KHKTILIGGTGYTGEIKKGMFTVMNYLLPSERNVLTMHCSANIGKEGDVALFFGLSGTG
FT                   KTTLSADPNRRLIGDDEHAWTPNGVFNLEGGCYAKVIDLSPENEPQIFQAIRGQALLEN
FT                   VVFHKDSNCIDFSNKSITENTRVSYPLTYIKHAVIPSMGGTPKNIFFLTCDAFGVLPPI
FT                   SKLDADQAMYFFLNGYTAKIAGTEEGIKEPKPTFSTCFGAPFLPLKPSTYAEMLKEKIA
FT                   ESGSQVWMVNTGWTGGGYGVGSRIKLSYTRAMISAALKGELKGVITQKHPIFGVEMPLC
FT                   CPGVPSLLLNPANTWENKEQYFEESKKLSTLFEKNHQKFTVETV"
FT   gene            483391..484692
FT                   /locus_tag="Lbys_0455"
FT   CDS_pept        483391..484692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4410 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Neutral/alkaline
FT                   non-lysosomal ceramidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16230"
FT                   /db_xref="InterPro:IPR031329"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR1"
FT                   /protein_id="ADQ16230.1"
FT                   /translation="MRKFIKFVLVFFVVILVLLLALVQWIPRTPYEQTEHFKEWRNMDL
FT                   DFEQIDSTYEVGWAKENITPDFSVPLAGFGKRKGRHFESVHDSIYVRAFAIRSGKRIIH
FT                   LVSADLLFIPPKVVEKLVAKGVDLRNVHLAATHSHSSIGGWESSITGMLFGGKYDQRVV
FT                   DFLADKFYFAIQQSTLNLSPGEITYGEVIDDEDVRFRMNSDDGVRDREIRGLSFIKDTG
FT                   ERAHLVTYSAHNTTLGDRNSQLSRDYSGVLVDSLLPDFGAYMAGAVAGMGPVEVGDTEF
FT                   DEAKHQGAGVYKHFQKRTEKKVGAGLVSEWIKIPLPKPVARLSKHWGLRPWVFRWAFGD
FT                   YDAYVKVTRLGSTLLLGMPADFSGEIMVELDEYATAKGLDLIITSFNGGYIGYITHDKR
FT                   YDSGHYETVTMSWYGYQSGGYFTQISKDIIDRLK"
FT   sig_peptide     483391..483492
FT                   /locus_tag="Lbys_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            484689..485228
FT                   /locus_tag="Lbys_0456"
FT   CDS_pept        484689..485228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0456"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0431 flavoprotein; InterPro IPR005025;
FT                   KEGG: scl:sce1514 hypothetical protein; PFAM:
FT                   NADPH-dependent FMN reductase; SPTR: Putative
FT                   uncharacterized protein; PFAM: NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16231"
FT                   /db_xref="GOA:E4RWR2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR2"
FT                   /protein_id="ADQ16231.1"
FT                   /translation="MKIKIISGSPRQRSLTVRVAKHLLKRLKEEKVDVELIDLREHQIP
FT                   FVETVWSTLDKVPSEFKELGEKIFSADAFILVSPEYNGGYSPALKNLLDHFPKQSRKVF
FT                   GIATATDGALGAMRSAQQLIQMVAAFFGILSPQLLITPHVDKKFDEEGNLTDDSFQKAI
FT                   DTFVSEFLWLAKKIKD"
FT   gene            485276..486409
FT                   /locus_tag="Lbys_0457"
FT   CDS_pept        485276..486409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zpr:ZPR_2896 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF3472)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16232"
FT                   /db_xref="InterPro:IPR021862"
FT                   /db_xref="InterPro:IPR031712"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR3"
FT                   /protein_id="ADQ16232.1"
FT                   /translation="MIPIEGNTWGKSPEVEIDHRGIKQWKDGRGELYFFSKEQGQAEII
FT                   FYSKGPVDIQVSFQGATKHLKFSGEQSLGVFPIDQVGYHSLVMEGNAESLQGVEVKGIE
FT                   TTFVKDEFYWGRRGPSVHFTYSMPEENVEWLYNEVTVPEGEDVIGSYFMANGFAEGYFG
FT                   IQVNSEEERRILFSVWSPYQTDDPNAIPEDQRITLLKKGKGVYTGEFGNEGSGGQSFKK
FT                   HMWKAGLTYSFLTRIRPSEVTGSTEYTSYFKDAETGKWELIASFRRPKTSTYAKRFHSF
FT                   LENFITETGDQPRKVLFGNTWVRTVNGEWRELTRARFTADATARKGNRLDYTGGAEGPY
FT                   FYLKNCGFFYAPVELNTVFDREASGKIPQIIMEDLER"
FT   gene            486501..487208
FT                   /locus_tag="Lbys_0458"
FT   CDS_pept        486501..487208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0458"
FT                   /product="peptidase membrane zinc metallopeptidase"
FT                   /note="COGs: COG2738 Zn-dependent protease; InterPro
FT                   IPR007395; KEGG: chu:CHU_3831 hypothetical protein; PFAM:
FT                   peptidase membrane zinc metallopeptidase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Putative neutral zinc
FT                   metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16233"
FT                   /db_xref="GOA:E4RWR4"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR4"
FT                   /protein_id="ADQ16233.1"
FT                   /translation="MGGLILIGVVFMIIGSLVSSRLKSKFAQYSQIGLSNGLSGEAIAR
FT                   KMLEDNGIYDVKITQVDGQLTDHYNPLDKTVNLSADVYHGRSAAAAAVAAHEVGHAVQH
FT                   AQAYAALKFRSAMVPAVNIASRVMGMANMFLMFGGVALLSQNNPMGNTLLLVLIAANVA
FT                   LALFALVTLPVEFDASKRALNWMETRNVVSQREHGMAKDALKWAAMTYVVGAAAAMANL
FT                   LYFVMIFLGRRDD"
FT   sig_peptide     486501..486581
FT                   /locus_tag="Lbys_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(487233..488099)
FT                   /locus_tag="Lbys_0459"
FT   CDS_pept        complement(487233..488099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0459"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: cpi:Cpin_1584 protein of
FT                   unknown function DUF6 transmembrane; PFAM: protein of
FT                   unknown function DUF6 transmembrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: EamA-like transporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16234"
FT                   /db_xref="GOA:E4RWR5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR5"
FT                   /protein_id="ADQ16234.1"
FT                   /translation="MNYRFFLLGILFAALWASASAAAKIALPYIEPLAMFQVRFFLAGV
FT                   LLIAYSLIITKDRFPKGKEWVQLIIFGGLNTTLYLSLFVLSLREISAGIGSLATSTNTL
FT                   IISALSTVFLGQSLKSKQWMALLLGFAGVGLACYPLWENHQATPRGLFLIFLSMLSYSV
FT                   GTLYYSKIKWNLSRITINGWQVFLGGVLMFPLTWYFHVDGANQWNSIVWTSILWLIFPV
FT                   SIGAVQLWLYLLKQDTVRASFFLFLCPIFGFIYANILLQEPLTWYTWTGTAMVLAGLYM
FT                   GIEKKPR"
FT   sig_peptide     complement(488037..488099)
FT                   /locus_tag="Lbys_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(488089..488874)
FT                   /locus_tag="Lbys_0460"
FT   CDS_pept        complement(488089..488874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0460"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="COGs: COG0084 Mg-dependent DNase; InterPro
FT                   IPR012278:IPR001130; KEGG: sli:Slin_2234 hydrolase, TatD
FT                   family; PFAM: TatD-related deoxyribonuclease; SPTR:
FT                   Hydrolase, TatD family; PFAM: TatD related DNase; TIGRFAM:
FT                   hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16235"
FT                   /db_xref="GOA:E4RWR6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR6"
FT                   /protein_id="ADQ16235.1"
FT                   /translation="MIETHAHIYDESFDEDRALIVSRAKELGIQEIWMPNCSSETLKAL
FT                   YASEEQFPDACRPMMGLHPAYVNETYVEELKTAAAELEKREFIMIGEIGLDFYWDLTFV
FT                   KEQEEAFMTQLEWAKKYNLPICIHSRNSKDNSWNAILRCCELIEEFNWPQLRGIFHCFS
FT                   GNLEEAQRVIGLNFLLGIGGVATFKNGGIDKWLGEIDLKHLVLETDAPYLAPVPFRGKR
FT                   NEPSYLQLVVKKLSEIYACSEDIIKAQTTENAKKLINEL"
FT   gene            489169..490515
FT                   /locus_tag="Lbys_0461"
FT   CDS_pept        489169..490515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0461"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: sli:Slin_1003 oxidoreductase
FT                   domain protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Oxidoreductase domain protein; PFAM: Oxidoreductase family,
FT                   NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16236"
FT                   /db_xref="GOA:E4RWR7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR7"
FT                   /protein_id="ADQ16236.1"
FT                   /translation="MNRRNFIQTTVAGSTLPFIGNAMHNDKPKQDKVRLGFIGVGLRGR
FT                   NHLTVAINSDDVEVVAICDIDPDAIAKSQSMIKKAGRKEAVAYSKNEVDYKNLLKRDDI
FT                   DGVVISTPWELHVPMSVDAMKAGKYTAVEVSATVTLQESWDLVDTFEATGSHCMILENV
FT                   CYRRDVMAVLNMIRKGLFGDIQYGHCGYQHDLREVKFNDGKQAYGGGVEFGEKGFSEAK
FT                   WRTQHSIDRNGDLYPTHGLGPVAHWMNINRGNKFNFLTSMATSSKGLHKYIVDKGGQDH
FT                   PNAKVKFKLGDIVTTNIQCENGENIVIIHDTNLPRPYSLGFRAQGTEGIWMDDNKSIYL
FT                   EGKSPAHRWEPFEKYQKEYDHPLWKKFEENAKNAGHGGIDYFVMRAFIESIKRRVAPPM
FT                   DVYDAAAWSAISPLSELSIARGSSPVEIPDFTRGKWKTNKPIFGLNDAY"
FT   sig_peptide     489169..489240
FT                   /locus_tag="Lbys_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            490502..491002
FT                   /locus_tag="Lbys_0462"
FT   CDS_pept        490502..491002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0462"
FT                   /product="Phosphinothricin acetyltransferase"
FT                   /note="COGs: COG1247 Sortase and related acyltransferase;
FT                   InterPro IPR000182; KEGG: gct:GC56T3_0584 phosphinothricin
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   PRIAM: Phosphinothricin acetyltransferase; SPTR:
FT                   Phosphinothricin acetyltransferase; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16237"
FT                   /db_xref="GOA:E4RWR8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR8"
FT                   /protein_id="ADQ16237.1"
FT                   /translation="MMPINYRTADIKDLAGIVEIYNSTIPSRLVTAHLEPVSVESRVDW
FT                   FRSHTPEKYPLWVIESEGKMLGWLGFQPFHPRPAYAPTAEISLYLAPSARGKGLGYQSL
FT                   QFALEKAPEFGIQTLIGLIFAHNEPSIRLFEKAGFEEWGYLPRIAHMDGIRRGLKYFGK
FT                   ELI"
FT   gene            complement(490994..491581)
FT                   /locus_tag="Lbys_0463"
FT   CDS_pept        complement(490994..491581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4376 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16238"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWR9"
FT                   /protein_id="ADQ16238.1"
FT                   /translation="MNLERRSANVLLIFSRHMKKSILLASLLFLQCTKENNPIDRELHY
FT                   FDTRGVIENTISKLSQEKPKVVKLWKYGRAEEKRMVEDMDWEKELKLFLDADINKSSFI
FT                   GSYDSTRAGQMITYSLKSNENLPVKILSVSQDSTDLEIHAIRTSENYFFTTYGDLLLRI
FT                   KDEKLDSYNIHTVQKLLWFDADTTVVSGKVLY"
FT   gene            491732..492976
FT                   /locus_tag="Lbys_0464"
FT   CDS_pept        491732..492976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0464"
FT                   /product="Uncharacterized protein family UPF0324"
FT                   /note="COGs: COG2855 membrane protein; InterPro IPR018383;
FT                   KEGG: phe:Phep_2085 hypothetical protein; PFAM:
FT                   Uncharacterised protein family UPF0324; SPTR: PSE family
FT                   sulfate exporter; PFAM: Conserved hypothetical protein 698;
FT                   TIGRFAM: conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16239"
FT                   /db_xref="GOA:E4RWS0"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS0"
FT                   /protein_id="ADQ16239.1"
FT                   /translation="MKENRLRFSEDWVVVIAGFILIFAILFGLKVDSPTYKWASWSELV
FT                   GKVLSAGNLVKMVWQCLQVTVVGIVAMILLGKPWRSFVQGFILIFVLSVLAQVMAGNAL
FT                   VQEYNLEAVIFSLLIGLVINNFFGVPQILRDSMQSELFVKIGLVMLGTTIIFGDILKAG
FT                   ALGLVQALVVVLSVWYFAFWLCKRMKIDKEMSLMISSAVSICGVSAAIATSGAIKGDGK
FT                   KLSYVISLVLITAVPMMIFMPYIAEYFNLSQAVTGAWLGGSIDTTGAVVASGSLVGEEA
FT                   LEISTIIKFSQNVLLGLAAFAISVYWSVTQAKEKEERPTLGVIWDRFPKFVIGFLAASL
FT                   LFSFVLSPESVASYKGGIKSLQGVWFSLAFVSIGLETNFKQLFAQENKKPLVAFLGAQT
FT                   FNVIITLIMALILFS"
FT   sig_peptide     491732..491803
FT                   /locus_tag="Lbys_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            493465..497252
FT                   /pseudo
FT                   /locus_tag="Lbys_0465"
FT   gene            complement(497217..498608)
FT                   /locus_tag="Lbys_0466"
FT   CDS_pept        complement(497217..498608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_4875 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16240"
FT                   /db_xref="GOA:E4RWS1"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS1"
FT                   /protein_id="ADQ16240.1"
FT                   /translation="MLTFFRIYSVFQILSILAIVVALRVLFFQVPLLYNELEWMLVGRK
FT                   LNENLFLYNEVLTQVAPLSSYFYQLVDATFGQNQWAYQGIASALIYVQALIFNFMINKR
FT                   NLFNEKNYIGALMYVILTSISFDLMKLSPALLANTFVLLGTNAVLAQIEKRDSVGDDVF
FT                   EAGIFFGLAVLFHHPTFVFIVWALLVLFLYTGINIRQAFMVTLAFILPVLFMYIFFYIN
FT                   DKGADFTEVWLFNFNSFVRLTLLNIRDILIVYTLPVILSLVGVLKVITGQRYNSFQNRS
FT                   HQSLIILGIFALIAFLISGKYLPSNLVYFIIPLAFYGAGFFVHAKKLFILETLFLSFFG
FT                   LLIFISYIGAKNILGVSSDLLQDYRVKEVNTQFPGKRIYITGRNIDAYQYNAMATGYLS
FT                   WNLARKDFENPSNYLSLANIYNNFSKDMPEIIIDEEGVMPEVFRHIPSLQKQYLFKGSG
FT                   IYELR"
FT   sig_peptide     complement(498543..498608)
FT                   /locus_tag="Lbys_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            498723..499097
FT                   /locus_tag="Lbys_0467"
FT   CDS_pept        498723..499097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0467"
FT                   /product="ribosome-binding factor A"
FT                   /note="COGs: COG0858 Ribosome-binding factor A; InterPro
FT                   IPR000238; KEGG: dfe:Dfer_4876 ribosome-binding factor A;
FT                   PFAM: ribosome-binding factor A; SPTR: Ribosome-binding
FT                   factor A; TIGRFAM: ribosome-binding factor A; PFAM:
FT                   Ribosome-binding factor A; TIGRFAM: ribosome-binding factor
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16241"
FT                   /db_xref="GOA:E4RWS2"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS2"
FT                   /protein_id="ADQ16241.1"
FT                   /translation="MESKRQKQVARLIQKDLGEIFQREFRSLFAGNFVTITDVKVSPDL
FT                   SVAKVYLSFLKNHNRESLLEEIKEQTKKIRGMFGMKAGKQLRIIPHFSFFIDDTAEYAQ
FT                   KIEELFANIHIPPAEEEEDS"
FT   gene            499094..500308
FT                   /locus_tag="Lbys_0468"
FT   CDS_pept        499094..500308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0468"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG4591 ABC-type transport system involved in
FT                   lipoprotein release permease component; InterPro IPR003838;
FT                   KEGG: dfe:Dfer_4877 protein of unknown function DUF214;
FT                   PFAM: protein of unknown function DUF214; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16242"
FT                   /db_xref="GOA:E4RWS3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS3"
FT                   /protein_id="ADQ16242.1"
FT                   /translation="MNLSFFIAKKYFLSKKKRSFIHFISLISMLGVGIGLAALIIILSV
FT                   FNGLEDLNREIFKSFDPDLKISAKTSKSFHPDADFLQRIRSTEGVAYCTEVYQDKALAK
FT                   NQRAQTIVDIKGVDTTFALNKDFQKALVGGEMKVYVGPRAAAFIGAGVYNTLELTVNDF
FT                   FKPIELLYPKNEKLNALNPESNVNRVSLEISGVFLLEQHYDNFVYLPIEVMEDLNEQVG
FT                   RRTSLEINIQQGKDVQRIKAALKKFLPENLQIQDRDEQNASLLRAIRIEKLFIFIALIF
FT                   VVGIAAFNIFYGLSMLVLDKKDDIATLSAMGANPQLIKKIFYVEGFIISGVGVLLGLVL
FT                   GLGTCFLQMQYGFIGLGMDHAITEAYPVRIMLADIVGSVAGIILITFLASLIPANKAAS
FT                   FMLKS"
FT   gene            500305..502758
FT                   /locus_tag="Lbys_0469"
FT   CDS_pept        500305..502758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0469"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="COGs: COG0308 Aminopeptidase N; InterPro IPR014782;
FT                   KEGG: dfe:Dfer_4878 peptidase M1 membrane alanine
FT                   aminopeptidase; PFAM: Peptidase M1 membrane alanine
FT                   aminopeptidase; SPTR: Peptidase M1 membrane alanine
FT                   aminopeptidase; PFAM: Peptidase family M1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16243"
FT                   /db_xref="GOA:E4RWS4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS4"
FT                   /protein_id="ADQ16243.1"
FT                   /translation="MKKLFLFLFVPILSFAQQRESQEILFNLLHTELHLEPRWEDQTLK
FT                   GKAILTLKPHFYAQSTLILDAKEMQVKAVKHGNNALTFRNDGRKLSISLGKTYTPKDTL
FT                   KIIIDYVAQPEKIKPIPGEENKSEKGLYFINPLGKVKGLPTQLWTQGETQCNSGWFPTI
FT                   DAPNQKHTQDIFLKVDKKYTTLSNGVLVSSTDAGNGYRIDHWKQKLPHSVYLTMIAVGD
FT                   FVKVVDPNFKRFEVSYYLEPEYAPHALKIFGRTPSMIEFFEKILGVPYPWEKYAQIPIR
FT                   KFISGAMENTTATTHAISVMKNPNQLVDANDDAVIAHELFHHWFGDLVTCESWGHLPLN
FT                   EAFANYSEFLWATHYYGKDEGDYTYLMDLHSYLSESQSKKESLIRHHYGNSEEMFDAHS
FT                   YQKGGRILHTLREEIGDDAFFASLNKYLTQHAFQTVEVEDLRIAFEKTTGRDLKWFFDQ
FT                   WFKSPGHPQVVITHQKDTKQLRLKVDQIPDSTGLAYFRVRLPVRVFSGSSVKDTVLHLD
FT                   APSNTYDIPLQGELVNFIPNPSGYFPGIVKDDRGLSHWIHQYDNSKEMFARLYALESVG
FT                   IVQENPLESEEIRKVYMRALNDSFWRIRQVAVNAFNDYDGDDFLAIEKVLEDKIQNDPS
FT                   SNVRAEAFLSVRNFQNPKHLEMARAALKDTSYAVQASALELLFNADVEDGMEIAKAYEN
FT                   VHDGGIFGVLASYYIGKQKEGVGEWLLQRLSLMEGLELYQYVGLLASHLVSAGEEEMNK
FT                   ALPFLEEVALNEPVWYARMNAVRVLMTIKDLSPKAASLLEKVLKEETDENLVPIYKQFN
FT                   VEGQN"
FT   sig_peptide     500305..500352
FT                   /locus_tag="Lbys_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            502739..503752
FT                   /locus_tag="Lbys_0470"
FT   CDS_pept        502739..503752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0470"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197; KEGG: sli:Slin_0240 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SPTR: Radical SAM domain
FT                   protein, putative; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16244"
FT                   /db_xref="GOA:E4RWS5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS5"
FT                   /protein_id="ADQ16244.1"
FT                   /translation="MWRDKINFLSKLTPKRVSNALGLVSSFAMSRWNKSAQAKYLPVAL
FT                   AVEPTTSCNLRCPECPSGLRSFTRPTGMLRKDMFEKLMDEIGDTLMYLTFYFQGEPYLH
FT                   KDFLGMVEKATKKGIYTSTSTNAHYLHYDNALATVKSGLDRLIISIDGTTQDVYTQYRV
FT                   GGNLNKVLEGTKNIIRAKKELNSRTPHVIFQFLVVKPNEHQMAEVKALAKDLGVDELRF
FT                   KTAQIYDYENGSELIPENDRFSRYQRVGEGKWAIKNKLIDHCWKMWHSAVVTWDGIVVP
FT                   CCFDKDAEYRMGNVSEKSFNEVWFSSTYTKFRAQLIKGRKHIEMCKNCTEGTKIWG"
FT   sig_peptide     502739..502852
FT                   /locus_tag="Lbys_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(503830..506151)
FT                   /locus_tag="Lbys_0471"
FT   CDS_pept        complement(503830..506151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0471"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG0514 Superfamily II DNA helicase;
FT                   InterProIPR002121:IPR014021:IPR001650:IPR011545:IPR
FT                   018982:IPR014001:IPR006293:IPR018329; KEGG: dfe:Dfer_3602
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; DEAD/DEAH box helicase domain protein; RQC domain;
FT                   HRDC domain protein; SMART: DEAD-like helicase; helicase
FT                   domain protein; HRDC domain protein; SPTR: ATP-dependent
FT                   DNA helicase RecQ; TIGRFAM: ATP-dependent DNA helicase
FT                   RecQ; ATP-dependent DNA helicase, RecQ family; PFAM:
FT                   Helicase conserved C-terminal domain; RQC domain; HRDC
FT                   domain; DEAD/DEAH box helicase; TIGRFAM: ATP-dependent DNA
FT                   helicase RecQ; ATP-dependent DNA helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16245"
FT                   /db_xref="GOA:E4RWS6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS6"
FT                   /protein_id="ADQ16245.1"
FT                   /translation="MISESVEQRLKQNLKEIFGFDNFRGEQEKIIKSVISGKNTFVIMP
FT                   TGAGKSLCYQLPATVLEGTAIVISPLIALMKNQVDQLTAYGINAQFLNSTLNKSEMNRV
FT                   KNDVISGVCKLLYIAPESLTKEDNLEFLKKAKISFVAVDEAHCISEWGHDFRPEYRKIK
FT                   DIIENIDTALPIVALTATATPKVQLDIKKSLNMDDSVIFKTSFNRANLYYEVRPKQNAK
FT                   KQLIKFVSQNRGKSGIVYCLSRKKVEEIAELLNVNGFKALPYHAGLDPEVRMKNQDAFL
FT                   NENCDIVVATIAFGMGIDKPDVRFVVHYDAPKSLEGYYQETGRAGRDGIDGTCLMFYAL
FT                   DDITKLEKFNKDKNVTERDNAKALLMEMVAYSSLGVCRRRQLLSYFGEQMEKDCGFCDN
FT                   CKKPTKTFKGKEEVELVIKTILKTEQRFSANHIADILTGNTKDNPAILSYEHNKLEMFG
FT                   KGLKYFNLEDKFEEEEEEDDEDTILVNKKPKADINADGRISASDKWVSIIRQLMVFGYL
FT                   EKDIDNYGVVKVSQKGMNYLNDPYSITFHEDHDLDETEGSGEDDLQQTPGSASGSGAAD
FT                   QALLELLKSLRKKIAKEKNVPPYVVFQDPSLEEMATTYPSNANELAQVNGVGMGKVQKF
FT                   GKPFLDLINKYVEDNEIETTHDLMVKTTVNKSKTKIFIIQQIDRKIDLEDIAEAKEMSA
FT                   EEIISEIESICFSGTKLNLDYYINQIIDKEKQQDIYEYFMTSSSDDIRAALKEFEDYEE
FT                   EVTEEELRLMRIKFISEMAN"
FT   gene            506304..507278
FT                   /locus_tag="Lbys_0472"
FT   CDS_pept        506304..507278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0472"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR000644:IPR001347:IPR004800;
FT                   KEGG: dfe:Dfer_3603 KpsF/GutQ family protein; PFAM: sugar
FT                   isomerase (SIS); CBS domain containing protein; PRIAM:
FT                   Arabinose-5-phosphate isomerase; SMART: CBS domain
FT                   containing protein; SPTR: KpsF/GutQ family protein;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain; SIS
FT                   domain; TIGRFAM: KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16246"
FT                   /db_xref="GOA:E4RWS7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS7"
FT                   /protein_id="ADQ16246.1"
FT                   /translation="METKVEKNIIDTAKKVLADESEAIKSLISTIGSEFEEVVNLILNS
FT                   RGKVVLSGIGKSAIIAQKISATLNSTGQKAVFMHATDAVHGDLGIIDDEDVIVILSKSG
FT                   NTPELKVLIPLIRRLPNKLVGMVSDLDSFLARNSDYVLNAHVNREACPMNLAPTTSTTV
FT                   SLALGDALAVCLLEARGFTKRDFAKYHPGGSLGKKLYLKVSDIYPNNEVPIVKEEAGME
FT                   EVILEMTSKRLGTTAVINEEGHLTGIITDGDLRRKLREKVDVFSLKALDLMSRNPKVIR
FT                   KDDFAVNALNLMQELSITQLVVAENQKVLGFVHLHDLLREGLV"
FT   gene            507290..508894
FT                   /locus_tag="Lbys_0473"
FT   CDS_pept        507290..508894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0473"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COGs: COG0029 Aspartate oxidase; InterPro
FT                   IPR003953:IPR004112:IPR005288:IPR013027; KEGG:
FT                   phe:Phep_0012 L-aspartate oxidase; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; SPTR: L-aspartate oxidase; TIGRFAM: L-aspartate
FT                   oxidase; PFAM: domain; FAD binding domain; TIGRFAM:
FT                   L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16247"
FT                   /db_xref="GOA:E4RWS8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS8"
FT                   /protein_id="ADQ16247.1"
FT                   /translation="MRTVDFLVIGSGIAGLSFALKAAKKGKVLILTKVNADETNTKYAQ
FT                   GGIASVFDPATDSFDKHIQDTLIAGDGLCDREIVEIVVSEGPDRIRELIDYGTNFDKME
FT                   TGEYNLTREGGHSENRILHYKDITGWEIERALLEEVAKHENIEILTHYFAVEVITQHHL
FT                   GEKTNGNAECYGVYALNVNTMEVEKILSKVTVMASGGAGQIYSSTTNPIIATGDGIAMV
FT                   YRAGGEVRDMEMIQFHPTSLYNPGTFPSFLITEAVRGEGGVLRDKFGREFMYDYDERGS
FT                   LAPRDIVARSIDAEMKKSGEEHVWLDITHKPKEFILQHFPNIYEKCLSIGIDISKDYIP
FT                   VTPAAHYLCGGIKVDEFGRTTIKNLYACGECSSTGLHGANRLASNSLLEAAVFAHRIAG
FT                   SALEIVDQLDFETKVPEWNEFGAVQSNEEILVSHNTRELQKMMSDYVGIVRSDFRLDRA
FT                   ETRMKMLRDETEEFYRKTKLSVKLCELRNLILCAQMVIQSAKKRKESRGLHYNTDYPYK
FT                   LGGKPENTVLGRHLSAS"
FT   sig_peptide     507290..507355
FT                   /locus_tag="Lbys_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            508978..509202
FT                   /locus_tag="Lbys_0474"
FT   CDS_pept        508978..509202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_6388 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: PspC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16248"
FT                   /db_xref="GOA:E4RWS9"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWS9"
FT                   /protein_id="ADQ16248.1"
FT                   /translation="MDKLKFLLESNMFGVCSKIGQKLNFSASSIRKYFIYASFFTLGSP
FT                   VIIYLVLAFWMEIRKTIRNANHPSVWELE"
FT   gene            complement(509203..510411)
FT                   /locus_tag="Lbys_0475"
FT   CDS_pept        complement(509203..510411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0475"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR001135; KEGG: dfe:Dfer_3733 NADH
FT                   dehydrogenase (quinone); PFAM: NADH-ubiquinone
FT                   oxidoreductase chain 49kDa; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH dehydrogenase (Quinone); PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16249"
FT                   /db_xref="GOA:E4RWT0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT0"
FT                   /protein_id="ADQ16249.1"
FT                   /translation="MQKIQYKYKTEYLTESEPLKFKEEDLAEEEMILNVGPQHPSTHGV
FT                   LRLEVKTDGELIKEVVPHLGYLHRCFEKHAESLPFPQVIPFVDRLDYLASMNSEHAYVM
FT                   GVEKMLDLQMPQRVEYIRVLVAELNRIASHFLAIGSYALDIGAQTPFLWLFRDRETILR
FT                   MLEWVSGGRLLYNYIWIGGLFYDLPVGFEEKCKEFTAYVRPKLVELQQIIIDNHLFINR
FT                   TAGVGVLPLDLAINYGCTGPVLRGSGLRYDLRKVDGYSVYPELDFDIPVGEGKMGKVGD
FT                   SWDRNYVRLLECFESLKIIDQCLEKLLKEHKRTRDFDPQALVPKKIRPKAMDFYVRAEN
FT                   PKGELGFFFRTDGKSDTPLRVKCRACSFHNLSVLPALSKNILMADLIAIVGSLDLVMGE
FT                   VDR"
FT   gene            510441..511004
FT                   /locus_tag="Lbys_0476"
FT   CDS_pept        510441..511004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_3066 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16250"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT1"
FT                   /protein_id="ADQ16250.1"
FT                   /translation="MHEIEPFYNWNKYYQPYKDRKGPFYGKEQAEYYENAVYGYVIHPD
FT                   WDFIGSETLYIKVLMVNYSLKYAVIELMGEWNDTLHNDVMYLKRTVVDKLVKAGIQHFI
FT                   LIGENLFQFHGGEDDYYEEWFEDVESGWIALLNIRKFVMEELEKYKLDYYLHFGGTLQM
FT                   ENWRTLKPDVFFGLVDSLIQRRLN"
FT   gene            511009..511821
FT                   /locus_tag="Lbys_0477"
FT   CDS_pept        511009..511821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0477"
FT                   /product="Serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="COGs: COG1045 Serine acetyltransferase; InterPro
FT                   IPR001451; KEGG: phe:Phep_2363 serine O-acetyltransferase;
FT                   PRIAM: Serine O-acetyltransferase; SPTR: Serine
FT                   O-acetyltransferase; PFAM: Bacterial transferase
FT                   hexapeptide (three repeats); TIGRFAM: serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16251"
FT                   /db_xref="GOA:E4RWT2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT2"
FT                   /protein_id="ADQ16251.1"
FT                   /translation="MDKKFIEFLYNKHQNVPDIPPSKDITAWALRVFDLLFPERSKDFF
FT                   RSADEVEGEFWNIGNDLKAILNATAECRNCGSEEKSRAFVDGIPELYRILSTDLDAILK
FT                   GDPAAKSMYEVIRVYPGFFAIFFYRVAHALHQLEIGFIPRILTEYAHSRTGIDIHPGAK
FT                   IGEHFYIDHGTGVVIGETTFIGKNVKIYQGVTLGALFVEKSLENTKRHPTVEDDVIIYA
FT                   GATILGGNTVIGAGSIIGGNVWLTKSVPAGSTVYHKPEIQVISNETTI"
FT   gene            511824..512570
FT                   /locus_tag="Lbys_0478"
FT   CDS_pept        511824..512570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0478"
FT                   /product="Methyltransferase type 12"
FT                   /note="InterPro IPR013217; KEGG: dfe:Dfer_3413
FT                   methyltransferase type 12; PFAM: Methyltransferase type 12;
FT                   SPTR: Methyltransferase type 12; manually curated; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16252"
FT                   /db_xref="GOA:E4RWT3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT3"
FT                   /protein_id="ADQ16252.1"
FT                   /translation="MFINYQEYQAMYEVEDSLWWYRILHDRVVEELKALPHFTQLKILD
FT                   AGCGTGGLMSRLLKEGVQDIQGFDFNEHAVAFSGDRGLNVQQGDITRFSLGQFDVVISN
FT                   DVLYQMDDEGLEQAFYRLYAALKPGGILITNNQAFPVFRGIHDLAVGSKRRFVLKDFEK
FT                   LLEKYPDLKLEKATYWSLFLSPFILIARTIQRIQLKLNLVKEVKSDVSLPSPWLNQFFY
FT                   TLCTWERKILKASPFGSSLFLRIRKA"
FT   gene            512631..514130
FT                   /locus_tag="Lbys_0479"
FT   CDS_pept        512631..514130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0479"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase; InterPro
FT                   IPR001412:IPR020058:IPR004527:IPR020060; KEGG:
FT                   sli:Slin_4891 glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; SPTR: Glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: tRNA synthetases class I (E
FT                   and Q), catalytic domain; TIGRFAM: glutamyl-tRNA
FT                   synthetase, bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16253"
FT                   /db_xref="GOA:E4RWT4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT4"
FT                   /protein_id="ADQ16253.1"
FT                   /translation="MSVRVRFAPSPTGPLHIGGVRTALYNYLFARKMGGKMLLRIEDTD
FT                   QTRFVPGATDYIQEALQWLGIEIDEGVGVGGDAGPYVQSERKDIYAKYAQQLLDEGKAY
FT                   YAFDTPEELDQMRKELEAAKVDNISYNAFTRMKMKNSITLPAEEVEERISSGQPYVIRL
FT                   KVPLKDEVRFKDLVRGWVSVHSSTIDDKVLMKSDGMPTYHLANIVDDHMMGITHVIRGE
FT                   EWLPSAPLHILLYKAFGWQAPEFAHLPLLLKPEGNGKLSKRDGLLGDFPVFPLEWKDPN
FT                   TAEISRGFREDGYYPEAVMNFLALLGWNPGNDQEILSKEELISLFDIHNIQKAGARFDV
FT                   QKAKWFNQQYLRKKDNAVLADELKASLPQPEWAEKIVALMKDRVDFVKEMTQGVTFLFA
FT                   SPDTYEEEVAAKKWDDLAKQAMPVIISTLEGVSNFQSQDLHDALFSGLEAASIKPGKVM
FT                   QALRLAVTGQGKGPDLMLIMEIIGKEETLKRLNKALDVLGR"
FT   gene            complement(514262..516718)
FT                   /locus_tag="Lbys_0480"
FT   CDS_pept        complement(514262..516718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0480"
FT                   /product="Dipeptidyl-peptidase IV"
FT                   /EC_number="3.4.14.5"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; InterPro IPR002469;
FT                   KEGG: bvu:BVU_1818 dipeptidyl peptidase IV; PFAM: peptidase
FT                   S9B dipeptidylpeptidase IV domain protein; PRIAM:
FT                   Dipeptidyl-peptidase IV; SPTR: Peptidase S9, prolyl
FT                   oligopeptidase active site domain protein; PFAM: Prolyl
FT                   oligopeptidase family; Dipeptidyl peptidase IV (DPP IV)
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16254"
FT                   /db_xref="GOA:E4RWT5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT5"
FT                   /protein_id="ADQ16254.1"
FT                   /translation="MRKTLTLILLSSALTWAQKPNYEQAAKFSPTKLRTLIFSTEVRPS
FT                   WINHSDKFWYEYQTSSGKKWYLVDPNAKTKQPLFDNSDLARQITRIVKNPFDAQHLPIE
FT                   NLEFTEDERSIRFEVKSTKDTIKSKEELAKLKNKADSLKKKTFYLEYDLLTKQVKEINE
FT                   SLKVKPRPTWASYSPDTMKIFFAKNYNLYWMDRANFEKAIKDENDSTIVEHQITKDGVQ
FT                   YYAWGGDQYSTTTGGDEKEESKRKNVWISWSPDAKYFVLTRKDNRHLNPMWVINNVGGK
FT                   RPTLETYKYQMPGETDSTEVELHLFNAETLTSKKIHVNAFKNQTVSIYTKNRDKSSYKG
FT                   KLYINYWLGDEKEFYISRSSRDLKRIDIVAVGVDGSVRNVVSERSNVYLDIKKPYFVNN
FT                   NTQFIHWSQRDGWGHFYLYQKDGTLIRQLTQGDYNTEDVTGYDPKTQTYTFTANGKETG
FT                   EDPYYLHHYAQSLLGGEPKLLNKGNFDHQIMTSESGKYFVNNSSRVNTIPISDLYDNKG
FT                   NLILKLEEADLSLLFAAGYKFPEPFKVKAGDGITDLYGVMYKPFDFDSTKTYPIIEYVY
FT                   PGPQTEAVNKSFGRSMDRVDRLAQMGFIVITVGNRGGHPARSKWYHTYGYGNLRDYGLE
FT                   DKKVTVEQLAARHKYIDINKVGITGHSGGGFMSTAAMLVYPDFFKVAVSAAGNHENNIY
FT                   NRWWSERHHGVTEKVSAKGDTTFSYAIEKNTELAKNLKGKLLLATGDIDNNVHPANTIR
FT                   MADALIKANKRFDIVLLPGQRHAFGNMTEYFFWKMADYFSEHLLGISKRDEVDIVEINK
FT                   EIPLKR"
FT   sig_peptide     complement(516668..516718)
FT                   /locus_tag="Lbys_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(517198..517614)
FT                   /locus_tag="Lbys_0481"
FT   CDS_pept        complement(517198..517614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0481"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001387; KEGG: fjo:Fjoh_4999 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16255"
FT                   /db_xref="GOA:E4RWT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT6"
FT                   /protein_id="ADQ16255.1"
FT                   /translation="MEPKIHEGKNVKRFREMLGIKQEALAQELGEDWTQKKVSLMEQKA
FT                   VLEPEVLYKVSKALNIPDMAIKNFDEEKAITIIANTVNNNDHATGNSLFNYQPIFNPID
FT                   KIVQLHEEKIQLYERMLREKEDMINKLEKLLPQN"
FT   gene            complement(517761..517982)
FT                   /locus_tag="Lbys_0482"
FT   CDS_pept        complement(517761..517982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT_4753 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16256"
FT                   /db_xref="GOA:E4RWT7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT7"
FT                   /protein_id="ADQ16256.1"
FT                   /translation="MTKKKTPFGKYLESKSINQAALARTTGIRPNRISEFATQDCLKMR
FT                   ADEIYLLAKALGERPGTLLDYLLAEIKS"
FT   gene            518030..518254
FT                   /locus_tag="Lbys_0483"
FT   CDS_pept        518030..518254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF1804 hypothetical protein; SPTR:
FT                   S-adenosylmethionine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16257"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT8"
FT                   /protein_id="ADQ16257.1"
FT                   /translation="MLGVLKNVMFIAKKDNIVFMRLVLPQPEYYKIALLNLLKLLQLKG
FT                   IPKESIEDVKRVYELLEILDANINEQNIS"
FT   gene            518260..519072
FT                   /locus_tag="Lbys_0484"
FT   CDS_pept        518260..519072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0484"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="InterPro IPR007627:IPR007630:IPR014284; KEGG:
FT                   zpr:ZPR_4420 RNA polymerase ECF-type sigma factor; PFAM:
FT                   sigma-70 region 4 domain protein; sigma-70 region 2 domain
FT                   protein; SPTR: RNA polymerase ECF-type sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16258"
FT                   /db_xref="GOA:E4RWT9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWT9"
FT                   /protein_id="ADQ16258.1"
FT                   /translation="MNIENINLIKLKNGNEAGLSYFYRRFFPWYTFRAFRYMRDDLDAQ
FT                   CAVQEAFLRLWLNRAQVDSVESMHEFLKRQVQEAAKAFHRKRSNEFRKSMLYYFDYDDP
FT                   DILIGHRAVEEEVTEELQPDASDQEKLDSIHRLLPHLGREQELFIRLCLRFNFNYERIA
FT                   FYLGGIRDYEVANKVNKCIVQLKTLVADSSKLSSASKMETIRVDERLTPEQAEVLKLRY
FT                   ELGASFDDIGQALQMPVSRVREIFIQAFTVFKHGKNHSYSKNTVSYSL"
FT   gene            519023..520111
FT                   /locus_tag="Lbys_0485"
FT   CDS_pept        519023..520111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zpr:ZPR_4419 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: transposase,
FT                   IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16259"
FT                   /db_xref="UniProtKB/TrEMBL:E4RWU0"
FT                   /protein_id="ADQ16259.1"
FT                   /translation="MEKIILTRKIQLVIPCKDREILKSYYDRLYEFQRHTCKAANLIHT
FT                   HLFIQDRWKEMVYLAEDAKISLADHKKKEGGVLNTSRMNSTYRQLSAHFLKVLPSNTMS
FT                   NLNQAVYRTYQANRDLYWRGEKSLPNYRRDIPIPFSSREMRWEEAGDGKNFLLYLFRIP
FT                   FKTYLGRDRSELKSLLKKIVKGEIALRQSALQIKNNKIYLLASVEVEKAKHSLDKTLIA
FT                   EVALSLEYPLVIKIGKDEFQIGSKEEFLYRRLSIQAARRRLQQACAYRSGGKGKEERYK
FT                   CLKHYKEKEKNYIEEKLHLYSRRLIDYCVKAGAGTILLVNQSYKEELAKEDPMLLRNWS
FT                   YYGLKEKIAYKAKMAGIHVLVE"
FT   gene            520370..523528
FT                   /locus_tag="Lbys_0486"
FT   CDS_pept        520370..523528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0486"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="InterPro IPR012910:IPR000531; KEGG: bfs:BF0596
FT                   putative surface membrane protein; PFAM: TonB-dependent
FT                   receptor plug; TonB-dependent receptor; SPTR: Putative
FT                   uncharacterized protein; PFAM: TonB dependent receptor;
FT                   TonB-dependent Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16260"
FT                   /db_xref="GOA:E4RXB5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXB5"
FT                   /protein_id="ADQ16260.1"
FT                   /translation="MKHVYFYRHCLLALPLLLIFGSAWANRNLEGLVKDANGPLPGVSI
FT                   AIKGQLAAAISDADGRFSLQIPDAKVVLVFTSVGYKSKEVEVLPGFNTQLVVELEEDNQ
FT                   QLTELLVVGYGTRNKNEFTGSAVQIKGDAIKEQPVQSFDQALQGRAAGVSIAQPNGVLN
FT                   NPPVIRIRGVNSISLSSYPLIVVDGIPVNTGNVSGDSNVPNNPLGDINPADIESIDILK
FT                   DAASTAIYGSRAAAGVLLITTKRGKEGKAKVSYEGWVGASEAVRLPKLLNAEQFVAIKN
FT                   EAVLNSRILAGQSVENYEQFFADQHPDGTPVDTRWYDYIYRTGVSHHHGLNISGGTAAT
FT                   SYFFSANYSDQKGFLQDNDFRRAGVRFNIDHRVSERLKLRGNFSFNNTFNQSPNSGSLP
FT                   NNAQLIIGAARMSFILPPNVDPYLPDGSWNVTSTGQIGNGKNKIVSAYYNPVALFALSK
FT                   YTSENDRILGNLGATLNLAKGLDLNTTYSIDRLKVENIGFNSSKVGSSSTTTGGNAYQI
FT                   AALRNNWNWTTTLQYDLRRSTSHLGLLAGYDVQKFENSSWGASVTQAADTYFENYQGTW
FT                   GNITPTGNSLEEKAYISYFGRITYDYLDKYFLTLNYRRDGSSPLGANYKFGDFGGASLG
FT                   WLISEEAFFPKGDILSSAKVKASWGRVGNGNINNAYGSLELYGASLYGTVPTWGLAQAG
FT                   NPDLGWETSDQTNVGLEFGLLKNRIQGEVTWFNNDVNGLILSSPQAPSKGIPGDAILAN
FT                   VGSLYNRGLEISLSGDVVKKGKFSWNANLNFTIVKNRVTALAEGNADIIGTTHVAANAF
FT                   NITRVGFSVGSLYGAVVDGVNPENGRQIFINKNGEKVQFTHVAGPGDYRWSYLDGREAP
FT                   AITAADYQILGNALPIFYGGFNHSFSYSSWDAGLNFTFAGGNYIMNGTRATLLDQRYFN
FT                   NSTEILKRWQKPGDITDIPRLVYNDQLSNGNNGPVSTNVEKGDFVRLQNISLGYRVPFT
FT                   LVNRLGANSIRVYAQVSNAFLWTKYSGLDPESSSNSNSNTSPGVELNAIGQARTYTFGI
FT                   NLGL"
FT   sig_peptide     520370..520444
FT                   /locus_tag="Lbys_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            523540..524952
FT                   /locus_tag="Lbys_0487"
FT   CDS_pept        523540..524952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0487"
FT                   /product="RagB/SusD domain protein"
FT                   /note="InterPro IPR012944; KEGG: bfr:BF0671 hypothetical
FT                   protein; PFAM: RagB/SusD domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: SusD family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16261"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXB6"
FT                   /protein_id="ADQ16261.1"
FT                   /translation="MKKIFIAISLLGFTACDQDKLLHTVPPTQLSSADVFNTPERIEAL
FT                   VNGIYKAIKNSSLYGGRYLLYNDVRGEDFINITGNTFTGYESWNNSYSSGSNDIINLWS
FT                   AGYTTINQANILIDGLGRSKGVISESQAAAYIGEAKFLRALTYYSLVTVYARPYADKEG
FT                   QNPGLPLRLLAETTPANNDLARSSVAEVYQQIIKDLDDAEASLPANYSTALLNTTRAHR
FT                   NTAIALKTRVYLTLGKWDKVVEEARKIVPQIQSPFKATSGVNHELQDVVQIFQNNFTTT
FT                   ESIFSMPFSSLDNLGGQSAIAYIYNTNSEYHLNPTGIFGDPQWGERDARRQWLRINNGR
FT                   AFLAKFGSTAPFLNYIPVIRYSEVLLNYAEALVRKGEWSLSKTLVEAVHHRSDPNYSFQ
FT                   STTGQGLLESIWKERRIELLGEGFRSNDLLRNLLPIPQKGSASLTAGRVDPHDENYIFP
FT                   LSNAEIATNKAL"
FT   sig_peptide     523540..523587
FT                   /locus_tag="Lbys_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(524967..526058)
FT                   /locus_tag="Lbys_0488"
FT   CDS_pept        complement(524967..526058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0488"
FT                   /product="Lipid A 3-O-deacylase-related protein"
FT                   /note="InterPro IPR018550; KEGG: gfo:GFO_0335 secreted
FT                   protein; PFAM: Lipid A 3-O-deacylase-related; SPTR:
FT                   Putative uncharacterized protein; PFAM: Lipid A
FT                   3-O-deacylase (PagL)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16262"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXB7"
FT                   /protein_id="ADQ16262.1"
FT                   /translation="MCYKKLLLLILLPQFIFAQLSIEVETENGGMLTQKSVKSTTYEDA
FT                   YYNGINARVGWKSSGKKDHYHQIYNYPVYGIGFYSSTFNSDIIGNPFALYGFVDTPISP
FT                   KSNSKWGFDYRIGLGLSGNFNPYDEDKNPLNLVIGSKTNVFIDFGLRTTYRWHEKWKVG
FT                   AGFSFHHFSNGSLSLPNKGINLVPFAVTVIYEPKKIEPYVRPTIPDYPKNLIFDFSYGS
FT                   GVKQLQKTSKERFWKSTVSLYASKYVSHKWRLGGGYDFFYSQSGKEERIAGQKAGSLGA
FT                   VLTGGPSLYIVHHLTSDLTLNGNVGYYLHKQSFNGELKRIFLRAGARYYFSHPFNAGVS
FT                   IKAHAGKADYIEWTIGYTLKGPQ"
FT   sig_peptide     complement(526005..526058)
FT                   /locus_tag="Lbys_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(526048..527166)
FT                   /locus_tag="Lbys_0489"
FT   CDS_pept        complement(526048..527166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0489"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: rmr:Rmar_2738 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Group 1
FT                   glycosyl transferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16263"
FT                   /db_xref="GOA:E4RXB8"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXB8"
FT                   /protein_id="ADQ16263.1"
FT                   /translation="MEILFVSHKYPPSTGGMEKQSFELINGMKRYAKVHMLVYEGQESL
FT                   LSFFIHLQKRITQIIKENPGIQMVHFNDGLIGTFCSFHKSYAHIARSVTLHGLDVTFPS
FT                   SFYRIRLLTRMNRYDKIIAVSDATAKEAIKSGLDPEKVVVVANGVDTKENAYSAEELPI
FT                   IDPRPFLLMLGRPVERKGFSWFINHVLPLVRKKYQLIIVGPYKEVPNLLERILHILPKK
FT                   LRTRIMLFLGFPSDSVNLRKLLPGNPDVKHLGHLPYTTIVQLFRRSAAFIMPNIHQEGD
FT                   MEGFGLVCLEASVNGALVLASQVDGIPSAIHSYKNGILLPADDPNAWAKTLMDLEKYQN
FT                   KKEAFTLYTKENFSWDRMVKAYLKVFQNDHVL"
FT   gene            complement(527169..528101)
FT                   /locus_tag="Lbys_0490"
FT   CDS_pept        complement(527169..528101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2303 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0104); TIGRFAM: conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16264"
FT                   /db_xref="GOA:E4RXB9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXB9"
FT                   /protein_id="ADQ16264.1"
FT                   /translation="MKILRWGLIISVIISLGLFLKATDFQEVFEILKKIGAKAFIILLS
FT                   TCAAYLLGTWGWKYCLGENANTLSFGRLFVLRHVGETLALFNPTSILAGDWLKSHGLQK
FT                   AGINPEVANNSVILSRILMILTQMFLLICALSWMYLGGNLEEKWRLGVGILLGILLITL
FT                   TVLLILLFKDVDESSSYKWWTTLKSYKNALRNYVLQYPKYSILAALFLMLHWIAGSLEM
FT                   YFILSFLGYDLSVFHGLLMDMGVILIKSIGAFIPGQLGLEEIANKTVILLIGISSASLW
FT                   VSVSILKRSRQMFWSAIGGILYLLYRKEI"
FT   sig_peptide     complement(528036..528101)
FT                   /locus_tag="Lbys_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(528098..529213)
FT                   /locus_tag="Lbys_0491"
FT   CDS_pept        complement(528098..529213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0491"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: rmr:Rmar_2737 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Possible group
FT                   1 glycosyl transferase; PFAM: Glycosyl transferases group
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16265"
FT                   /db_xref="GOA:E4RXC0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC0"
FT                   /protein_id="ADQ16265.1"
FT                   /translation="MRVAFIAEILIKEFDGASRTMFQLIERIPSEGMDFRFFCGMAQEN
FT                   LEAVTLPTLKVPGNETYRFVVPWGGKLEKELDGFQPDVIHIATPSLLGNAALKYARKKG
FT                   IPVISIYHTHFISYMDYYLKKAKIFIPLGKWYIRRSYQNFYNHCDLIYVPSISMIEELS
FT                   HLGIQKSRMKLWQRGIDLSLFSPEKRNPSLLPQNSKKTILFSSRLVWEKNLKTLIDLYV
FT                   LLEKEGMPYHLLIAGSGVAEEETKKAMPQATFLGHISHDLLSKYYASSDVFIFPSVTET
FT                   FGNVVLEAMASGLPSVVARGGGSKDFIIPGENGYLVEPNDAKEYLFFIKEILSDEELHK
FT                   KLSLKAVQMAKSYDWEALAATYFEDLKSLKP"
FT   gene            complement(529213..531723)
FT                   /locus_tag="Lbys_0492"
FT   CDS_pept        complement(529213..531723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_2554 hypothetical protein; SPTR:
FT                   Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16266"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC1"
FT                   /protein_id="ADQ16266.1"
FT                   /translation="MTYKKGILFILLFGRIATALAQSTIVSGKVIDAVTKETLPFVTVS
FT                   IVGDNKAVPTDEDGNYSISVDEKFNQLQFRYVGYATQIKTITHGKSFKLNVELDLDASL
FT                   LGEVVVKPKGYRYRNRDNPAVQLIRKVIDHKDENRLSGQEYAQYEEYEKVSLSLSNLSE
FT                   KFRNRRIFKDYQFLFVEGEDHKYLLPAYMREKITQVYYRKSPQKLQRNVIAEKQVEFDK
FT                   KFISNESISEYTSHLYENVDIYSNNINLLTNMFLSPIAGSAPTFYKFFITDTLKNVEPQ
FT                   LIELSFVPRNKTDLLFRGKLYITLDGKYAVKSANLTLDKNININFIRSMQTTLDFAQDG
FT                   NGRYYLENSEITMEFALTDNGSGFQGKRSVSYKDYIAGVPIPDAAFHAKVQPLNDLNWE
FT                   ELRHRPLAKQEANIYRNVDTLQTITSFRRAMDIGTMLIAGYKVAGPLEVGPINTFYSFN
FT                   PVEGFRLRFGGRTTPEMSKRFYAETYAAYGFKDEKWKYYLSGTYALNNKSIYNFPLHYI
FT                   KASYQKDTKIPGESLQFVQEDNFLLSFKRGDNYRWLYNDTYTLEYMHEWQNHFSYQLKL
FT                   SKWRQLPAGILTYQHRNQEGVLVDHPELNTTELSLALRYAPNEKFMQGKLYRSPLYNKY
FT                   PVFNLTYMAGMKGFLDGEYNYHNVSANIFKRFYLSQLGYADITAEGTYIFGNGIPFPLL
FT                   NVHRANQTYAYQLNAYNLMNFMEFVSDHSAGMNVQYYMNGFIFNKIPLFKKLKWREVFS
FT                   FKGLWGGLRDENNPQKNANVLIFQEQDGVPITYTLNNGPYMEASAGIANIFKLFRVDII
FT                   RRLNYLDHPDAPKWGVRARFKLDF"
FT   sig_peptide     complement(531640..531723)
FT                   /locus_tag="Lbys_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(531726..532700)
FT                   /locus_tag="Lbys_0493"
FT   CDS_pept        complement(531726..532700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0493"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509; KEGG: dfe:Dfer_2555
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: UDP-glucose 4-epimerase; PFAM:
FT                   NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16267"
FT                   /db_xref="GOA:E4RXC2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC2"
FT                   /protein_id="ADQ16267.1"
FT                   /translation="MKKKVLITGASGFLGFHLIQEAMERGYEVYGAVRQNSHTEHLPCK
FT                   LISLPYEDEQALQSLLQEKRFDYIVHAAAMTRAKRPEDYYKVNVQYSLSLAKAASLCSA
FT                   TKSFLFVGSLAAIGPVGYSSAPITENFPKNPVTGYGRSKREAEEELIKIPSLPLKIVRP
FT                   TAIYGPREKDLEVLVNTILSGWDAYIGHKPQKLSFIHGRDAARAIWDLSELEGKGPVDF
FT                   NLTDGNVYTRYDFADAIKKITGKKAIRLHLPTGLVKLTAGLLEFLYKNSEKLPVLYKER
FT                   LHELTAESWEVDISRLREHTAFEPKYDLISGLEDTLKWKQKGQ"
FT   sig_peptide     complement(532635..532700)
FT                   /locus_tag="Lbys_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(532697..533815)
FT                   /locus_tag="Lbys_0494"
FT   CDS_pept        complement(532697..533815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0494"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000182; KEGG: dfe:Dfer_2556 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16268"
FT                   /db_xref="GOA:E4RXC3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC3"
FT                   /protein_id="ADQ16268.1"
FT                   /translation="MIEVVENKKQLKEFIDFPHELYKNDPCYVPELYIGQKELLWKADN
FT                   HPFFDHSDMRLFLAKRDNKVVGRIAAILNNNHIEYTRQPEGFFGFFDCENQQVTANALL
FT                   NEAAKWLKGYQLKNIIGPVNQSTNNTCGLLVEGFNTPPVVMMPYNAPYYSELLENWGLQ
FT                   KKTDLLAYEVSKDSTQSKALNLLDRLISRLESKGIVIRSINTKDFKNEVAKIREVYNTA
FT                   WDKNLGFVPMTENEFKVTAKELKMILDPRFGIVAEKEGKIIGFAIGIPDINEIQIDMPK
FT                   GRLFPTGIFKLLFRKNKVSTLRVMMLGVLEEYRKLGIEACLYGKIIRNAEGTNITKAEC
FT                   SWMLEHNYLMNHAIEQINGRLYKRYRIYEKAI"
FT   gene            complement(533815..535023)
FT                   /locus_tag="Lbys_0495"
FT   CDS_pept        complement(533815..535023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0495"
FT                   /product="serine palmitoyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /EC_number="2.3.1.50"
FT                   /note="COGs: COG0156 7-keto-8-aminopelargonate synthetase;
FT                   InterPro IPR001917:IPR004839; KEGG: dfe:Dfer_2557 glycine
FT                   C-acetyltransferase; PFAM: aminotransferase class I and II;
FT                   PRIAM: Glycine C-acetyltransferase; SPTR: Glycine
FT                   C-acetyltransferase; PFAM: Aminotransferase class I and II;
FT                   TIGRFAM: 8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16269"
FT                   /db_xref="GOA:E4RXC4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC4"
FT                   /protein_id="ADQ16269.1"
FT                   /translation="MSNKLKERTTSFKDSLQIKEQGLYPYFRAIESGQDTEVKIRGQRV
FT                   LMFGSNSYLGLTNHPKVIEASQKAAIQYGTGCAGSRFLNGTLDLHEQLEAKLAEHTGKE
FT                   DALLFSTGFQANLGALSCITGRHDYILLDERNHASIIDGSRLSFSKVIKYAHNNPKDLE
FT                   KKLSLLPEESLKLIATDGIFSMEGDIVRLPEMVEVAKAYDAAIVVDDAHSLGVIGEKGA
FT                   GTASYFGLTDEVDLIVGTFSKSLASLGGFIAGTKDSIEYLKHKARSVMFSASMPPSAVA
FT                   STLAALEIMREEPEHMQRLWDNTHYMKSLLVENGFDLGKTESPILPVYIRDSEKTFRIT
FT                   QMLFENGVFVNPVVSPAVPSEESLIRLSLMATHTFDQIEEAVDKMIKARTALRIGTLDT
FT                   ATI"
FT   gene            535359..535682
FT                   /locus_tag="Lbys_0496"
FT   CDS_pept        535359..535682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_4095 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16270"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC5"
FT                   /protein_id="ADQ16270.1"
FT                   /translation="MATPDFLPTSMSTLSEVMELLADRGFDHELTFSPEGKLVGNNKAY
FT                   VPEDLLLIRTYRFEGISDPSDNAALYLFTDKEENIGFVVDIYGRESNFPASFADFLRNV
FT                   PSI"
FT   gene            complement(535704..538067)
FT                   /locus_tag="Lbys_0497"
FT   CDS_pept        complement(535704..538067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0497"
FT                   /product="protein of unknown function DUF214"
FT                   /note="InterPro IPR003838; KEGG: dfe:Dfer_5420 protein of
FT                   unknown function DUF214; PFAM: protein of unknown function
FT                   DUF214; SPTR: Putative ABC transporter permease; PFAM:
FT                   Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16271"
FT                   /db_xref="GOA:E4RXC6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC6"
FT                   /protein_id="ADQ16271.1"
FT                   /translation="MIKNYFLVAWRNLLRNRGFSFINIFGLAIGMAAAILILLWIKFET
FT                   SVDREYALADRIYVMYNRDTFSGEKWAWSTTPTVMGPAIKKDYAEVEETVRVSNDRLLL
FT                   TVGDKQLYSRGLIVDSVFFKVFDFEAISGDLITSLNNPNHIVVTEELALQLFSTTDVLG
FT                   RTVKVDSSDLFKISAVLKDMPNNSRFKTSYFLPWEIIKKRDWDNGNWTNNSISNYILLR
FT                   ENADINAFNEKVRDITIRNTPGSPTTTEVFAYPITQAYLYGKSEDGKLVAGKLVTVRMF
FT                   GAIVTFIVIIACINFMNLTTARSEKRAKEVGVRKVAGASRGVLIVQFLGECILLSLIAG
FT                   LLALVLVFVSLPAFNSLIDNHLQMDLSHPFFWINFLGFVLFTGILAGSYPAFLLSSFPP
FT                   VTALKGTFRVSPSGFTIRKVLVVLQFTFAIILIISTLIIQKQIKFAQNRELGYDQEKLI
FT                   YVPLTGSMPRQFTYIKQAILKSGAGVGVTKSLSPITEQWSDGWGYSWPGSEPDDEKLDF
FT                   IRFSADADFTKVMGVNLIQGRDIDIYTYPTDSNSVLLNEAAVKKMRIKDPIGLVISDED
FT                   TKYTVVGVIKDFIIGSPYEPIRPMMVMGPGSWFNMMHIKLNPDRALSDNLQQIENILKE
FT                   FNPNYPFEYRFVDEQYAKKFENTRRTATLSSLFTALAIIISCLGLFGLSAYMATNRVKE
FT                   IGVRKVLGASVKDIVILLTKDFLKLVGISFLIASPIAWYIMREWLKEYTYKIDMSVDVY
FT                   VLTGLLCFIIAVATVSLQAIRAATSNPVKSLRTE"
FT   sig_peptide     complement(537972..538067)
FT                   /locus_tag="Lbys_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(538064..538741)
FT                   /locus_tag="Lbys_0498"
FT   CDS_pept        complement(538064..538741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0498"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR017871:IPR003593; KEGG: zpr:ZPR_4631 ABC-type
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter; TIGRFAM:
FT                   putative bacteriocin export ABC transporter, lactococcin
FT                   972 group"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16272"
FT                   /db_xref="GOA:E4RXC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC7"
FT                   /protein_id="ADQ16272.1"
FT                   /translation="MIKIKNLEKYYRTEEVETIALNKLNLKVEPGEFVAIMGPSGCGKS
FT                   TLLNILGLLDDPDGGEFIFNGTDVTHFNEKKRAELRKQTLGFVFQSFNLIDELTVFENV
FT                   ELPLIYLKIGASERKKRVEEVLEKMQIMHRRNHFPQQLSGGQQQRVAFARAVVHSPKLI
FT                   LADEPTGNLDSNNGNEVMQLLSDLNASGTTVIMVTHSEHDARYSHRIIRMLDGQTVTEN
FT                   ILR"
FT   gene            complement(538746..539990)
FT                   /locus_tag="Lbys_0499"
FT   CDS_pept        complement(538746..539990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0499"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG1566 Multidrug resistance efflux pump;
FT                   InterPro IPR006143; KEGG: rbi:RB2501_00516 efflux
FT                   transporter, MFP component, RND family protein; SPTR:
FT                   Efflux transporter, MFP component, RND family protein;
FT                   TIGRFAM: efflux transporter, RND family, MFP subunit;
FT                   TIGRFAM: RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16273"
FT                   /db_xref="GOA:E4RXC8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC8"
FT                   /protein_id="ADQ16273.1"
FT                   /translation="MDRKLEKKYTKKIFKWGFTGAGILAVAGLGIYLATSNPTQEVQME
FT                   RITIEEVKLGTFQETLPVNGVILPLTTIYLDVLEGGRVEEKFVEDGAIMKKGDPILRLG
FT                   NTDLELSLASQETQVYNVLTQMNISKNNATQNTILKLNQMAEVDNALKEAERVYLLNKK
FT                   LHQDRLISQQDFQQSENLYQYQLRRKKLTDEILSQDKEVIDLMQKQDKESLQKMQNTLA
FT                   LMRKKVSDLIVRAPIDGRLTSLDAEIGQLKNKGERLGQIDVTDGYKIRADIDEHYINRI
FT                   FPGLPATVLIAGNTYKLIIKKVYSQVKNGKFQVDLEFEVDRPDELRRGQTLQVILALSD
FT                   ETQALLLPRGAFYQKTGGTWIYKVSKDGKTAYKTDIKINRNNPKYYEVTAGLQAGDKVI
FT                   TSSYDNYESDLLLKP"
FT   sig_peptide     complement(539883..539990)
FT                   /locus_tag="Lbys_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            540192..541520
FT                   /locus_tag="Lbys_0500"
FT   CDS_pept        540192..541520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0500"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterProIPR002078:IPR001789:IPR002197:IPR003593:IPR 020441;
FT                   KEGG: zpr:ZPR_4629 sigma-54 dependent DNA-binding response
FT                   regulator, fis family protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; helix-turn-helix Fis-type; SMART: response
FT                   regulator receiver; AAA ATPase; SPTR: Sigma-54 dependent
FT                   DNA-binding response regulator, Fis family protein; PFAM:
FT                   Response regulator receiver domain; Bacterial regulatory
FT                   protein, Fis family; Sigma-54 interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16274"
FT                   /db_xref="GOA:E4RXC9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXC9"
FT                   /protein_id="ADQ16274.1"
FT                   /translation="MLLRNASVLIVDDDPDVLTAVNLFLKTEVKSVITENNPENLKKLF
FT                   RENTFHLVLLDMNYKSPIHTGNEGLYWLKEIKKLSPETEVIMITAYGNIDLAVRSLKEG
FT                   ATDFLLKPWYNDKLLEHLKEALGSKKSSSPKVEDHGLLGESDEMQKLQVKIRKIAPTDA
FT                   NVLILGENGTGKDLVARALHQQSLRAGKPFIKVDVGALTESLFESELFGYKKGAFTDAK
FT                   EDREGRFEAANGGTLFLDEIGNISLHLQSKLLSVLQNRQVMRLGSNVPIPVDIRLICAT
FT                   NIPMKELANEQRFRKDFVYRIHTVDVVLPPLRRRGDDMLLLAEHFVAEYAEKYFKAGLR
FT                   ISPQALEKLKAYSFPGNVRELQFSMERAVIMSEGDEITAEDLIFLPLENVEPEENELSL
FT                   SSVEKNTILRVIEKNNGNISKAAKELGITRTALYRRLNKYDID"
FT   gene            541507..542793
FT                   /locus_tag="Lbys_0501"
FT   CDS_pept        541507..542793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0501"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR005467:IPR003594:IPR004358; KEGG: zpr:ZPR_4628 sensory
FT                   box sensor histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; SPTR: Sensory box sensor histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16275"
FT                   /db_xref="GOA:E4RXD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD0"
FT                   /protein_id="ADQ16275.1"
FT                   /translation="MTSIKWLLRLLLTSFCLVGLGYALVSGPPWLIIGLACLSLYFLYT
FT                   LFQIPMQVLYEVKDFALSIKYKDFARHFATKKQREEIKILRSSFNEIHDAIKEITREKE
FT                   AQYHYLQKMLDWIDTGILLYKPESGEVVWMNEALKKLWGIPYLKTIDFLEKRNPKLFDK
FT                   LVHLGNHSEIYQEENKMLLTGTSFSTDGIMFKLIAVKNVNEVLAENEVQSWQKLLSVLT
FT                   HEIMNSVAPISSLADTLKKRLGDSEDDLAQGIDTIKSRSEGLLKFTAIYRNLNKITSLN
FT                   TESILVRELFENIYRLMDPTLSHKSIELQVLLRQPNMCVIADKALLEQVLINLILNAVE
FT                   AVKEVPEPKISLSASLTDHLEIMVSDNGTGIEDEVLDKIFVPFFTTKKKGSGIGLSLCK
FT                   QIVSLHKGSLLVRSKVGQGSVFTIVLPAF"
FT   sig_peptide     541507..541614
FT                   /locus_tag="Lbys_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(542790..544004)
FT                   /locus_tag="Lbys_0502"
FT   CDS_pept        complement(542790..544004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dfe:Dfer_3212 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16276"
FT                   /db_xref="GOA:E4RXD1"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD1"
FT                   /protein_id="ADQ16276.1"
FT                   /translation="MRIQHLLTAGLALGTAWAVRGQFGHEHGAAWAGAIGALTLILISG
FT                   REDWKKFALPIALAGGVGWGLGGMMSYGILVGYGKGTDWGNVYYGLTMLGVVGALYGFT
FT                   GGAWMGLSLSRAKNPWPQVIVESTVGAILSYFFLVEQFGYLMTPPRSELWSACLGISLA
FT                   TAWYLYRNEHIAALKLGGFTALGAGLGFGLGNFFQVLGNIYEVPFNMWNVMEYTLGFCG
FT                   GIGMYYGLITSEWPELSKEDRGRNLSWFFLCIFIPLVMWEQNATLEKISKKILSLREDF
FT                   PSHFAYLIQYLPAVLILILGLNWRKMQNVRHFYFQFFGLYISLSLFITGAFFSTHRPEQ
FT                   YLYLVNLLLVYLLLKSRSATFQNKKISNAFWIKGILGILLLFALLAWIAIQLHENALSG
FT                   AHNRF"
FT   sig_peptide     complement(543951..544004)
FT                   /locus_tag="Lbys_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            544153..548019
FT                   /locus_tag="Lbys_0503"
FT   CDS_pept        544153..548019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0503"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR001789:IPR000014:IPR000700:IPR
FT                   008207:IPR003018:IPR013767:IPR013655:IPR013656:IPR003661:I
FT                   PR003594:IPR001610:IPR004358; KEGG: fba:FIC_01779 PAS/PAC
FT                   domain protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; PAS fold domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; response regulator
FT                   receiver; Hpt domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   GAF domain protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; response regulator receiver;
FT                   SPTR: Possible sensory box histidine kinase/response
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: Response
FT                   regulator receiver domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; GAF domain; His Kinase A
FT                   (phosphoacceptor) domain; Hpt domain; PAS fold; TIGRFAM:
FT                   PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16277"
FT                   /db_xref="GOA:E4RXD2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD2"
FT                   /protein_id="ADQ16277.1"
FT                   /translation="MAELPNNEEERIERLHLLNLIEVGFDPEFDSCVQAACAMAQTPAG
FT                   YISVMTQDTQKVQSCIGLYWDKAKREETVCQYAILEGKPLIINDTLEDERTQNNDFLIR
FT                   NGIRFYAGFPILTDDGLALGTLCVLDYVPRKLEHEQILALEGFSKTISLLYLQKQSRVH
FT                   ADYYHKILSITNNLVLVLDTDLQIKKVNPAFESLFNMGQKVARGKDFKALFKESENWPN
FT                   DYPLKLASEDGFYFTSTTDQPKTIIQWRLKREEQFNEIFCFGRNVTQEVEEKKKLENSE
FT                   RRFRKFFEKAIGYMSMHDMTGKILAVNEKGRQQLGYEALDLSQMKLQDLLPEKHLPEYN
FT                   EYIKRIYKNKEDSGMMVLKTKSGDETYWLYNNILERDSQQNPYVISTALNLTERINLEK
FT                   DLLYTKEILERTSQVARVGGWELDCQTGKMFWSKTTRIIHGVGPDFEVNEENALDFFEE
FT                   EDREKFLNIVSKAKEEGTPYDVELRILRTNGEKIWVRLQGYPDIEKGKCRRIYGILQDI
FT                   DSLKRMLLEIQEKEAMLSSFVKHVPAAVAMLDLNLNYISTSKRWREEFFGGGENPVSQS
FT                   LFSLFPGMPDYLKEIYYKAVEGTPYKNYDEVVVVQGKDEPQHYYWEVRPWKYADDRIGG
FT                   VIVSALNNTESIAIQKELKEAMKSAEQANAAKSQFLANMSHEIRTPLNGVIGFSDLLLK
FT                   TPLNATQRQYLNYINESGSSLMQIINDILDFSKVEAGKMELDEAFHSIYDLSDQVINVV
FT                   MYQAQVKNIELLLDVQHGLPAAVLLDEARVKQVLVNLLGNAVKFTEEGEVELAVRQISR
FT                   TDKEIGLRFLVRDTGIGIPEEKKERIFDAFTQEDSSISKRYGGTGLGLTISNSILKHMG
FT                   SKLYLESEVGWGSTFYFDLVLEYTEELKDEIEVPLKRVLIVDDNEKNRVILKDMLQYKN
FT                   VETVLAEDGMRALKILENDLNFDAILMDFHMPGKSGLDTIAEVRNLFQIQKKETPLVVL
FT                   HTSSDQPDLFAEFKKLDNSYFLLKPIRSEELYRTLRNAANRIQESVQLTLPDAQEQSAV
FT                   NEVKILIADDNPVNMALNLRVLKIALPNAEIYQAKDGLEALEICKKVHFDIILMDVQMP
FT                   KMDGLEATRTIRTLPGYESIPIIGVSAGTTEGEKENGLKAGMTDFLPKPFKQQALWEKI
FT                   KPYLSEEEGPSKEIERWDMSILEEQTGGDEEFKMIFLETLKQELEKSFEDLEKNPYFED
FT                   RISAKQVLHKLKGTAGTAGLTLLYEKVKCAESLCVEGNPEPELYHEVREELSKSLQLIT
FT                   LFFG"
FT   gene            548022..548375
FT                   /locus_tag="Lbys_0504"
FT   CDS_pept        548022..548375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0504"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789; KEGG: fba:FIC_01778
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR:
FT                   Two-component response regulator; PFAM: Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16278"
FT                   /db_xref="GOA:E4RXD3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD3"
FT                   /protein_id="ADQ16278.1"
FT                   /translation="MLILVAEDDELILKTVEFKLKKEGHEVMLTRNGKDAIDAVKVLDF
FT                   DLVITDIMMPFASGIEILSALRSIGKDTPVIVLSSLGQEEVVTEAFDMGAADFMVKPFS
FT                   PNELMLRIKRLVR"
FT   gene            548378..549430
FT                   /locus_tag="Lbys_0505"
FT   CDS_pept        548378..549430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fba:FIC_01777 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16279"
FT                   /db_xref="GOA:E4RXD4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD4"
FT                   /protein_id="ADQ16279.1"
FT                   /translation="MDIFTLRNLYIALIVVLALVLVLSVVVLAISFFKYNRIINRKRWR
FT                   VKIDEIISKAIVTSEIEIDEVICESRPLRNQFLSALVDASRRFSGHAREEIAALFQAYD
FT                   LKEEVLGKLKDRRTHWIAGGIQEAAVMELEDLVPTIHDLLSHPSPIVYQEAQFAIVSFQ
FT                   GFDGLDFLDDLSFPLSEWQNLRLLSIIKKIPENGEEKLRFWLKSPNPTVVIFVMRLIAK
FT                   MQLLSLYDEVEAVEGEDRVKIQQVKTLEALENEKTVPSFMERFPDESEEVQKAILQALK
FT                   YSRHPEAVHFLSLQLKNHEQGAIRMQAAEALHHLGKIDEMKALLTEGDPVLKQIIYHVL
FT                   REKDASANDI"
FT   sig_peptide     548378..548464
FT                   /locus_tag="Lbys_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            549408..552737
FT                   /locus_tag="Lbys_0506"
FT   CDS_pept        549408..552737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0506"
FT                   /product="sulfatase"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173:IPR000917;
FT                   KEGG: fba:FIC_01776 glycosyl transferase, family 2; PFAM:
FT                   sulfatase; glycosyl transferase family 2; SPTR: Glycosyl
FT                   transferase family protein; PFAM: Sulfatase; Glycosyl
FT                   transferase family 2; Chitin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16280"
FT                   /db_xref="GOA:E4RXD5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD5"
FT                   /protein_id="ADQ16280.1"
FT                   /translation="MLAQTIYEVSIWVFLIYSILIFIIYGWIGYYAFGALKLYKQRNLF
FT                   TDYNLVASNPNAPRFSIVAPAYNEGKTIVENVRSLLSLFYNNLEIIIVNDGSKDDSIDR
FT                   LIAAYDLEATSFFVQGHLPTQDIKAVYRSKNLAFKKLVVVDKVNGGKADALNAGINVSS
FT                   GDYLVCIDVDCILEQDAILKLAKPFLEQTDKKVIACGGVIRLANNCIVENGKVVDVNLP
FT                   KTWLGKSQALEYIRAFVLGRMAWSRASALILISGAFGAFDRKIVLECGGYDPETVGEDM
FT                   ELVVRMRRYMEEKNEPYKVVNIPDPLCWTEVPEKEEVLKRQRNRWMRGTMETLWKHRKL
FT                   IFNPKYGKLGMMSMPYWLFFEFLGPIVESLGYVFFAMLWIFGLINWQFFLALYGLVICT
FT                   GITYSVYGILVDLASHQVYTKRKDFWKLIATANLEPLYFHPLVVRASVSGVLDYFRNKQ
FT                   GWGEMTRQGFRKGEEDLPLWKWVLNSLERSFMAWFWPSMAFIGITCILAGVEAFWYRYQ
FT                   EIEFDGISLFRNNLEIAFQCVMFGAVFYLLLRLLNVRRGQIFLVIYYTFLSVLYFVLFL
FT                   YFSEGKSLLGADAFIYSKEEVWQIVKSSGVMNPLNIGILVFMISAVACLIYVSLFQKTR
FT                   SWIPGFVLFLVGFMLWGVNFESEHESEMTRMSSSSKWAFFFEANYKHLKDKWWPENELA
FT                   NAEFPFLHQKNTTNFLKEYLNSSAEKPNIVLIIVEGLGSAYTRSEGYIGNFTPFFDSLT
FT                   TQSLYWKNALSSSGRTFAALPTLTGSLPFAQSGFLELNEYPSHFSLWNILKKNGYQTGF
FT                   FYGGHASFDRMKDFLVFNEVDQIIERNNFPDGYRLLPNNNGETWGYEDASVLSVLSQAE
FT                   SSKPYFHVALTLSTHNPFIINDKSVYEEKFEQRVKELKYEGAKLKQVRDQKKALTTVLE
FT                   LDDNLRHFMQVYSQRDDFHRTIFIITGDHAMPEIPFETKLDRYRVPLLIYSPLIKTPRT
FT                   FKQMVSHFDLVPSLLSYLENANNLIVPQQVTWIGEGLQGSKAYPLMQSKTLLQEYITPK
FT                   YHWVGGETYVISADLQEERVPEDRDGLGEKFKLFKQRNQTLIQGKPLMPDSVYTNFLRR
FT                   FD"
FT   sig_peptide     549408..549485
FT                   /locus_tag="Lbys_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(552721..553944)
FT                   /locus_tag="Lbys_0507"
FT   CDS_pept        complement(552721..553944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0507"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR019734:IPR013026:IPR001440; KEGG:
FT                   fba:FIC_01774 hypothetical protein; PFAM: Tetratricopeptide
FT                   TPR_1 repeat-containing protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16281"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR030887"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD6"
FT                   /protein_id="ADQ16281.1"
FT                   /translation="MKRLITLFLLTLSTYTFGQSSDDLLAQAKTQAFDQKNYPEAIKTL
FT                   KQAIEKSPDYLDLHIFLGRIYTWSDQVEEARNVFKPWFEKKVDTEDFYLAYASLEYWND
FT                   EEDRALEILQQGLEFNPKSEDLLYLQARIYNSLDQYEKAEESLNTLLSQNPKHTEGREL
FT                   LVRIRDLTAKNAIGVTYNFVHFDKQFADNWHIVGLSYRRATSIGSFIFRTNLAQKFGDN
FT                   GIQFEVEGYPRLSKMFYLYTGVGYSNQVGIFPKYRTGVSLYANLPQSFEGEIGYRQLHF
FT                   NDDVWMYTASVGKYYQNLWFNLRTYLTPGNSNLSHSYTGTVRYYTKGANDYLGFQIGTG
FT                   ISPDENRSNLLEPQIYKMKTYKIGLDYNFTLGKRNIFWIQGTYFNQEYQRETRGNQYDL
FT                   TLGFNRTF"
FT   sig_peptide     complement(553861..553944)
FT                   /locus_tag="Lbys_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(553997..554866)
FT                   /locus_tag="Lbys_0508"
FT   CDS_pept        complement(553997..554866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0508"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="COGs: COG1090 nucleoside-diphosphate sugar
FT                   epimerase; InterPro IPR013549:IPR010099; KEGG:
FT                   bal:BACI_c05080 putative epimerase; PFAM: domain of unknown
FT                   function DUF1731; SPTR: Putative uncharacterized protein;
FT                   PFAM: NAD dependent epimerase/dehydratase family; Domain of
FT                   unknown function (DUF1731); TIGRFAM: conserved hypothetical
FT                   protein TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16282"
FT                   /db_xref="GOA:E4RXD7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD7"
FT                   /protein_id="ADQ16282.1"
FT                   /translation="MKTILISGGTGYVGTHLISALINAGYQVHILTRKPQTSDHPQIRY
FT                   FVWKDFQAPAQAFKGVTTLINLCGTPLAEKRWTDLRKTEILHSRILPLKSLLTPALAAG
FT                   VRHIISSSAVGYYPEGKHDESSLPGQGFLSNVCVQWENAAKEWRGKGVITDILRFGLVL
FT                   SPDAPIIRKLLPLARLGINLSVGRGNQKLSWIHVQDLASIFLFLLENPQNKAINACSPQ
FT                   IMEMREFATVLQEGKYTLLPPAPSFVVKGILGQRATLLLDSIEAKPEILKNLNFPFAYA
FT                   DPRQILQK"
FT   gene            complement(554912..555337)
FT                   /locus_tag="Lbys_0509"
FT   CDS_pept        complement(554912..555337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0509"
FT                   /product="rifampin ADP-ribosyl transferase"
FT                   /note="KEGG: sli:Slin_3048 rifampin ADP-ribosyl
FT                   transferase; SPTR: Rifampin ADP-ribosyl transferase; PFAM:
FT                   DNA/RNA tunnel of bacterial DNA dependent RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16283"
FT                   /db_xref="GOA:E4RXD8"
FT                   /db_xref="InterPro:IPR021975"
FT                   /db_xref="InterPro:IPR038611"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD8"
FT                   /protein_id="ADQ16283.1"
FT                   /translation="MAGKKILTKMNATPLEPTYFHGTKAQLSIGDYITPGHNSNYGTGK
FT                   EASYIYLSGTLDAAIWGAELAKGEGKERIYLVEATGELEDDPNVTNKRFSGNPTLSYRS
FT                   TSPFLVVGEVGDWLPHPAEQVQAMKATISSKTDDDIL"
FT   gene            complement(555340..555776)
FT                   /pseudo
FT                   /locus_tag="Lbys_0510"
FT   gene            complement(555812..557041)
FT                   /locus_tag="Lbys_0511"
FT   CDS_pept        complement(555812..557041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0511"
FT                   /product="heat shock protein"
FT                   /note="COGs: COG0443 Molecular chaperone; KEGG:
FT                   chu:CHU_2145 heat shock protein; SPTR: Probable heat shock
FT                   protein; PFAM: Hsp70 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16284"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXD9"
FT                   /protein_id="ADQ16284.1"
FT                   /translation="MQNFLYGVDFGTSNSALSILDLQSHQIIKTFILPSVLYFPKGEKR
FT                   VLVGNEAVESYVGDGMKGRFIKSIKRVLSNKSFQHTLINGVRYDLSDLVSLILKKLKAQ
FT                   ADDFVGTNVDQVILGRPVFFDDDDQDRDTLAQKRLEIAAKQAGFQKIHFQLEPIAAAFA
FT                   YEKTLSSPQKVLVADLGGGTTDFTLISLDPAKHDQLDRRQDIISTGGIYLGGDAFDSAF
FT                   MWEKGTPHFGRGVKYSTRPEQWLDLPLSLFLNITTWEKMIFFNSTKVLQDLKRYYFQSK
FT                   NHPKLKNLIDLIEGNLGYSIFREIERVKVDLSQNTSTTFDFEPSGIKEPIRSSEYDEII
FT                   SGDLQKIQNYLNQFIGDHHADSVFLTGGTSLVPAVQRMFKEKFGEVQSGDNFISVTQGL
FT                   AYSHYLLHIE"
FT   gene            557138..557648
FT                   /pseudo
FT                   /locus_tag="Lbys_0512"
FT   gene            complement(557645..558034)
FT                   /locus_tag="Lbys_0513"
FT   CDS_pept        complement(557645..558034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_3164 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16285"
FT                   /db_xref="GOA:E4RXE0"
FT                   /db_xref="InterPro:IPR025597"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE0"
FT                   /protein_id="ADQ16285.1"
FT                   /translation="MRKLANGIVIISLLGLAYVALLAWWSPQQVMDLVHLEIPNPDAAS
FT                   SIRGVYGSVGLFVCFVLGYLWKQDLALSLRFLALFWLLYALARVVTWKSHGPLGEFGTT
FT                   WLGIESTFGILSLFLSKYPSVKSSA"
FT   sig_peptide     complement(557906..558034)
FT                   /locus_tag="Lbys_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(558098..558688)
FT                   /locus_tag="Lbys_0514"
FT   CDS_pept        complement(558098..558688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0514"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595; KEGG: chu:CHU_2259 cyclic
FT                   nucleotide binding regulatory protein; PFAM: cyclic
FT                   nucleotide-binding; SMART: cyclic nucleotide-binding; SPTR:
FT                   Cyclic nucleotide binding regulatory protein; PFAM: Cyclic
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16286"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE1"
FT                   /protein_id="ADQ16286.1"
FT                   /translation="MKTIAITEEFLNLKNMMKGLSEEEWDTFSEIWTKKTYPKGSLLTM
FT                   QGDPENYIYFVVEGIQRIYHSYEDGKEATIIFSYPYSFSGVIDAALTGTPSRYFFETLS
FT                   SSTFLKAPAQKFLELSRTIPALSGFVQNALAQNIKGLLEKMVEVQSLKSEEKFIRFMQR
FT                   SPHMLHKVPQRYLANYLGIDPTNFSKLMNKVSI"
FT   gene            558743..559261
FT                   /locus_tag="Lbys_0515"
FT   CDS_pept        558743..559261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3132 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16287"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE2"
FT                   /protein_id="ADQ16287.1"
FT                   /translation="MLLNDLVNQWIAQKENIYYLVNLPTHLLRKRREDGGWSALECIEH
FT                   LNIYARMYLDSVEEAISASPDDDNSTFKSGLLGGYFARTMAPAGTKMKTFKSTDPQLVS
FT                   FHHDVIDEFQKHLERWGILLEMARHKDLNKKRVAMVKLPLLRFKLGDMLHILINHQSRH
FT                   LQQAMRVVG"
FT   gene            complement(559258..559848)
FT                   /locus_tag="Lbys_0516"
FT   CDS_pept        complement(559258..559848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0516"
FT                   /product="YceI family protein"
FT                   /note="COGs: COG2353 conserved hypothetical protein;
FT                   InterPro IPR007372; KEGG: dfe:Dfer_0371 YceI family
FT                   protein; PFAM: YceI family protein; SPTR: YceI family
FT                   protein; PFAM: YceI-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16288"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE3"
FT                   /protein_id="ADQ16288.1"
FT                   /translation="MTMKKLFLITLILTSCSDSDKITSYRIDGENAKVLWKGSTTDHSH
FT                   TGSFEVDGYAKADLEGNLTEGEFSIPISSIDNYDLTGDVKIQLLEHLKSPDFFNALKYP
FT                   KASFKLIRSVPNTENSQGLNQLISGEFTLLGTTKMITFPARVIVDKKKIEVKAQFTLNR
FT                   TEYGMVSYTDPDEMLYVLPEVEIDLNIKGTKDA"
FT   sig_peptide     complement(559792..559848)
FT                   /locus_tag="Lbys_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            559999..560301
FT                   /locus_tag="Lbys_0517"
FT   CDS_pept        559999..560301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pgn:PGN_1476 hypothetical protein; SPTR:
FT                   Thermostable beta-glucosidase B (Gentiobiase)(Cellobiase)
FT                   (Beta-D-glucoside glucohydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16289"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE4"
FT                   /protein_id="ADQ16289.1"
FT                   /translation="MLHNKKLLLAALIFLSAWAFIRYRERLTIKHVNEDPRSTVGVLVK
FT                   KSEYKSYTFHVKYLVNERSYILKAKVPQYVYVARNMGDTLPVKYSNAKPRFAILD"
FT   sig_peptide     559999..560076
FT                   /locus_tag="Lbys_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            560466..562688
FT                   /locus_tag="Lbys_0518"
FT   CDS_pept        560466..562688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0518"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dau:Daud_0865 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR:
FT                   Mannosyltransferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16290"
FT                   /db_xref="GOA:E4RXE5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE5"
FT                   /protein_id="ADQ16290.1"
FT                   /translation="MNKLALIGNFPPRKCGIATFSKDLFDGLIMNGVSVSVVAINDGLK
FT                   NYSYPPEVEFEIEQNEVSTYIKAANYLNSNNFDAVILQHEYGIFGGRDGRHIVQLLKRL
FT                   QMPVVTTLHTILDRPTEGQRDVLQEITGLSRKLISISQKGIELLKEVYDIPESKCAHIH
FT                   HGVHEILTQNRDQVRKKLGVEDKKVLLTFGLLSRNKSIEVVIKALPEVVERNPDVMYIV
FT                   LGETHPHVLKREGEDYRHSLLRLVSKLKLDKHVIFINRFTTNKELFDFLQLCDIYIIPY
FT                   LGEKQISSGTLIYTMGAARPIISTPFWYAKEMLAENRGLLFDFNDAEQLSQKILYLLDN
FT                   EEERKSIGENALALAKQCYWPNIGKQYVELLQGISWDDISATRFQLSNDLEFSLPLSPV
FT                   NLHHLRVLTDDTGIFQHARYSIPDRTHGYCVDDNARALMLSVMLQNDLQDVDELNRLTS
FT                   IYLSFVDYAYNESNGKFRNFMSYDRKWLEEEGSEDSVGRTMWALGYTAAQTRVSNFYHH
FT                   SNSLFFRGLQKVDYIRHPRALAYLILGMVHHAEAHGDPTVIEQLRSKLGQLNAFFDPCI
FT                   DKEWLWFDPIVTYANSRIPQALIAGGHYFKDEELVKRGLKILDWLIDKQFSEHLFSPIG
FT                   NQGWLTPEGKAEYDQQPLEAHGMIDACLQAEMVMKDGRYAEYALKAFAWFMGENSSSAV
FT                   LYDFSTGGCRDGLHSEGANMNQGAESTLSWMMSLISISYYLRRKKQ"
FT   gene            562691..564124
FT                   /locus_tag="Lbys_0519"
FT   CDS_pept        562691..564124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0519"
FT                   /product="glycosidase related protein"
FT                   /note="COGs: COG2152 glycosylase; InterPro IPR007184; KEGG:
FT                   rba:RB2988 hypothetical protein; PFAM: glycosidase related
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function (DUF377)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16291"
FT                   /db_xref="GOA:E4RXE6"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE6"
FT                   /protein_id="ADQ16291.1"
FT                   /translation="MKRLPIKITPSPTRTLVRPFVPGNIAQIQHILERIFSTPPEDQER
FT                   VMKGVYERLDLPNDSIQTIFLRHFELIQGHLPESRVFSEEEKIFIGACFTQQYALESTA
FT                   LFNPSIVPHPVQDKAGVTKFILSLRAIGEGHISSITFMEGEIDKELNIKLIENSPVIYE
FT                   SQRKEHLYDKELFMRKAGELGILFGAEQMVFEPLGDPFTFEQLEEVLNQIKGSKPFKSS
FT                   INMRRLVTGIRMLALSNFTLTFTTDTISERAIYPASPSQSNGLEDARFVKFTEDDGSSI
FT                   YYATFTAYDGKIIMPELLETHDFIEFKVSTLNGKAAKNKGMALFPRKVNGKYMMLGRQD
FT                   NESLYLMSSDNPYFWYESQPLVKPTFDWEMIQIGNCGSPVEIDEGWLVITHGVGPVRTY
FT                   SIGALLLDKDDPSKIIGRLKEPLLTPSKQERFGYVPNVFYSCGAMAIGRTLVLPYAIGD
FT                   VVTTFTLVDIDRLIKRMIE"
FT   gene            564121..565152
FT                   /locus_tag="Lbys_0520"
FT   CDS_pept        564121..565152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0520"
FT                   /product="mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="5.3.1.8"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dau:Daud_0862 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase, group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16292"
FT                   /db_xref="GOA:E4RXE7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE7"
FT                   /protein_id="ADQ16292.1"
FT                   /translation="MKIAMLAPIAWRTPPRHYGPWELVTSLLTEELVKMGLDVTLFATA
FT                   DSITKGKLRSVAMQGYEEDREMDAKVWECLHIAQCFEQADEFDLIHNHFDFLSLTYSKL
FT                   VKTPMLTTIHGFSSPKILEVYKKYNANTHYVAISEANKSPELDYVETVYHGIDLNDFEF
FT                   KGEEGEYLLFYGRIHPDKGTKEAVEMALALDMPLIIAGIIQDQDYYDQWVKPFLKKGKV
FT                   EYVGSIGPERRNECLGNAKVLLHPIHFEEPFGLSVVEAMACGTPVLAFNKGSMPELIHH
FT                   GENGFIVQDMEEACAYIPKVSSISRMKCREIVEQRFSKEIMAQRYLEVYKRLIIRPESA
FT                   VAV"
FT   gene            complement(565668..566786)
FT                   /locus_tag="Lbys_0521"
FT   CDS_pept        complement(565668..566786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2538 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16293"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE8"
FT                   /protein_id="ADQ16293.1"
FT                   /translation="MMKQIILYLLLPFACLAQSPYKSSIEIEKNLEKDTIPWKYQLAAT
FT                   DYSFIGNYAKLLETMEQERFGKRPSTREDSLFLQSARMLNAKEYILSQAKDAPMLIINE
FT                   AHHMPQHRAFTASLLKELYANGYRYFGLEALADDSINIRKYPQLKSGFYTQEPEFGNLI
FT                   KHALDLGFTLFGYEAGEGRNGKEREIEQAQNIKKFIEAHSEGKVVIHCGYAHAYENEYP
FT                   AWEKAMAGRIKEYLDIDPFTVEQTLFLERADASKNHLFLKSIKGTEPQVLLDHNGQVFK
FT                   GYTSQTDVVVIHPATRTIKGRPHWLYPEKKEYYLSREISSGLIFAYRKGETEGVPADII
FT                   EVFQPSTPLLLKPGPYILYHGTQAIQEISIER"
FT   sig_peptide     complement(566712..566786)
FT                   /locus_tag="Lbys_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(566815..566994)
FT                   /locus_tag="Lbys_0522"
FT   CDS_pept        complement(566815..566994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0522"
FT                   /product="putative enzymatic protein"
FT                   /note="KEGG: amc:MADE_03683 putative enzymatic protein;
FT                   SPTR: Putative enzymatic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16294"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXE9"
FT                   /protein_id="ADQ16294.1"
FT                   /translation="MILLPYYVPLMDEIVPSIMHGIPVNTNVFILLAPFRKVPELLTRQ
FT                   KINKHLNITKFLVV"
FT   gene            complement(567078..567674)
FT                   /locus_tag="Lbys_0523"
FT   CDS_pept        complement(567078..567674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0523"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="InterPro IPR000595; KEGG: cpi:Cpin_4692 putative
FT                   transcriptional regulator, Crp/Fnr family; PFAM: cyclic
FT                   nucleotide-binding; SPTR: Putative transcriptional
FT                   regulator, Crp/Fnr family; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16295"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF0"
FT                   /protein_id="ADQ16295.1"
FT                   /translation="MLERKHFESVCRIVQNHGIVFTPDEFELIKAQTQHKILPAGTVLM
FT                   KQGKEVQSLYFLNRGIARLFRVEKDVDYTLGIISHRHFLSTPLYLQNGQLSSCALEALT
FT                   EVEVLEWNKGGALALKKAIPRMYEMEMAIMDRLLNWLQDHQIEAICMTAEERYKKIMET
FT                   QPEVIQQVPLKYIASLLAIHQDSLSRIRKQVTQRS"
FT   gene            567796..568497
FT                   /locus_tag="Lbys_0524"
FT   CDS_pept        567796..568497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0524"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="COGs: COG3279 Response regulator of the LytR/AlgR
FT                   family; InterPro IPR001789:IPR007492; KEGG: phe:Phep_3159
FT                   response regulator receiver; PFAM: LytTr DNA-binding
FT                   region; response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Response regulator receiver;
FT                   PFAM: Response regulator receiver domain; LytTr DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16296"
FT                   /db_xref="GOA:E4RXF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF1"
FT                   /protein_id="ADQ16296.1"
FT                   /translation="MGRKIALIVDSDIGHRRWLRECTPKSFALWECESGGEAVRYINSL
FT                   QPDLVLINVNVPSKNAFEVLDSVDHLPGVIFMSDHVQDAARAFEYQAIDYLVKPFSSAR
FT                   FLHALQRFEKSIESKRSIGTLYPNRIFVERGNRLISRSIAEVTHLKADKDYTWIHMKNG
FT                   ESYLSNLGIGHVERKLNPQIFIRIHRSYIVNLDFVMEMYRDAQRSFVTLVNGVEINVGR
FT                   NYRSAIKELIF"
FT   gene            complement(568913..569359)
FT                   /pseudo
FT                   /locus_tag="Lbys_0525"
FT   gene            569545..569652
FT                   /locus_tag="Lbys_0526"
FT   CDS_pept        569545..569652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16297"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF2"
FT                   /protein_id="ADQ16297.1"
FT                   /translation="MHPTSFVVDPKAFQDRQIKISTNLEKYNEPRKYLR"
FT   gene            570132..570482
FT                   /locus_tag="Lbys_0527"
FT   CDS_pept        570132..570482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lci:LCK_01285 alternansucrase; SPTR:
FT                   Alternansucrase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16298"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF3"
FT                   /protein_id="ADQ16298.1"
FT                   /translation="MKNTRYLLVLILFLSGCSSKTFIDGNNCNSKELLKTIKNATGTVH
FT                   FDGYSYVIRSSHDNSYDLVDVGFVCNMNDSLRKDGLKLQFDGQYFKYNGKEKPAFAGTT
FT                   YYYLSISNVTLK"
FT   sig_peptide     570132..570206
FT                   /locus_tag="Lbys_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            570492..570854
FT                   /locus_tag="Lbys_0528"
FT   CDS_pept        570492..570854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0528"
FT                   /product="peptidase M10A and M12B matrixin and adamalysin"
FT                   /note="InterPro IPR001818; KEGG: mcc:703867 matrix
FT                   metallopeptidase 12 (macrophage elastase); PFAM: peptidase
FT                   M10A and M12B matrixin and adamalysin; SPTR: LOC100127631
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16299"
FT                   /db_xref="GOA:E4RXF4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF4"
FT                   /protein_id="ADQ16299.1"
FT                   /translation="MEKFFTIALLLFCYGTTFGQEKGKPVYYDNWPTEIAANRDILKIK
FT                   YSTTAKYVPIGSIWSKRILTYFFANGTTDMSGNTERDAVTLGFTYWSNVYVFKLNRTFW
FT                   DKSLRSILVYKFNNFS"
FT   sig_peptide     570492..570548
FT                   /locus_tag="Lbys_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(570830..571813)
FT                   /locus_tag="Lbys_0529"
FT   CDS_pept        complement(570830..571813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0529"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG2801 Transposase and inactivated
FT                   derivatives; InterPro IPR001584; KEGG: nwi:Nwi_3112
FT                   helix-turn-helix, fis-type; PFAM: Integrase catalytic
FT                   region; SPTR: Helix-turn-helix, Fis-type protein; PFAM:
FT                   Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16300"
FT                   /db_xref="GOA:E4RXF5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF5"
FT                   /protein_id="ADQ16300.1"
FT                   /translation="MRLSAGEKYEVIQAVTTSELGVKRTLESFGIARSTFYGWYQNYLE
FT                   KGYEGLKPTGRTSKRQWNSIPEEQKDLVVGIALEHTELSSRELAHKITDEQGVFISESS
FT                   VYRILKQRDLIPAPNHYLLSAASEFKDKTEFVHQMWQTDFTYFKIIGWGWYYLSTILDD
FT                   YSRYIIHWEICDSMKAEDVKRTVNKAIEKAKLKSKTKPKLLSDNGSCYVSNELKTYLRE
FT                   DLKMKQVHGKPMHPQTQGKIERYHRTMKNVVKLNHFYHPEELVEALRKFVENYNNNRYH
FT                   ESLQNLTPADMYFGRSEVILKKRKEIKMNSINRRRQLYNQEKLLNL"
FT   gene            complement(571834..572247)
FT                   /locus_tag="Lbys_0530"
FT   CDS_pept        complement(571834..572247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0530"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: mch:Mchl_5506 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Transposase IS3/IS911; PFAM:
FT                   Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16301"
FT                   /db_xref="GOA:E4RXF6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF6"
FT                   /protein_id="ADQ16301.1"
FT                   /translation="MDTIFLNLKECFLKNELHLFMETPKKKSTEKFVKDIRKNTRRIFT
FT                   AEQKILIVMEGLRAETPVAELCRQHNIAQSQFYAWNKEFMEAGKKRLNGDVVREATSDE
FT                   VSDLKKENARLKEIVADLVLRYDIVKKSLDMLD"
FT   gene            complement(572798..575161)
FT                   /locus_tag="Lbys_0531"
FT   CDS_pept        complement(572798..575161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0531"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR000209; KEGG: pdi:BDI_3426 putative calcium
FT                   dependent protease; PFAM: peptidase S8 and S53 subtilisin
FT                   kexin sedolisin; SPTR: Putative calcium dependent protease;
FT                   PFAM: Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16302"
FT                   /db_xref="GOA:E4RXF7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF7"
FT                   /protein_id="ADQ16302.1"
FT                   /translation="MRKYILLLLLAIGVLPGFSQKFYRYVDNEKDILTISGDKFFVSLK
FT                   DSTYAENLSRVNFISKLDRIDNKGTYLISSTRKIDFSEVFEHLKNDSYVEFLSPVISSN
FT                   GKEMGGYTSKIIIKTKNEMSLEDIENIVDKYGLRVFEYSKFDKTTVFLQSKEKDASKNQ
FT                   EIANALHSSGIFEYADPNYLLFVNPASDPLYSSQWHLNNTGQVGGTTGEDIKAPGAWTV
FT                   TTGSSSIKIAILDSGVDLDHEDLTDNMGAGYDATGGSSNGDDWYFHGTAVAGVAAARGD
FT                   NSKGVRGVAYYSTIIPVRFYNSASGWSTTESGYLQSAIQWIRTGNRADIINMSFTITQT
FT                   TSLNSEINTAASSGRGGKGIVMVASSGNNNSTSIGYPSSNSNVISVGASNQFRQRVSPT
FT                   SSDGTSDSDFLGSNYGSGLDIVAPGLNIRSTNIAGTIPANFYLYYKGTSYSAPQVSGAA
FT                   ALVLSVNSNLTREQVKNILESTADKIGTYTYSSGAGENPSLTWNSEMGYGRLNACRAVT
FT                   IAKAGKINGSDLVCSNSTFTLDAIPAGATISWSSSNTGILTINSSTGVATRVGSGSGSV
FT                   TITSTLNASCGSVQLTKVVWVGNPDLTKRINGTIAGTTPVNPGNLYNLTAESQSPSTSF
FT                   NYNNYTGSGDMVIDIYYPNSANTQMYVYGTSTNGSRHVRVTATNSCGSYYQDFVFYIPS
FT                   FFKSVYPNPAKDYLTLDFNDLTEKATLPDAIELYNEASMKKELVLNIDDVLKDTKNQQG
FT                   NKYILDIKDLKRGVWYLHAVKKGYKTEVIRLLFE"
FT   sig_peptide     complement(575105..575161)
FT                   /locus_tag="Lbys_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(575163..575648)
FT                   /locus_tag="Lbys_0532"
FT   CDS_pept        complement(575163..575648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppa:PAS_chr3_0966 Vacuolar membrane zinc
FT                   transporter; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16303"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF8"
FT                   /protein_id="ADQ16303.1"
FT                   /translation="MKLLFYLSLLAILSLSSCKEQSFNQEIPYTSLADLSKEAEFRFSI
FT                   KSSSLGNYPILDDGEVRTSDYLVVINDENAYLNEVVTKYEHPFINFSTHTLLVLGIEYR
FT                   GTVTLKPRKEGNKTILTVIKKIPELGPQGTVFNTFSAIVPKVDSTNVIKELIEVNVK"
FT   sig_peptide     complement(575577..575648)
FT                   /locus_tag="Lbys_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(575766..576545)
FT                   /pseudo
FT                   /locus_tag="Lbys_0533"
FT   gene            complement(576647..576913)
FT                   /locus_tag="Lbys_0534"
FT   CDS_pept        complement(576647..576913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0534"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: dap:Dacet_1482 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Transposase ORF-A, IS-type; PFAM:
FT                   Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16304"
FT                   /db_xref="GOA:E4RXF9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXF9"
FT                   /protein_id="ADQ16304.1"
FT                   /translation="MKTSKFNPTQIAKILKEFESGKDVDSIIREHGISKATFYKWRQRY
FT                   GGMEASELKRVKQLEEENAKLKRMYADLAIELDMAKYIIEKKL"
FT   gene            complement(577033..577764)
FT                   /locus_tag="Lbys_0535"
FT   CDS_pept        complement(577033..577764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0535"
FT                   /product="Integrase catalytic region"
FT                   /note="InterPro IPR001584; KEGG: sli:Slin_6766 integrase
FT                   catalytic region; PFAM: Integrase catalytic region; SPTR:
FT                   Putative transposase, ISSmu1; PFAM: Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16305"
FT                   /db_xref="GOA:E4RQU6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E4RQU6"
FT                   /protein_id="ADQ16305.1"
FT                   /translation="MDYILQETKTLLEGEFVDYGYYKTYRYLNQEKGLRIGAYRTYKLM
FT                   KENNLLKFQRSNTKRISRNWVKELVPIVQREFAFLEFDIKYVYIQGKRTNAQVLTILDV
FT                   FSRWQLGQYIANSIKSEDVINLFEQILQTYPMPKQFIVRNDNGSQFEALIVQEYLKQKG
FT                   ITQEFTKPATPQQNGHIEAYHSILESAVCQRFEFESLQEFKQVMIRWKKFYNFERIHGG
FT                   LHYKSPRKFLESIGVKIDPNW"
FT   gene            complement(577929..578237)
FT                   /locus_tag="Lbys_0536"
FT   CDS_pept        complement(577929..578237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0536"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="InterPro IPR002514; KEGG: sli:Slin_6765 transposase
FT                   IS3/IS911 family protein; PFAM: transposase IS3/IS911
FT                   family protein; SPTR: Putative transcriptional regulator,
FT                   Fis family protein; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16306"
FT                   /db_xref="GOA:E4RQU5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4RQU5"
FT                   /protein_id="ADQ16306.1"
FT                   /translation="MSKHRKTWSLEEKEKIVLHSIQHGVSYSSREFGVSTVSIYNWKEK
FT                   FEKLGKSGLEAGAMTDAERELKQLRRENEALKRIVAEKELAIQIKDSLLKKSQSLKK"
FT   gene            complement(578470..578925)
FT                   /pseudo
FT                   /locus_tag="Lbys_0537"
FT   gene            579058..579312
FT                   /locus_tag="Lbys_0538"
FT   CDS_pept        579058..579312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_5086 type IV secretion/conjugal
FT                   transfer ATPase; SPTR: Site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16307"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG2"
FT                   /protein_id="ADQ16307.1"
FT                   /translation="MHPTSFVGDPIKLVFDNNLYYENGIYRTPTMMQMFAHNSLKMKEK
FT                   GLLIYKKIGGNRNDFPLSEPTGSSIEHLDRILLFFERLK"
FT   gene            complement(579515..579679)
FT                   /locus_tag="Lbys_0539"
FT   CDS_pept        complement(579515..579679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zpr:ZPR_3089 hypothetical protein; SPTR:
FT                   Regulatory protein RteC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16308"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG3"
FT                   /protein_id="ADQ16308.1"
FT                   /translation="MNKFYNETLNKLENEISELEIETNFSVQKIETAIKFIIHSLTDLK
FT                   KFVLKNDFD"
FT   gene            complement(579914..582187)
FT                   /locus_tag="Lbys_0540"
FT   CDS_pept        complement(579914..582187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0540"
FT                   /product="multicopper oxidase type 3"
FT                   /note="COGs: COG2132 Putative multicopper oxidase; InterPro
FT                   IPR002355:IPR011707:IPR001117:IPR011706; KEGG:
FT                   fjo:Fjoh_0192 multicopper oxidase, type 3; PFAM:
FT                   multicopper oxidase type 3; multicopper oxidase type 1;
FT                   multicopper oxidase type 2; SPTR: Copper resistance
FT                   protein; PFAM: Multicopper oxidase; TIGRFAM:
FT                   copper-resistance protein, CopA family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16309"
FT                   /db_xref="GOA:E4RXG4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG4"
FT                   /protein_id="ADQ16309.1"
FT                   /translation="MNRYNKIPIRILQTVLILLCTQTLFAQRVVHYELYVKDTLVNYAG
FT                   KQKRAIAVNGQIPMPTLTFTEGDTAEIVVHNQLKESTSLHWHGVFLPNKEDGVPWLTQK
FT                   PIAPGTTYTYRFPIIQHGTHWYHSHSGLQEQIGMYGSFIMKKRSDDKTFRKGIDDLPTV
FT                   PIILSEWTNLNPDNINRMLHNANDWAAIKKGATQSYVEAIKEGKFGVKVTNEWKRMLAM
FT                   DVSDVYYDKILINGSNAPELKTVDGKTLKAGDKVRLRISNGGASSYFWLRYAGGKITVV
FT                   ANDGNDVEPVEVDRLIIAVSETYDIVVTIPQDGLAYEFLATTEDRTQSASYFIGDGVKQ
FT                   LISPLPRLKYFEGMKMMNDMMKMNGDLDDMGMKMSLNQMDMNVVMYPEITGDATKKADH
FT                   SKHEGMDMDNDANRYNANALGEIKTLNYAMLQSPHNTTLPKDAPVKELKFTLTGNMNRY
FT                   VWSMDNKILSETDKIPVKKGEVLRITIYNNSMMRHPMHLHGFDFRVINGKGEKSPLKNV
FT                   LDIMPMETDIIEFLANEEGDWFFHCHILYHMMAGMNRVFEVGDYKNPYLPDKAKAYKEL
FT                   QRESNMPHFMAQNDFATNGNDGEAMLMNARYQLGTEWRLGYNSMHGYEVETHLGRYIGK
FT                   MQWFMPFVGFDWRYRKMGEDEHEKNIFGQINKKDTRRAFSVGFMYTLPMLVNFQAEVYH
FT                   DGIVRLQLMREDIPISKRLRGGFMVNTDLEYMGELRYIINKNIGIRTHYDSDMGFGVGL
FT                   ALTY"
FT   sig_peptide     complement(582110..582187)
FT                   /locus_tag="Lbys_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(582201..582656)
FT                   /locus_tag="Lbys_0541"
FT   CDS_pept        complement(582201..582656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rbi:RB2501_04695 hypothetical protein; SPTR:
FT                   Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16310"
FT                   /db_xref="GOA:E4RXG5"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG5"
FT                   /protein_id="ADQ16310.1"
FT                   /translation="MTIKKKIILGLAVVLIAIQFSQPLRNQAVEVPATHIERVYAVPQN
FT                   VKAILVQSCYDCHSNNTHYPWYSRIQPGAWYMAEHIKKGKEELNFSEFGDYSVRRQRNK
FT                   FRAMAGQVKDGEMPLSSYTLIHRNAVLSPEDKQVLIAWFSTMEDSIK"
FT   sig_peptide     complement(582534..582656)
FT                   /locus_tag="Lbys_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(582689..583108)
FT                   /locus_tag="Lbys_0542"
FT   CDS_pept        complement(582689..583108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmx:PERMA_0554 MlpB; SPTR: MlpB family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16311"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG6"
FT                   /protein_id="ADQ16311.1"
FT                   /translation="MSKIIIGFISLLALLFTACGQAGSNKDEAAQHHSQATPESHGHST
FT                   QIGELVPSDEVCMVNDAYMGKKQFDVKFDGKIYYGCCEMCKERIPKDATVRMAIDPYSH
FT                   KQVDKANAMIAVTGNNGEVSYFENKENYAKYVKKQ"
FT   sig_peptide     complement(583043..583108)
FT                   /locus_tag="Lbys_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(583134..583648)
FT                   /pseudo
FT                   /locus_tag="Lbys_0543"
FT   gene            complement(583669..584334)
FT                   /locus_tag="Lbys_0544"
FT   CDS_pept        complement(583669..584334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3066 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3347)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16312"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG7"
FT                   /protein_id="ADQ16312.1"
FT                   /translation="MKNLTLSIIAVIMAFVTVSCNQASNKNEQSSNDTAVVSQEQPASQ
FT                   PKEDDTVSAPAVSETPSGQEAKATGKEEAKNFSIAPIVTDYLSLKNALVSDDDKAAASS
FT                   GKKLLATLNKVDMKAVPADKHKKYMDIADDAKEHAEHIGENVGNIHHQREHLASLGEDL
FT                   KDLIDLFGTSQTLYQDHCPMFNDGKGAVWFSENKEIKNPYYGSKMLTCGKVEKTINSK"
FT   sig_peptide     complement(584245..584334)
FT                   /locus_tag="Lbys_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(584341..586461)
FT                   /locus_tag="Lbys_0545"
FT   CDS_pept        complement(584341..586461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0545"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR018303:IPR008250:IPR005834:IPR006403:IPR
FT                   006416:IPR001757:IPR000695; KEGG: zpr:ZPR_3414
FT                   copper-transporting ATPase, P-type (CopB); PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Copper-exporting ATPase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   copper-(or silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16313"
FT                   /db_xref="GOA:E4RXG8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG8"
FT                   /protein_id="ADQ16313.1"
FT                   /translation="MKKYTCPMHPQVLKDEPGKCPLCGMALVPVGDASVSLEHTSEHGH
FT                   SGHSQHGHADENFNKHEGHHTGDFLTRFWISLVITIPILLLSHMIQQWLGFSLAFNGDK
FT                   YVLLALGTVIYCYGGLPFLKGMIGEVKAKAIGMMTLVAIAISVAYVYSVAVVFGLQGMD
FT                   FFWELATLIDIMLLGHWLEMRSQMAASRALQSLVALLPNDVTVERGGEAVKIKLEDLQS
FT                   GETAIIKPGEKIPADGLVLEGLSYINESMLTGESIPVKKEKDGKVIAGSINGDGALKVK
FT                   VTAVGKDSYLNRVINLVQEAQATKSNTQNLADKVAKWLTFIAIAVGIGTFVYWYASSGD
FT                   IAFALERMVTVMVTACPHALGVAIPLVVAISTTLSATNGLLIRNRTAFETTRKLSTVIF
FT                   DKTGTLTKGSHAVEKVIPLTDEYNDDEVIQYAAAVQQNSEHHIAKGIMATLKEKSLTLW
FT                   KSENFSYMQGIGVKGVVNGKNVVAGGPNYFTENHLSLPEIPNEINQEAETVNFVLIDDR
FT                   VIGIITLADSIREGSAQAIEELKKMGIKSFLLTGDNDRIAAAVAGKLGMDGYLANVLPH
FT                   NKQEKVKEFQAKGEIVAMTGDGVNDAPALAQADVGIAVGSGTDVAAETADIILVDSDPR
FT                   DVVKLIDFGKLTYKKMVQNLIWAVGYNVVAIPLAAGVLYPNFILSPAMGAVLMSVSTIV
FT                   VAINASFLKIKK"
FT   gene            complement(586480..586785)
FT                   /locus_tag="Lbys_0546"
FT   CDS_pept        complement(586480..586785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0546"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /note="KEGG: zpr:ZPR_3413 phosphoribosylpyrophosphate
FT                   synthetase; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16314"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXG9"
FT                   /protein_id="ADQ16314.1"
FT                   /translation="MVQYNDMVQALKDLRQRGYSMDFSLLPDCLYCTSRSLKLKPEDFT
FT                   VTETHRFESLDSSPDNNAVIYAISSNDSKNKGVLVDAYGTYAEEMTHEMAKKLSAT"
FT   gene            complement(586800..587651)
FT                   /locus_tag="Lbys_0547"
FT   CDS_pept        complement(586800..587651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3064 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM:
FT                   Heavy-metal-associated domain; Protein of unknown function
FT                   (DUF3347)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16315"
FT                   /db_xref="GOA:E4RXH0"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXH0"
FT                   /protein_id="ADQ16315.1"
FT                   /translation="MVIAVLLSSINGFAQIKNAKTETVKIYGNCGMCKTTIEKAGNVKK
FT                   VASVDWNKDTKMATLTYDGDKTNQDEILKRIALAGYDSEKFRAPDDVYAKLAGCCQYDR
FT                   PVKTVAKNKEAGMDMNAGQGNHDHSQMAANKDAAQNQSQLKAVFDNYFSVKDALIKTDA
FT                   ATASANAAELAASLKAVDMNKLSAEEHTAWMKVMQDLTANAESISKSKDVAKQRSAFAA
FT                   LSESIYTLAKVSKQDTPIYYQHCPMYNGGKGANWLSKENAVINPYYGSQMLTCGSTVET
FT                   IK"
FT   sig_peptide     complement(587589..587651)
FT                   /locus_tag="Lbys_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(587813..588142)
FT                   /pseudo
FT                   /locus_tag="Lbys_0548"
FT   gene            complement(588388..589182)
FT                   /locus_tag="Lbys_0549"
FT   CDS_pept        complement(588388..589182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0549"
FT                   /product="cation efflux protein"
FT                   /note="COGs: COG1230 Co/Zn/Cd efflux system component;
FT                   InterPro IPR006121:IPR002524; KEGG: prw:PsycPRwf_0699
FT                   cation efflux protein; PFAM: cation efflux protein; SPTR:
FT                   Cation efflux protein; PFAM: Cation efflux family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16316"
FT                   /db_xref="GOA:E4RXH1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXH1"
FT                   /protein_id="ADQ16316.1"
FT                   /translation="MNKTIFNITKMDCPSEEQLIRMKLQDFDTVKSLEFDIPNRELNVY
FT                   HSGNPEPILSALETLNLNTTLISTEETDGVIETDTSNRQRRLLWTVLVINFVFFGVEML
FT                   FGIFSNSMGLVADSLDMLADSIVYALALFAVGGTVARKNNIAKFAGYFQILLAVIGFVE
FT                   VIRRFLGFEKMPDFQTMIIVSVLALMANVLCLYLLQKNKSKEAHMQASMIFTSNDVIIN
FT                   SGVIVAGLLVHWLNSSYPDLIIGAIVFVIVARGAYRILKLVE"
FT   gene            complement(589186..591357)
FT                   /locus_tag="Lbys_0550"
FT   CDS_pept        complement(589186..591357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0550"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG4771 Outer membrane receptor for
FT                   ferrienterochelin and colicins; InterPro IPR012910; KEGG:
FT                   bvu:BVU_4189 TonB-dependent outer membrane receptor; PFAM:
FT                   TonB-dependent receptor plug; SPTR: TonB-dependent outer
FT                   membrane receptor; PFAM: TonB-dependent Receptor Plug
FT                   Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16317"
FT                   /db_xref="GOA:E4RXH2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXH2"
FT                   /protein_id="ADQ16317.1"
FT                   /translation="MKKILIVSFFMALNLCVYAQNTLTAVVKSSGTKEPLIGVTASIKG
FT                   TSIGATSNENGQITLFNIPNGLQEIHFNYIGFNERIDTLEFPLKDTSVIEILLKESSEE
FT                   LDEIVISSTRSTRSIQNIPTRIEFIGGEELDEKGNMKAGDIRMLLSESTGIHVQTTSPT
FT                   SANASIRIQGLDGRYTQILKDGFPIYSGASSGLGLLQIPPLDLKQVEVIKGSTSTLYGG
FT                   GAIAGLVNLISKTPTEERDLRFHLNGTSGRGLDINGFYGQKFNKIGTTIFASHNRNVAY
FT                   DPAQIGLSAIPQFERYVLNPKLFVYFNDKTKMNFGINATIENRLGGDMLYIKGKADNTH
FT                   QFFEENKTQRYSTQFVFDHTVNENSFVQVKNSVSYFNRNTAIPNYEFEGTQTATFTEAS
FT                   YTHSKEKSEWITGVNIWTDNFKEKQITSFPLRDYNQTTFGAFVQNSFRATDWFQLETGL
FT                   RTDYVVDYGAVFLPRVSALFHIANGLTSRIGGGFGYKTPTIFTEESERIQYQNVMPIYD
FT                   NTNKLEKSYGANADFNYRTNMGDDWTFSINHLFFYTYLDNPLLLQNMATNTYQFINSSG
FT                   YIHTKGTETNVKIGYDDLKLFLGYTFTDTRLLENGTSTENPLTPKHRVNSVLMYEIEDK
FT                   WKIGLEAYYFSPQKLNDGTTGKDYWMCGFMAEKIWERFSLYINFENFLDTRQTRFDNIY
FT                   TGTITNPVFRDIYAPLDGFVINGGIKFKL"
FT   sig_peptide     complement(591271..591357)
FT                   /locus_tag="Lbys_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(591443..591754)
FT                   /locus_tag="Lbys_0551"
FT   CDS_pept        complement(591443..591754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvu:BVU_4190 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16318"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXH3"
FT                   /protein_id="ADQ16318.1"
FT                   /translation="MKYLSFILALMVLVLSTAPCFMEDKCLDLAQQTTDSQEQDNDDCG
FT                   MDWCSPFSKCNTCTGFVITSFYFSIANSFQLPEKKLGVITTSPISDFPYSIWHPPQIA"
FT   sig_peptide     complement(591689..591754)
FT                   /locus_tag="Lbys_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(591887..592626)
FT                   /pseudo
FT                   /locus_tag="Lbys_0552"
FT   gene            complement(593871..594065)
FT                   /locus_tag="Lbys_0553"
FT   CDS_pept        complement(593871..594065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgt:cgR_0748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16319"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXH4"
FT                   /protein_id="ADQ16319.1"
FT                   /translation="MSIYTALITFFVTLKNSVTESSNSTSSEGVTLPAPPKSSPVRLVI
FT                   WLSKGFKDCMVTENALVKE"
FT   sig_peptide     complement(594009..594065)
FT                   /locus_tag="Lbys_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            594090..595556
FT                   /locus_tag="Lbys_0554"
FT   CDS_pept        594090..595556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0554"
FT                   /product="Resolvase domain"
FT                   /note="COGs: COG1961 Site-specific recombinase DNA
FT                   invertase Pin homologs; InterPro
FT                   IPR006118:IPR006119:IPR011109; KEGG: zpr:ZPR_3496
FT                   site-specific recombinase; PFAM: Resolvase domain;
FT                   Recombinase; SPTR: Site-specific recombinase; PFAM:
FT                   Recombinase; Resolvase, N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16320"
FT                   /db_xref="GOA:E4RXZ2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ2"
FT                   /protein_id="ADQ16320.1"
FT                   /translation="MKTAYLYIRVSTDEQKRRGYSLPEQEDRLLKYCEFNNIEVKGIFR
FT                   EDYSAKTFNRPEWKKLITVIKSRSSKDDKSILFIKWDRFSRNIENAYEMIGMLRKHKTT
FT                   AMAIDQPIDFSVPESTVMLAVYLSVPEAENSRRAMNTANGIRRAKLMGRYPGKAPLGFI
FT                   NLTTVDGKKVIVPKQPEAGIIKWVFHQLAKNIHRVEDVRRMADDKGLKCSRSYFFKLIR
FT                   NPAYCGLIPIKLSSREQHMVKGIHDPLIAETLFYEVQRIILTKTKTVRKTDNLKATFFL
FT                   TGFLTCPLCGRKMLGSFSQGSRKKYPYYHCRGKCKTRISASLLNDSYEQELQKLVLSDK
FT                   AVDLFNCVLEDWNTSTQKTEYLQERRQVEKKLKEQELFFSQARKLFVSSVLNLDDYKEI
FT                   KKEYHINSKGLRGELEDINVKLMRIDKQRQQVGQPIVNILHGFSEMDATDKKHLVALIP
FT                   PIKVDCHTKAVSLDICRALSRILIPVYSNI"
FT   gene            595561..595758
FT                   /locus_tag="Lbys_0555"
FT   CDS_pept        595561..595758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0555"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16321"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ3"
FT                   /protein_id="ADQ16321.1"
FT                   /translation="MSFLDKKVSTKRAIDILEKNGTQVDEGDAVIILDFLYLIAKNSNM
FT                   LEVDQNSPTLKRNRTSGKIL"
FT   gene            complement(595916..595987)
FT                   /locus_tag="Lbys_R0009"
FT   tRNA            complement(595916..595987)
FT                   /locus_tag="Lbys_R0009"
FT                   /product="tRNA-Glu"
FT   gene            596186..597187
FT                   /locus_tag="Lbys_0556"
FT   CDS_pept        596186..597187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0556"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   fjo:Fjoh_3463 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: Candidate
FT                   beta-glycosyltransferase; Glycosyltransferase family 2;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16322"
FT                   /db_xref="GOA:E4RXZ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ4"
FT                   /protein_id="ADQ16322.1"
FT                   /translation="MQILFSLIVPVYNRPQEIDELLASLCEQTVKPFEVVIVEDGSNLR
FT                   SEDVVKRYQDKLQITYFYKSNSGPGDSRNFGMKNATGNYFLILDSDCILPPDYLKQAHA
FT                   ALEKDYVDCFGGVDTALATFTPVQKAINFAMTSVLTTGGVRGGSEKLGKFQPRSFNMGL
FT                   SRKAFDASGGFGSIHPGEDPDLSFRLWKLGFETRLFSQVSVYHKRRIDWDKFYTQVNKF
FT                   GKVRPILNLWHPEYKKLTYWFPSLFLIGGIGSFICALVGYPVFLLAYLLYFFVCFVMAS
FT                   LEYKSMSIGGMACRAVFTQFLGYGSGFLLSFLKLKKESPEKAFPELFFNKRS"
FT   gene            complement(597164..598456)
FT                   /locus_tag="Lbys_0557"
FT   CDS_pept        complement(597164..598456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0557"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="COGs: COG0001 Glutamate-1-semialdehyde
FT                   aminotransferase; InterPro IPR005814:IPR004639; KEGG:
FT                   sli:Slin_2012 glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; SPTR:
FT                   Glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   Aminotransferase class-III; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16323"
FT                   /db_xref="GOA:E4RXZ5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ5"
FT                   /protein_id="ADQ16323.1"
FT                   /translation="MIKKSEKAFQEAVNYIPGGVNSPVRAFKSVGGTPRFIKRAKGAYL
FT                   TDEDNTKYIDLIGSWGPMILGHAFEPVENAVRKAIKSSFSFGAPTVKEVEMAKLICDLV
FT                   PSVEMVRMVNSGTEATMSAIRLARAYTGKNKIIKFEGCYHGHGDAFLISAGSGALSLGV
FT                   PDSPGITPSTLGDTLTAPYNDLDAVKRLLETHKGEVAALIIEPVVGNMGCVLPKEGYLQ
FT                   GLRDLCTKEGVVFIFDEVMTGFRLALGGAQERFGITPDLTTMGKIIGGGMPVGAYGGKK
FT                   EIMQMVAPSGPMYQAGTLSGNPIAMSAGMAMLKHLKKHPEIYAQLDETGAFIAEGLRKS
FT                   VKELGLNYTVNQIGSMYSLFFTSEHVVDFKTAKTADIPAFSKYFHQMLNRGVYLAPSQF
FT                   ESLFLSTKIDKRIANKILRASHYSLTSLVEE"
FT   gene            complement(598453..600078)
FT                   /locus_tag="Lbys_0558"
FT   CDS_pept        complement(598453..600078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sli:Slin_2013 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16324"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ6"
FT                   /protein_id="ADQ16324.1"
FT                   /translation="MKKAFLTFLLLPGLLWAQSIDYLSQYKEGVALFKEGNFEGASAKF
FT                   SNLTNKNYDNKVAPYAFLYAAQSAEKKGNKYQAKILYRNLLTYYPNWDKIDEARILYAQ
FT                   NNLADGYYEEGLKALHEIENEKYNGLKLQVMEDHMKNVKTIAALKQLYAKYPNYRPIAK
FT                   ALVNKIQANRYNTKADLEMSDMLTNRFKLSEEEKPKTTTKGKAEGLHFGLLLPFELQAS
FT                   DPTLPAYRYIYDLYAGMQMAQEKLGNEGTALYLHPFDIKNDANAYKLAEKKPGFEEIQL
FT                   FVGPLYAAPNSLAQKHIMDKNLIQVHPTSNNLDLIKDHKNAFLVQPSHAQQANKALDFA
FT                   AKEGWAKTVSIYYGDSRKDSLFASIYAGEAKKRGYTVLEFKRFTTQKLKPQKGHLFLAA
FT                   DNNLGVKFLQNAAMNQVECEIIMTASSLSWDRINTSVLTEKVALIYPEFVNRNREVVQE
FT                   FEKAYFDKHFALPSYYSYLGYDIVYYFGNRLKKGKSSFDREVNRGEYIDDFLLGGYDFS
FT                   KKVKQNDIVPIVKFRDQNFEEVYR"
FT   sig_peptide     complement(600028..600078)
FT                   /locus_tag="Lbys_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(600124..601959)
FT                   /locus_tag="Lbys_0559"
FT   CDS_pept        complement(600124..601959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0559"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="COGs: COG0706 Preprotein translocase subunit YidC;
FT                   InterPro IPR001708:IPR019998:IPR020001; KEGG: dfe:Dfer_1150
FT                   putative inner membrane protein translocase component YidC;
FT                   PFAM: 60 kDa inner membrane insertion protein; SPTR: 60 kDa
FT                   inner membrane insertion protein; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family; membrane protein insertase,
FT                   YidC/Oxa1 family domain containing; PFAM: 60Kd inner
FT                   membrane protein; TIGRFAM: membrane protein insertase,
FT                   YidC/Oxa1 family, C-terminal domain; membrane protein
FT                   insertase, YidC/Oxa1 family, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16325"
FT                   /db_xref="GOA:E4RXZ7"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ7"
FT                   /protein_id="ADQ16325.1"
FT                   /translation="MENKIDKNYIIGLLLMVLMFTAYSIFYTPSNPTTPEKTEVTSTTK
FT                   TAPKAVNPILDSTTAAAPEKEIVVENKDIKVTFSSRGGVIKQVALKDYKTYADYIGGKD
FT                   KAEMVIFDGSKSNLDFEIPTATGALKLSQVNFHTDAVNATVAEGQPLTLVFSTQIQGGT
FT                   LQKTYTLNDKGFEIQHGISTQGLEAVVRNAPIVLNWENHLQVLENDLNENRKGSQINYF
FT                   DKEENFEDLGGNSTSNANEEAELPVKWFSFHQKYFTSGIVFENSFFQKAKFNMETPTAD
FT                   ESVVKIGTATAEIAYADFIGNKTSFKYYFGPNELKELKAVGYDFQKNLYLGYDIVKPIN
FT                   RYIFVPLFTWVESFVSNYGLLIIVVVLIIKLVLTPLIYKSYMSSAKMRVLAPEINAIKE
FT                   KVGDDPVKLQQETMKLYQQVGVNPLSGCIPLLLQMPILMSVFFLFPNLVMFRQKEFLWA
FT                   KDLSTYDNLISWGFNMPILGNHLSLFVVLMTISSLAFTYYNNQNTPDQPGPVDMKKISY
FT                   IFPVVFMFVLNSFPAALSFYYLVSNLVTIAQQLIVKRFVNEEKILSILENNKRNYHSKP
FT                   QKKNKFSDFLEKQMQASEEMKRKSEELKKQQKKRN"
FT   sig_peptide     complement(601888..601959)
FT                   /locus_tag="Lbys_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            602106..602804
FT                   /locus_tag="Lbys_0560"
FT   CDS_pept        602106..602804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0560"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959:IPR003593; KEGG: cpi:Cpin_2822 AAA ATPase central
FT                   domain protein; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase; SPTR: ATPase central domain protein;
FT                   PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16326"
FT                   /db_xref="GOA:E4RXZ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ8"
FT                   /protein_id="ADQ16326.1"
FT                   /translation="MHISDLTLTDTRNISLKDIFLSNDNRLALEQVLKEFHYKSRLEEY
FT                   GLPVQHKILLYGPSGCGKTMTASAIANGLGKKLYILHLSNLVSSRIGETGQHLKSVFDK
FT                   ANREQAVLFLDEFDHIGKARGADDKDVGEMRRLVNSLIQLIDQCSALLIAATNHVEILD
FT                   PALIRRFQARMGFEMPTKEQLDHYYDQIVFRFPKGVQLIERAYGISYAEAQDLAFRQIK
FT                   SKLISQWELD"
FT   gene            602991..603254
FT                   /locus_tag="Lbys_0561"
FT   CDS_pept        602991..603254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0561"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="InterPro IPR000504; KEGG: cli:Clim_2119 RNP-1 like
FT                   RNA-binding protein; PFAM: RNP-1 like RNA-binding protein;
FT                   SMART: RNP-1 like RNA-binding protein; SPTR: RNP-1 like
FT                   RNA-binding protein; PFAM: RNA recognition motif. (a.k.a.
FT                   RRM, RBD, or RNP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16327"
FT                   /db_xref="GOA:E4RXZ9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E4RXZ9"
FT                   /protein_id="ADQ16327.1"
FT                   /translation="MNIFVAKLSFDTQDAGLREAFENFGEVKSAKVIMDNYTGRSKGFG
FT                   FVEMNDHAEASNAIRSLNDSELDGRTIVVKQAEERGQRSSRY"
FT   gene            complement(603304..603549)
FT                   /locus_tag="Lbys_0562"
FT   CDS_pept        complement(603304..603549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0562"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="InterPro IPR000504; KEGG: pfh:PFHG_04109 conserved
FT                   hypothetical protein; PFAM: RNP-1 like RNA-binding protein;
FT                   SMART: RNP-1 like RNA-binding protein; SPTR: Nucleolar
FT                   protein 4; PFAM: RNA recognition motif. (a.k.a. RRM, RBD,
FT                   or RNP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16328"
FT                   /db_xref="GOA:E4RY00"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY00"
FT                   /protein_id="ADQ16328.1"
FT                   /translation="MKILIHNLPTTIKNCDLFKLFRPHGEVEDISIPYNILGYGQGHAY
FT                   VKMKNKKEGEIAIQNLQNLEIEGTNVIVEEWYTPLD"
FT   gene            complement(603754..604479)
FT                   /locus_tag="Lbys_0563"
FT   CDS_pept        complement(603754..604479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0563"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR001537;
FT                   KEGG: vha:VIBHAR_01509 hypothetical protein; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); SPTR: RNA
FT                   methyltransferase TrmH family; PFAM: SpoU rRNA Methylase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16329"
FT                   /db_xref="GOA:E4RY01"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY01"
FT                   /protein_id="ADQ16329.1"
FT                   /translation="MISKQQQKYIQSLHNKKYRTEYGQFLVEGEKGISELLHSDYQIIQ
FT                   IYITEEFAQKLPTHKNLMVAPVTQIESVSTYKSNASGIAVVQQKRFEVPENFQGRILIL
FT                   DGLRDPGNLGTIIRLADWYGIEHLICSEDTVEFYNPKVISSTMGSFTRVKPYYLDIHSF
FT                   MEKYPHPILGADLEGQNVHKWDFPKNMALVIGSESHGISAETERQLTDKVNIPRIGKAE
FT                   SLNAAMATGIILDNMFREI"
FT   gene            604497..606995
FT                   /locus_tag="Lbys_0564"
FT   CDS_pept        604497..606995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0564"
FT                   /product="surface antigen (D15)"
FT                   /note="COGs: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; InterPro IPR000184; KEGG: dfe:Dfer_2726
FT                   surface antigen (D15); PFAM: surface antigen (D15); SPTR:
FT                   Surface antigen (D15); PFAM: Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16330"
FT                   /db_xref="GOA:E4RY02"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY02"
FT                   /protein_id="ADQ16330.1"
FT                   /translation="MLKPLLHILTLLAGLSLFSCKNNIPPPQNKLLLWKNQFKGQEKVF
FT                   KEELELIIPFAQRENSKPFSLPITPRVWWYNFGQNNFDSLKTARRWANKKLALERLKSE
FT                   EGYSLKKAAKWERKMERYETALENKISWFYANIGEPQVYISPEDVQETASRIQKYLFDR
FT                   GFRDAQVAGDTIRLGKKQRYNVRYQIQEGDLYRIDSLFYVVNHPVMDSLLQADVKNRLL
FT                   KSGDPLHHQQVEAEKLRLEQLFKNNGFYSFNNRYITYGVTNYEQSEELFKERKEGNLQL
FT                   QILNPVLGSHKQYYLRDVIFKTFDPNSKNSRPDTTVIRGVKFIRPDHSVPLSLIRNRIF
FT                   TKPGDLFSNAAIYETQRQISLFNQFSFASSQLKVVDSTHLDLEYFAPVQERFTFGISPG
FT                   INNIYTDGNSFFGFGVPVSLSMRNVLRKLEIIELGVRGSYEGQPTPIRTSENAIRGSLE
FT                   LGGNLNITLPVLFPFHPKGRRVNLMNPRTTFGIGYNYSEPFWGTRTNFKLTAGNSLQLN
FT                   KYAILYMNFLDAYLINTSYSNNASGREFYRTLDSLQRIGNNLKVTFDPQFVSSINANYV
FT                   YNNQDPSKPFSTSTFFRFFIESAGTVLNFTKDKERIGLVEDLFPMSAGPDSVRAYFQFL
FT                   KFNADYRRSINLSPKSSYAFRVNLGVANPYGKNKAIPYDKSFFVGGSNSIRAWAPRSLG
FT                   TGSSASDTTAVGNTIPQPGDILLEGSIEYRRNIIRFAGNIQLALFMDAGNVWKWHQINI
FT                   PERYNKSNFDFGRFYKEIAVGTGFGVRWDLGFFLFRFDWGIKVVDPSREEGDRFVLDKF
FT                   SLRRRAPYGLNLNFGIGYPF"
FT   sig_peptide     604497..604559
FT                   /locus_tag="Lbys_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            607073..607420
FT                   /locus_tag="Lbys_0565"
FT   CDS_pept        607073..607420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0565"
FT                   /product="bleomycin resistance protein"
FT                   /note="KEGG: fba:FIC_01904 bleomycin resistance protein;
FT                   SPTR: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16331"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY03"
FT                   /protein_id="ADQ16331.1"
FT                   /translation="MWKSVCPKLPMRNNFITQEYYVKGLEFEVLGDYGDYLMLKRDEVE
FT                   LHFFLFEALDPYQNYGQIYIRVEDIKKIYSGIKVVIYRLLEDKPWGQREFSLLDPDHNL
FT                   ITFGEDIPSLK"
FT   gene            607821..608420
FT                   /locus_tag="Lbys_0566"
FT   CDS_pept        607821..608420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_3233 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16332"
FT                   /db_xref="GOA:E4RY04"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY04"
FT                   /protein_id="ADQ16332.1"
FT                   /translation="MNFIAKVSAYGFILLFILLHLLKPEIDPTWQPFSYYLIGEYGWLM
FT                   QCAFLLLSLSFFTFALGVIKVLQTWRSKMGAVLFVLAGIGNVLCAFFYPDPLHAEPTLH
FT                   GQWHAIGFSLLGAALLGTLFICLQFYRQSDVSLFRGRILFATVLFGAIEISMIFGMLLY
FT                   FDGPESAMGGLGRLVILMSAIWVIITSNALANKSVV"
FT   sig_peptide     607821..607892
FT                   /locus_tag="Lbys_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(608427..609185)
FT                   /locus_tag="Lbys_0567"
FT   CDS_pept        complement(608427..609185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0567"
FT                   /product="O-methyltransferase-like protein"
FT                   /note="COGs: COG4122 O-methyltransferase; KEGG:
FT                   cpi:Cpin_6507 O-methyltransferase-like protein; SPTR:
FT                   O-methyltransferase-like protein; PFAM:
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16333"
FT                   /db_xref="GOA:E4RY05"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY05"
FT                   /protein_id="ADQ16333.1"
FT                   /translation="MLFDFLRYYIKAGNAHSIHSPFVFELYTKIYKDFTPQEEFQELEN
FT                   LRKKLRADDRAIQITDFGAGSHYKNRTIKDIAKHALKSPFWAQFFYRIIRHYNYSHILE
FT                   LGTSLGLTTSYLAKAAPTGKVYTLEGCPQTLQVAEENFDQLELSHIHTYVGNIDQTLPD
FT                   LLERIEKLDFALLDANHRYTPTLSYFEQCLAKVHERSVLVFDDIYWSDEMKKAWQEIQK
FT                   RKEVSLSLDFFHVGMVFFRKGVEKQHFVLK"
FT   gene            complement(609187..609573)
FT                   /locus_tag="Lbys_0568"
FT   CDS_pept        complement(609187..609573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0568"
FT                   /product="ApaG domain protein"
FT                   /note="COGs: COG2967 Uncharacterized protein affecting
FT                   Mg2+/Co2+ transport; InterPro IPR007474; KEGG:
FT                   sli:Slin_0247 ApaG domain protein; PFAM: ApaG domain
FT                   protein; SPTR: ApaG domain protein; PFAM: Protein of
FT                   unknown function (DUF525)"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16334"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY06"
FT                   /protein_id="ADQ16334.1"
FT                   /translation="MITAITHGIKVSVKPEYQPFYSQPARNLYAFSYTINIENTTDVTV
FT                   KLLTRHWEIFDSYGTAYEVNGEGVVGLFPIIEPGESFEYTSGCNFASTVGKMQGKYIMQ
FT                   RVRDGKTFEISIPEFLLEVPYILN"
FT   gene            609657..610316
FT                   /locus_tag="Lbys_0569"
FT   CDS_pept        609657..610316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0569"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="COGs: COG0692 Uracil DNA glycosylase; InterPro
FT                   IPR002043:IPR018085:IPR005122; KEGG: bvu:BVU_4148
FT                   uracil-DNA glycosylase; PFAM: Uracil-DNA glycosylase
FT                   superfamily; SPTR: Uracil-DNA glycosylase; TIGRFAM:
FT                   uracil-DNA glycosylase; PFAM: Uracil DNA glycosylase
FT                   superfamily; TIGRFAM: uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16335"
FT                   /db_xref="GOA:E4RY07"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY07"
FT                   /protein_id="ADQ16335.1"
FT                   /translation="MKIHESWKEVLAEEFEKPYFERLKEYVRQEYGTQVCYPPGRLIFE
FT                   AFNQTPFEEVKVVILGQDPYHGPGQAHGLSFSVPPGVAFPPSLRNIFKELKDDVGKEVP
FT                   MSGDLTEWARQGVLLLNATLSVRAGQAGSHQNQGWETFTDAVIHLLNQRKENLVFLLWG
FT                   AYAQNKGKFIDPNRHLVLKAKHPSPLSANSGGWFGTKHFSKTNEYLQQLGKPEIKW"
FT   gene            610331..611437
FT                   /locus_tag="Lbys_0570"
FT   CDS_pept        610331..611437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0570"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="COGs: COG0116 N6-adenine-specific DNA methylase;
FT                   InterPro IPR004114:IPR002052:IPR000241; KEGG: fjo:Fjoh_2495
FT                   putative RNA methylase; PFAM: RNA methylase; THUMP
FT                   domain-containing protein; PRIAM: rRNA
FT                   (guanine-N(2)-)-methyltransferase; SPTR: Putative RNA
FT                   methylase; PFAM: Putative RNA methylase family UPF0020;
FT                   THUMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16336"
FT                   /db_xref="GOA:E4RY08"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY08"
FT                   /protein_id="ADQ16336.1"
FT                   /translation="MVATTLMGLEDVLAKEIKALGGEKVKVLKRAVSFVGDDALLYKAN
FT                   LSLRTALRVLVPLIEFRAHNEEKLYREVKDFPWEDVFSLEQTFIIDAVLSGTVFRHSQF
FT                   LALKTKDAIVDRFRERTGQRPSIDTQNPDIYLNIRVHEDKVTLSINSSGVSLDRRGYRR
FT                   VSNEAPINEVLAAGIILHTGWNPTQPFIDPMAGSGTFSIEAALIGTGIPSGWNRSFSFQ
FT                   NWLEFDANLYEKVRFELNKKISDPNLQIHARDLLNSSLELIAKNAEKAGVEDYLSLKKE
FT                   DFFESEPKGSGGVVVLNPPYGERLKISNADAFYKKMGDTLKQRYKGFDAWIISSDLDAL
FT                   RSIGLRAEEKIEMMNGGLPARLLKFEMF"
FT   gene            611439..611714
FT                   /locus_tag="Lbys_0571"
FT   CDS_pept        611439..611714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0571"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="InterPro IPR019887; KEGG: mmw:Mmwyl1_0222 AsnC
FT                   family transcriptional regulator; PFAM: Transcription
FT                   regulator AsnC-type-like; SPTR: Putative transcriptional
FT                   regulator, AsnC family; PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lbys_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ16337"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:E4RY09"
FT                   /protein_id="ADQ16337.1"
FT                   /translation="MVTAVILFSVERSHINAVGEELAGTKGITEVFSVSGQYDLVALAR
FT                   VQKNEDLADLMTKTIGNLPGIIKTETLIAFRTLSKYDLESMFDLGS"
FT   gene            complement(611703..612053)
FT                   /locus_tag="Lbys_0572"
FT   CDS_pept        complement(611703..612053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lbys_0572"
FT                   /product="Uncharacterized conserved protein UCP033199"
FT                   /note="COGs: COG4898 conserved hypothetical protein;
FT                   InterPro IPR014580; KEGG: cpi:Cpin_6024 hypothetical
FT                   protein; PFAM: Uncharacterised conserved protein UCP033199;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2200)"
FT