(data stored in ACNUC13767 zone)

EMBL: CP002330

ID   CP002330; SV 1; circular; genomic DNA; STD; PRO; 2843785 BP.
XX
AC   CP002330; AEKB01000001-AEKB01000080;
XX
PR   Project:PRJNA52409;
XX
DT   19-NOV-2010 (Rel. 106, Created)
DT   10-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Caldicellulosiruptor kronotskyensis 2002, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Caldicellulosiruptor kronotskyensis 2002
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacterales Family III. Incertae Sedis; Caldicellulosiruptor.
XX
RN   [1]
RP   1-2843785
RX   DOI; 10.1128/JB.01515-10.
RX   PUBMED; 21216991.
RA   Blumer-Schuette S.E., Ozdemir I., Mistry D., Lucas S., Lapidus A.,
RA   Cheng J.F., Goodwin L.A., Pitluck S., Land M.L., Hauser L.J., Woyke T.,
RA   Mikhailova N., Pati A., Kyrpides N.C., Ivanova N., Detter J.C.,
RA   Walston-Davenport K., Han S., Adams M.W., Kelly R.M.;
RT   "Complete genome sequences for the anaerobic, extremely thermophilic plant
RT   biomass-degrading bacteria Caldicellulosiruptor hydrothermalis,
RT   Caldicellulosiruptor kristjanssonii, Caldicellulosiruptor kronotskyensis,
RT   Caldicellulosiruptor owensensis, and Caldicellulosiruptor lactoaceticus";
RL   J. Bacteriol. 193(6):1483-1484(2011).
XX
RN   [2]
RP   1-2843785
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Davenport K., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Mikhailova N.,
RA   Blumer-Schuette S.E., Kelly R.M., Woyke T.;
RT   "Complete sequence of Caldicellulosiruptor kronotskyensis 2002";
RL   Unpublished.
XX
RN   [3]
RP   1-2843785
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Davenport K., Detter J.C., Han C., Tapia R., Land M.,
RA   Hauser L., Jeffries C., Kyrpides N., Ivanova N., Mikhailova N.,
RA   Blumer-Schuette S.E., Kelly R.M., Woyke T.;
RT   ;
RL   Submitted (12-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4e8566861dd3cc0d2b582f7863c783fc.
DR   EnsemblGenomes-Gn; Calkro_R0001.
DR   EnsemblGenomes-Gn; Calkro_R0002.
DR   EnsemblGenomes-Gn; Calkro_R0003.
DR   EnsemblGenomes-Gn; Calkro_R0004.
DR   EnsemblGenomes-Gn; Calkro_R0005.
DR   EnsemblGenomes-Gn; Calkro_R0006.
DR   EnsemblGenomes-Gn; Calkro_R0007.
DR   EnsemblGenomes-Gn; Calkro_R0008.
DR   EnsemblGenomes-Gn; Calkro_R0009.
DR   EnsemblGenomes-Gn; Calkro_R0010.
DR   EnsemblGenomes-Gn; Calkro_R0011.
DR   EnsemblGenomes-Gn; Calkro_R0012.
DR   EnsemblGenomes-Gn; Calkro_R0013.
DR   EnsemblGenomes-Gn; Calkro_R0014.
DR   EnsemblGenomes-Gn; Calkro_R0015.
DR   EnsemblGenomes-Gn; Calkro_R0016.
DR   EnsemblGenomes-Gn; Calkro_R0017.
DR   EnsemblGenomes-Gn; Calkro_R0018.
DR   EnsemblGenomes-Gn; Calkro_R0019.
DR   EnsemblGenomes-Gn; Calkro_R0020.
DR   EnsemblGenomes-Gn; Calkro_R0021.
DR   EnsemblGenomes-Gn; Calkro_R0022.
DR   EnsemblGenomes-Gn; Calkro_R0023.
DR   EnsemblGenomes-Gn; Calkro_R0024.
DR   EnsemblGenomes-Gn; Calkro_R0025.
DR   EnsemblGenomes-Gn; Calkro_R0026.
DR   EnsemblGenomes-Gn; Calkro_R0027.
DR   EnsemblGenomes-Gn; Calkro_R0028.
DR   EnsemblGenomes-Gn; Calkro_R0029.
DR   EnsemblGenomes-Gn; Calkro_R0030.
DR   EnsemblGenomes-Gn; Calkro_R0031.
DR   EnsemblGenomes-Gn; Calkro_R0032.
DR   EnsemblGenomes-Gn; Calkro_R0033.
DR   EnsemblGenomes-Gn; Calkro_R0034.
DR   EnsemblGenomes-Gn; Calkro_R0035.
DR   EnsemblGenomes-Gn; Calkro_R0036.
DR   EnsemblGenomes-Gn; Calkro_R0037.
DR   EnsemblGenomes-Gn; Calkro_R0038.
DR   EnsemblGenomes-Gn; Calkro_R0039.
DR   EnsemblGenomes-Gn; Calkro_R0040.
DR   EnsemblGenomes-Gn; Calkro_R0041.
DR   EnsemblGenomes-Gn; Calkro_R0042.
DR   EnsemblGenomes-Gn; Calkro_R0043.
DR   EnsemblGenomes-Gn; Calkro_R0044.
DR   EnsemblGenomes-Gn; Calkro_R0045.
DR   EnsemblGenomes-Gn; Calkro_R0046.
DR   EnsemblGenomes-Gn; Calkro_R0047.
DR   EnsemblGenomes-Gn; Calkro_R0048.
DR   EnsemblGenomes-Gn; Calkro_R0049.
DR   EnsemblGenomes-Gn; Calkro_R0050.
DR   EnsemblGenomes-Gn; Calkro_R0051.
DR   EnsemblGenomes-Gn; Calkro_R0052.
DR   EnsemblGenomes-Gn; Calkro_R0053.
DR   EnsemblGenomes-Gn; Calkro_R0054.
DR   EnsemblGenomes-Gn; Calkro_R0055.
DR   EnsemblGenomes-Gn; Calkro_R0056.
DR   EnsemblGenomes-Gn; Calkro_R0057.
DR   EnsemblGenomes-Gn; Calkro_R0058.
DR   EnsemblGenomes-Gn; Calkro_R0059.
DR   EnsemblGenomes-Gn; Calkro_R0060.
DR   EnsemblGenomes-Gn; EBG00001103711.
DR   EnsemblGenomes-Gn; EBG00001103712.
DR   EnsemblGenomes-Gn; EBG00001103713.
DR   EnsemblGenomes-Gn; EBG00001103714.
DR   EnsemblGenomes-Gn; EBG00001103715.
DR   EnsemblGenomes-Gn; EBG00001103716.
DR   EnsemblGenomes-Gn; EBG00001103717.
DR   EnsemblGenomes-Gn; EBG00001103718.
DR   EnsemblGenomes-Gn; EBG00001103719.
DR   EnsemblGenomes-Gn; EBG00001103720.
DR   EnsemblGenomes-Gn; EBG00001103721.
DR   EnsemblGenomes-Gn; EBG00001103722.
DR   EnsemblGenomes-Gn; EBG00001103723.
DR   EnsemblGenomes-Gn; EBG00001103724.
DR   EnsemblGenomes-Gn; EBG00001103725.
DR   EnsemblGenomes-Gn; EBG00001103726.
DR   EnsemblGenomes-Gn; EBG00001103727.
DR   EnsemblGenomes-Gn; EBG00001103728.
DR   EnsemblGenomes-Gn; EBG00001103729.
DR   EnsemblGenomes-Gn; EBG00001103730.
DR   EnsemblGenomes-Gn; EBG00001103731.
DR   EnsemblGenomes-Gn; EBG00001103732.
DR   EnsemblGenomes-Gn; EBG00001103733.
DR   EnsemblGenomes-Gn; EBG00001103734.
DR   EnsemblGenomes-Gn; EBG00001103735.
DR   EnsemblGenomes-Gn; EBG00001103736.
DR   EnsemblGenomes-Gn; EBG00001103737.
DR   EnsemblGenomes-Gn; EBG00001103738.
DR   EnsemblGenomes-Gn; EBG00001103739.
DR   EnsemblGenomes-Gn; EBG00001103740.
DR   EnsemblGenomes-Gn; EBG00001103741.
DR   EnsemblGenomes-Gn; EBG00001103742.
DR   EnsemblGenomes-Gn; EBG00001103743.
DR   EnsemblGenomes-Gn; EBG00001103744.
DR   EnsemblGenomes-Gn; EBG00001103745.
DR   EnsemblGenomes-Gn; EBG00001103746.
DR   EnsemblGenomes-Gn; EBG00001103747.
DR   EnsemblGenomes-Gn; EBG00001103748.
DR   EnsemblGenomes-Gn; EBG00001103749.
DR   EnsemblGenomes-Gn; EBG00001103750.
DR   EnsemblGenomes-Gn; EBG00001103751.
DR   EnsemblGenomes-Gn; EBG00001103752.
DR   EnsemblGenomes-Gn; EBG00001103753.
DR   EnsemblGenomes-Gn; EBG00001103754.
DR   EnsemblGenomes-Gn; EBG00001103755.
DR   EnsemblGenomes-Gn; EBG00001103756.
DR   EnsemblGenomes-Gn; EBG00001103757.
DR   EnsemblGenomes-Gn; EBG00001103758.
DR   EnsemblGenomes-Gn; EBG00001103759.
DR   EnsemblGenomes-Gn; EBG00001103760.
DR   EnsemblGenomes-Gn; EBG00001103761.
DR   EnsemblGenomes-Gn; EBG00001103762.
DR   EnsemblGenomes-Gn; EBG00001103763.
DR   EnsemblGenomes-Gn; EBG00001103764.
DR   EnsemblGenomes-Gn; EBG00001103765.
DR   EnsemblGenomes-Gn; EBG00001103766.
DR   EnsemblGenomes-Gn; EBG00001103767.
DR   EnsemblGenomes-Gn; EBG00001103768.
DR   EnsemblGenomes-Gn; EBG00001103769.
DR   EnsemblGenomes-Gn; EBG00001103770.
DR   EnsemblGenomes-Gn; EBG00001103771.
DR   EnsemblGenomes-Gn; EBG00001103772.
DR   EnsemblGenomes-Gn; EBG00001103773.
DR   EnsemblGenomes-Gn; EBG00001103774.
DR   EnsemblGenomes-Gn; EBG00001103775.
DR   EnsemblGenomes-Gn; EBG00001103776.
DR   EnsemblGenomes-Gn; EBG00001103777.
DR   EnsemblGenomes-Gn; EBG00001103778.
DR   EnsemblGenomes-Gn; EBG00001103779.
DR   EnsemblGenomes-Gn; EBG00001103780.
DR   EnsemblGenomes-Gn; EBG00001103781.
DR   EnsemblGenomes-Gn; EBG00001103782.
DR   EnsemblGenomes-Gn; EBG00001103783.
DR   EnsemblGenomes-Gn; EBG00001103784.
DR   EnsemblGenomes-Gn; EBG00001103785.
DR   EnsemblGenomes-Gn; EBG00001103786.
DR   EnsemblGenomes-Gn; EBG00001103787.
DR   EnsemblGenomes-Gn; EBG00001103788.
DR   EnsemblGenomes-Gn; EBG00001103789.
DR   EnsemblGenomes-Gn; EBG00001103790.
DR   EnsemblGenomes-Gn; EBG00001103791.
DR   EnsemblGenomes-Gn; EBG00001103792.
DR   EnsemblGenomes-Gn; EBG00001103793.
DR   EnsemblGenomes-Gn; EBG00001103794.
DR   EnsemblGenomes-Gn; EBG00001103795.
DR   EnsemblGenomes-Gn; EBG00001103796.
DR   EnsemblGenomes-Gn; EBG00001103797.
DR   EnsemblGenomes-Gn; EBG00001103798.
DR   EnsemblGenomes-Gn; EBG00001103799.
DR   EnsemblGenomes-Gn; EBG00001103800.
DR   EnsemblGenomes-Gn; EBG00001103801.
DR   EnsemblGenomes-Gn; EBG00001103802.
DR   EnsemblGenomes-Gn; EBG00001103803.
DR   EnsemblGenomes-Gn; EBG00001103804.
DR   EnsemblGenomes-Gn; EBG00001103805.
DR   EnsemblGenomes-Gn; EBG00001103806.
DR   EnsemblGenomes-Gn; EBG00001103807.
DR   EnsemblGenomes-Gn; EBG00001103808.
DR   EnsemblGenomes-Gn; EBG00001103809.
DR   EnsemblGenomes-Gn; EBG00001103810.
DR   EnsemblGenomes-Gn; EBG00001103811.
DR   EnsemblGenomes-Gn; EBG00001103812.
DR   EnsemblGenomes-Gn; EBG00001103813.
DR   EnsemblGenomes-Gn; EBG00001103814.
DR   EnsemblGenomes-Gn; EBG00001103815.
DR   EnsemblGenomes-Gn; EBG00001103816.
DR   EnsemblGenomes-Gn; EBG00001103817.
DR   EnsemblGenomes-Gn; EBG00001103818.
DR   EnsemblGenomes-Gn; EBG00001103819.
DR   EnsemblGenomes-Gn; EBG00001103820.
DR   EnsemblGenomes-Gn; EBG00001103821.
DR   EnsemblGenomes-Gn; EBG00001103822.
DR   EnsemblGenomes-Gn; EBG00001103823.
DR   EnsemblGenomes-Gn; EBG00001103824.
DR   EnsemblGenomes-Gn; EBG00001103825.
DR   EnsemblGenomes-Gn; EBG00001103826.
DR   EnsemblGenomes-Gn; EBG00001103827.
DR   EnsemblGenomes-Gn; EBG00001103828.
DR   EnsemblGenomes-Gn; EBG00001103829.
DR   EnsemblGenomes-Gn; EBG00001103830.
DR   EnsemblGenomes-Gn; EBG00001103831.
DR   EnsemblGenomes-Gn; EBG00001103832.
DR   EnsemblGenomes-Gn; EBG00001103833.
DR   EnsemblGenomes-Gn; EBG00001103834.
DR   EnsemblGenomes-Gn; EBG00001103835.
DR   EnsemblGenomes-Gn; EBG00001103836.
DR   EnsemblGenomes-Gn; EBG00001103837.
DR   EnsemblGenomes-Gn; EBG00001103838.
DR   EnsemblGenomes-Gn; EBG00001103839.
DR   EnsemblGenomes-Gn; EBG00001103840.
DR   EnsemblGenomes-Tr; Calkro_R0001-1.
DR   EnsemblGenomes-Tr; Calkro_R0002-1.
DR   EnsemblGenomes-Tr; Calkro_R0003-1.
DR   EnsemblGenomes-Tr; Calkro_R0004-1.
DR   EnsemblGenomes-Tr; Calkro_R0005-1.
DR   EnsemblGenomes-Tr; Calkro_R0006-1.
DR   EnsemblGenomes-Tr; Calkro_R0007-1.
DR   EnsemblGenomes-Tr; Calkro_R0008-1.
DR   EnsemblGenomes-Tr; Calkro_R0009-1.
DR   EnsemblGenomes-Tr; Calkro_R0010-1.
DR   EnsemblGenomes-Tr; Calkro_R0011-1.
DR   EnsemblGenomes-Tr; Calkro_R0012-1.
DR   EnsemblGenomes-Tr; Calkro_R0013-1.
DR   EnsemblGenomes-Tr; Calkro_R0014-1.
DR   EnsemblGenomes-Tr; Calkro_R0015-1.
DR   EnsemblGenomes-Tr; Calkro_R0016-1.
DR   EnsemblGenomes-Tr; Calkro_R0017-1.
DR   EnsemblGenomes-Tr; Calkro_R0018-1.
DR   EnsemblGenomes-Tr; Calkro_R0019-1.
DR   EnsemblGenomes-Tr; Calkro_R0020-1.
DR   EnsemblGenomes-Tr; Calkro_R0021-1.
DR   EnsemblGenomes-Tr; Calkro_R0022-1.
DR   EnsemblGenomes-Tr; Calkro_R0023-1.
DR   EnsemblGenomes-Tr; Calkro_R0024-1.
DR   EnsemblGenomes-Tr; Calkro_R0025-1.
DR   EnsemblGenomes-Tr; Calkro_R0026-1.
DR   EnsemblGenomes-Tr; Calkro_R0027-1.
DR   EnsemblGenomes-Tr; Calkro_R0028-1.
DR   EnsemblGenomes-Tr; Calkro_R0029-1.
DR   EnsemblGenomes-Tr; Calkro_R0030-1.
DR   EnsemblGenomes-Tr; Calkro_R0031-1.
DR   EnsemblGenomes-Tr; Calkro_R0032-1.
DR   EnsemblGenomes-Tr; Calkro_R0033-1.
DR   EnsemblGenomes-Tr; Calkro_R0034-1.
DR   EnsemblGenomes-Tr; Calkro_R0035-1.
DR   EnsemblGenomes-Tr; Calkro_R0036-1.
DR   EnsemblGenomes-Tr; Calkro_R0037-1.
DR   EnsemblGenomes-Tr; Calkro_R0038-1.
DR   EnsemblGenomes-Tr; Calkro_R0039-1.
DR   EnsemblGenomes-Tr; Calkro_R0040-1.
DR   EnsemblGenomes-Tr; Calkro_R0041-1.
DR   EnsemblGenomes-Tr; Calkro_R0042-1.
DR   EnsemblGenomes-Tr; Calkro_R0043-1.
DR   EnsemblGenomes-Tr; Calkro_R0044-1.
DR   EnsemblGenomes-Tr; Calkro_R0045-1.
DR   EnsemblGenomes-Tr; Calkro_R0046-1.
DR   EnsemblGenomes-Tr; Calkro_R0047-1.
DR   EnsemblGenomes-Tr; Calkro_R0048-1.
DR   EnsemblGenomes-Tr; Calkro_R0049-1.
DR   EnsemblGenomes-Tr; Calkro_R0050-1.
DR   EnsemblGenomes-Tr; Calkro_R0051-1.
DR   EnsemblGenomes-Tr; Calkro_R0052-1.
DR   EnsemblGenomes-Tr; Calkro_R0053-1.
DR   EnsemblGenomes-Tr; Calkro_R0054-1.
DR   EnsemblGenomes-Tr; Calkro_R0055-1.
DR   EnsemblGenomes-Tr; Calkro_R0056-1.
DR   EnsemblGenomes-Tr; Calkro_R0057-1.
DR   EnsemblGenomes-Tr; Calkro_R0058-1.
DR   EnsemblGenomes-Tr; Calkro_R0059-1.
DR   EnsemblGenomes-Tr; Calkro_R0060-1.
DR   EnsemblGenomes-Tr; EBT00001695278.
DR   EnsemblGenomes-Tr; EBT00001695279.
DR   EnsemblGenomes-Tr; EBT00001695280.
DR   EnsemblGenomes-Tr; EBT00001695281.
DR   EnsemblGenomes-Tr; EBT00001695282.
DR   EnsemblGenomes-Tr; EBT00001695283.
DR   EnsemblGenomes-Tr; EBT00001695284.
DR   EnsemblGenomes-Tr; EBT00001695285.
DR   EnsemblGenomes-Tr; EBT00001695286.
DR   EnsemblGenomes-Tr; EBT00001695287.
DR   EnsemblGenomes-Tr; EBT00001695288.
DR   EnsemblGenomes-Tr; EBT00001695289.
DR   EnsemblGenomes-Tr; EBT00001695290.
DR   EnsemblGenomes-Tr; EBT00001695291.
DR   EnsemblGenomes-Tr; EBT00001695292.
DR   EnsemblGenomes-Tr; EBT00001695293.
DR   EnsemblGenomes-Tr; EBT00001695294.
DR   EnsemblGenomes-Tr; EBT00001695295.
DR   EnsemblGenomes-Tr; EBT00001695296.
DR   EnsemblGenomes-Tr; EBT00001695297.
DR   EnsemblGenomes-Tr; EBT00001695298.
DR   EnsemblGenomes-Tr; EBT00001695299.
DR   EnsemblGenomes-Tr; EBT00001695300.
DR   EnsemblGenomes-Tr; EBT00001695301.
DR   EnsemblGenomes-Tr; EBT00001695302.
DR   EnsemblGenomes-Tr; EBT00001695303.
DR   EnsemblGenomes-Tr; EBT00001695304.
DR   EnsemblGenomes-Tr; EBT00001695305.
DR   EnsemblGenomes-Tr; EBT00001695306.
DR   EnsemblGenomes-Tr; EBT00001695307.
DR   EnsemblGenomes-Tr; EBT00001695308.
DR   EnsemblGenomes-Tr; EBT00001695309.
DR   EnsemblGenomes-Tr; EBT00001695310.
DR   EnsemblGenomes-Tr; EBT00001695311.
DR   EnsemblGenomes-Tr; EBT00001695312.
DR   EnsemblGenomes-Tr; EBT00001695313.
DR   EnsemblGenomes-Tr; EBT00001695314.
DR   EnsemblGenomes-Tr; EBT00001695315.
DR   EnsemblGenomes-Tr; EBT00001695316.
DR   EnsemblGenomes-Tr; EBT00001695317.
DR   EnsemblGenomes-Tr; EBT00001695318.
DR   EnsemblGenomes-Tr; EBT00001695319.
DR   EnsemblGenomes-Tr; EBT00001695320.
DR   EnsemblGenomes-Tr; EBT00001695321.
DR   EnsemblGenomes-Tr; EBT00001695322.
DR   EnsemblGenomes-Tr; EBT00001695323.
DR   EnsemblGenomes-Tr; EBT00001695324.
DR   EnsemblGenomes-Tr; EBT00001695325.
DR   EnsemblGenomes-Tr; EBT00001695326.
DR   EnsemblGenomes-Tr; EBT00001695327.
DR   EnsemblGenomes-Tr; EBT00001695328.
DR   EnsemblGenomes-Tr; EBT00001695329.
DR   EnsemblGenomes-Tr; EBT00001695330.
DR   EnsemblGenomes-Tr; EBT00001695331.
DR   EnsemblGenomes-Tr; EBT00001695332.
DR   EnsemblGenomes-Tr; EBT00001695333.
DR   EnsemblGenomes-Tr; EBT00001695334.
DR   EnsemblGenomes-Tr; EBT00001695335.
DR   EnsemblGenomes-Tr; EBT00001695336.
DR   EnsemblGenomes-Tr; EBT00001695337.
DR   EnsemblGenomes-Tr; EBT00001695338.
DR   EnsemblGenomes-Tr; EBT00001695339.
DR   EnsemblGenomes-Tr; EBT00001695340.
DR   EnsemblGenomes-Tr; EBT00001695341.
DR   EnsemblGenomes-Tr; EBT00001695342.
DR   EnsemblGenomes-Tr; EBT00001695343.
DR   EnsemblGenomes-Tr; EBT00001695344.
DR   EnsemblGenomes-Tr; EBT00001695345.
DR   EnsemblGenomes-Tr; EBT00001695346.
DR   EnsemblGenomes-Tr; EBT00001695347.
DR   EnsemblGenomes-Tr; EBT00001695348.
DR   EnsemblGenomes-Tr; EBT00001695349.
DR   EnsemblGenomes-Tr; EBT00001695350.
DR   EnsemblGenomes-Tr; EBT00001695351.
DR   EnsemblGenomes-Tr; EBT00001695352.
DR   EnsemblGenomes-Tr; EBT00001695353.
DR   EnsemblGenomes-Tr; EBT00001695354.
DR   EnsemblGenomes-Tr; EBT00001695355.
DR   EnsemblGenomes-Tr; EBT00001695356.
DR   EnsemblGenomes-Tr; EBT00001695357.
DR   EnsemblGenomes-Tr; EBT00001695359.
DR   EnsemblGenomes-Tr; EBT00001695361.
DR   EnsemblGenomes-Tr; EBT00001695363.
DR   EnsemblGenomes-Tr; EBT00001695365.
DR   EnsemblGenomes-Tr; EBT00001695367.
DR   EnsemblGenomes-Tr; EBT00001695369.
DR   EnsemblGenomes-Tr; EBT00001695370.
DR   EnsemblGenomes-Tr; EBT00001695371.
DR   EnsemblGenomes-Tr; EBT00001695373.
DR   EnsemblGenomes-Tr; EBT00001695374.
DR   EnsemblGenomes-Tr; EBT00001695376.
DR   EnsemblGenomes-Tr; EBT00001695378.
DR   EnsemblGenomes-Tr; EBT00001695380.
DR   EnsemblGenomes-Tr; EBT00001695382.
DR   EnsemblGenomes-Tr; EBT00001695385.
DR   EnsemblGenomes-Tr; EBT00001695386.
DR   EnsemblGenomes-Tr; EBT00001695388.
DR   EnsemblGenomes-Tr; EBT00001695390.
DR   EnsemblGenomes-Tr; EBT00001695392.
DR   EnsemblGenomes-Tr; EBT00001695393.
DR   EnsemblGenomes-Tr; EBT00001695394.
DR   EnsemblGenomes-Tr; EBT00001695396.
DR   EnsemblGenomes-Tr; EBT00001695398.
DR   EnsemblGenomes-Tr; EBT00001695400.
DR   EnsemblGenomes-Tr; EBT00001695402.
DR   EnsemblGenomes-Tr; EBT00001695403.
DR   EnsemblGenomes-Tr; EBT00001695405.
DR   EnsemblGenomes-Tr; EBT00001695407.
DR   EnsemblGenomes-Tr; EBT00001695409.
DR   EnsemblGenomes-Tr; EBT00001695411.
DR   EnsemblGenomes-Tr; EBT00001695412.
DR   EnsemblGenomes-Tr; EBT00001695414.
DR   EnsemblGenomes-Tr; EBT00001695416.
DR   EnsemblGenomes-Tr; EBT00001695418.
DR   EnsemblGenomes-Tr; EBT00001695419.
DR   EnsemblGenomes-Tr; EBT00001695421.
DR   EnsemblGenomes-Tr; EBT00001695423.
DR   EnsemblGenomes-Tr; EBT00001695424.
DR   EnsemblGenomes-Tr; EBT00001695425.
DR   EnsemblGenomes-Tr; EBT00001695427.
DR   EnsemblGenomes-Tr; EBT00001695428.
DR   EnsemblGenomes-Tr; EBT00001695430.
DR   EnsemblGenomes-Tr; EBT00001695431.
DR   EnsemblGenomes-Tr; EBT00001695433.
DR   EnsemblGenomes-Tr; EBT00001695434.
DR   EnsemblGenomes-Tr; EBT00001695435.
DR   EnsemblGenomes-Tr; EBT00001695437.
DR   EnsemblGenomes-Tr; EBT00001695439.
DR   EnsemblGenomes-Tr; EBT00001695441.
DR   EnsemblGenomes-Tr; EBT00001695442.
DR   EuropePMC; PMC3067630; 21216991.
DR   EuropePMC; PMC3416521; 22636774.
DR   EuropePMC; PMC6307998; 30404970.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP002330.
DR   SILVA-SSU; CP002330.
DR   StrainInfo; 823177; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4087034
CC   Source DNA and organism available from Robert M. Kelly
CC   (rmkelly@eos.ncsu.edu)
CC   Contacts: Robert M. Kelly (rmkelly@eos.ncsu.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Caldicellulosiruptor kronotskyensis 2002
CC   collection_date     :: Missing
CC   lat_lon             :: 54.108 159.427
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Russia
CC   environment         :: Hot spring
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 18902
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: 18523201
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v.2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi07645
CC   Type Strain         :: Yes
CC   Isolation Site      :: terrestrial neutral geothermal spring
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Thermophile
CC   Temperature Optimum :: 70C
CC   pH                  :: 7.0
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2843785
FT                   /organism="Caldicellulosiruptor kronotskyensis 2002"
FT                   /strain="2002"
FT                   /mol_type="genomic DNA"
FT                   /country="Russia"
FT                   /isolation_source="terrestrial neutral geothermal spring"
FT                   /db_xref="taxon:632348"
FT   gene            83..1447
FT                   /locus_tag="Calkro_0001"
FT   CDS_pept        83..1447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   ate:Athe_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44922"
FT                   /db_xref="GOA:E4SBZ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E4SBZ7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADQ44922.1"
FT                   /translation="MVEYDVNEVWEKIKEAVKKEINPSPTDISYNTWFESLVPLCFDDN
FT                   DTLILKAFADFHRDIVINRYSLVILNAIRQLFSPHLSIKVILPDEVEKYKRFLKPKQDE
FT                   KPEIVTQLNPKYTFETFVVGNNNRLAHAAALAVAETPPGERTYNPLFIYGGVGLGKTHL
FT                   MHAIGHHVLKLYPGTKVMYVTSEIFTNELIAAIRDEKTDEFRLKYRNVDVLLIDDIQFL
FT                   GGKERTQEEFFHTFNTLYEANKKIILSSDRPPKEINTLEDRLRSRFEWGLITDIQPPDF
FT                   ETRIAILSKKCQLEGTPVPQHILEFIASKIETNIRELEGALNKILAYSKLMAPDKEITL
FT                   DLAEKALKEFIDTNTKKELTIEDIQAEVASYFGIRLEDFKSSRRSRNVAFPRQIAMYLA
FT                   RELTNVSLPKIGEAFGGKDHTTVLHACEKIKELINTDSNTKNTVETIKKRLIHRE"
FT   gene            1452..1649
FT                   /locus_tag="Calkro_0002"
FT   CDS_pept        1452..1649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44923"
FT                   /db_xref="UniProtKB/TrEMBL:E4SBZ8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0002"
FT                   /protein_id="ADQ44923.1"
FT                   /translation="MWITLCEFQFSHVNLVENFKIYQQEYIHPKPQISQAFDTVINLST
FT                   AITVNTTESFIWWYVFETPT"
FT   gene            1667..2773
FT                   /locus_tag="Calkro_0003"
FT   CDS_pept        1667..2773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: ate:Athe_0003 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44924"
FT                   /db_xref="GOA:E4SBZ9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E4SBZ9"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADQ44924.1"
FT                   /translation="MRFIVDKEVLQDNISKVIPAAASTKVTSILECVLIEAEDRIIFTT
FT                   NDMKMQMQTEFEAEILDRGSALLKAKLLSDIVKKLPSGDVEVIREENEVKIRSQKIEFR
FT                   LPTLDPLDFPKMDRKPSESFCEFVASEFVDAVDKVIFATSKDETRPTFTGVLFEKEDDD
FT                   FVNLVGMDGHRLAICKIKPVAVEGSFSKIVPAENLDDITKIVDIEEPEKVRVSFFENQA
FT                   TFEIGSTTVILTLISGKFFDYKSAIPTEYSTKISISSDVLESTLERASIVSKDEKTNIQ
FT                   AVIFETNGMMFTVKSVSADGRYEEDVLCSVEGKDIRVGFNVKYFLDVLKELDGEINLFI
FT                   TSQTSPSIVQKPDDPNYIYLVLPIKMPE"
FT   gene            2799..3860
FT                   /locus_tag="Calkro_0004"
FT   CDS_pept        2799..3860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: ate:Athe_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44925"
FT                   /db_xref="GOA:E4SC00"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC00"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADQ44925.1"
FT                   /translation="MKIKSIYVENFRGYKQRFFEFKDKMNLIVGNNASGKTSLLEALYF
FT                   CMCGKSFKSRDIDAINFDSFYFKLEMLAEVGDTEYNVFCYVDKALDKRIMINDKKIKKL
FT                   SELISTFKFVFFEPDATELIKHQPKLRRRFLDMEVTKLYPYMTKVYSEYHRALLSRNAF
FT                   LKSYDKKDIIDVYDMQISQLGFLIFQKRQEVINKLSIEAQKIFSLVFENKSMLELKYMP
FT                   SIIASNDKEYYKEIKKNIDKDLSFGYTTKGVHRDDFEILIDKKPAINFASEGQIKLAAI
FT                   SVVLATSLLYPEPVLILDDVFSELDSFKRKNLVKFISQYQSFVTSAEDLSVLEREGILE
FT                   FGSANLIFLERSM"
FT   gene            3889..4173
FT                   /locus_tag="Calkro_0005"
FT   CDS_pept        3889..4173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44926"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC01"
FT                   /inference="similar to AA sequence:KEGG:Athe_0005"
FT                   /protein_id="ADQ44926.1"
FT                   /translation="MFAHIGEDYVINSAELLVILSWDSFVRSEDNLKILENLKAQDRIV
FT                   VINDDIKKSIIILEVDGRMYGIISPVSPGTIAKRLLNFNLYFENYLDQE"
FT   gene            4170..6122
FT                   /locus_tag="Calkro_0006"
FT   CDS_pept        4170..6122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: ate:Athe_0006 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44927"
FT                   /db_xref="GOA:E4SC02"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC02"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADQ44927.1"
FT                   /translation="MILKIICLEGEIKLDMVNTNSQQYSASEIQVLEGLEAVRKRPGMY
FT                   IGSTSQRGLHHLVYEIVDNAIDEAMAGFCKNIEVVIHKDNSVTVIDDGRGIPVDIHPKL
FT                   QKSGVEVVFTVLHAGGKFNERVYKVSGGLHGVGASVVNALSRYLEVEVYRDGKVYYQRY
FT                   ERGKPTCELKVIGTTDRTGTKVTFLPDDEIFETIEFDGDVILQRLRELAFLNKGIRIVF
FT                   VDEREKNVKPVELKYDGGIAEFVKFLNRNKEVLHQEPIYIEGEKNDILIEIAIQYTEDF
FT                   GENIYSFANNIATIDGGTHLIGFKTAVTKAVNEYAKKYNFIKGDTQLLGEDIRDGMTAI
FT                   VSVKIHEPQFEGQTKTKLGNSEARWAVENLVSERLAAFLEENPDISKKIIDKAILAAKA
FT                   REEAKKARELVIKRKSALDSSNLPGKLADCSEKDPAKCEIFIVEGDSAGGSAKQGRDRR
FT                   YQAILPLWGKMLNVEKASQDKIYSNDKLLPLIQALGVGIGNDIDLKKLRYHKVIIMADA
FT                   DVDGSHIRTLLLTFFYRYMRPLIENGHIYIAQPPLYKITKGKQVRYAYNDKELQKVLQE
FT                   MKDAQVQRFKGLGEMNAQELWETTMDPARRILLRVELEDAVMAEEIFTILMGDKVEPRR
FT                   EFIEKNAKYVRNLDI"
FT   gene            6140..6316
FT                   /locus_tag="Calkro_0007"
FT   CDS_pept        6140..6316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44928"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC03"
FT                   /inference="similar to AA sequence:KEGG:Athe_0007"
FT                   /protein_id="ADQ44928.1"
FT                   /translation="MEVAKKIYEEVIKLPEETQREVLDFIEFKKMKWKKNIEEIIDKVI
FT                   EENYEILKELADK"
FT   gene            6313..6693
FT                   /locus_tag="Calkro_0008"
FT   CDS_pept        6313..6693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0008"
FT                   /product="death-on-curing family protein"
FT                   /note="KEGG: cbi:CLJ_0294 death-on-curing family protein;
FT                   TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44929"
FT                   /db_xref="GOA:E4SC04"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC04"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ADQ44929.1"
FT                   /translation="MIMLSIEDVLLIAKKLIERFGGTFGIRDKGLLESSLNNAFQTFDG
FT                   EELYKTDVEKIAVISYSIIRNHPLIDGNKRLGISVLLILCKLNNIILEYTREGAVDLAI
FT                   RIAEGSIDIEDVVEWIKKHEKK"
FT   gene            6722..9151
FT                   /locus_tag="Calkro_0009"
FT   CDS_pept        6722..9151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0009"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: ate:Athe_0008 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44930"
FT                   /db_xref="GOA:E4SC05"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC05"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADQ44930.1"
FT                   /translation="MEELDFRIIPVDIQEEMKKSYIDYAMSVIVSRALPDVRDGLKPVH
FT                   RRILYAMNEIGLTPDKPYRKSATVVGHVLAKYHPHGDAAVYESLVRMAQDFSMRHPLVD
FT                   GHGNFGSVDGDPPAAMRYTEARMSKIAIEMLRDIEKETVDFMPNFDESAKEPKVLPSRF
FT                   PNLLVNGSQGIAVGMATNIPPHNLAEVIDAIVYLLDNENASLDDIMKIIKGPDFPTGGY
FT                   IIGKKGIKDAYATGKGKIIVRAKATIEQTSKGRQRIVVTELPYMVNKARLIEKIAELVH
FT                   EKRIDGISDIRDESDKEGLRIVIEIKKDADANVVLKQLYKNTQLQDSFGIIMLALVDNQ
FT                   PKVLTLMDMLNLYIEHQKEVIVRRTKYDLKKAEERAHILEGLKKALDHIDEIISIIRSS
FT                   RTVNEAKERLISRFQFTEVQAQAILDMRLQRLTGLERQKIEEELAELIKMIEYYKNVLA
FT                   SDAMVKEIIKKEILEIKEKYKDERRTKIIQDEHEDFEEEELIQEQETVITLTHFGYIKR
FT                   LPLDTYKSQKRGGRGITGISTREEDFVEDVFVTTTHHYILFFTDKGRVFRLRAYEVPEG
FT                   SRQAKGTAIVNLIQIGKDEKITATMAVKDFKEGYLMMCTKNGTIKKVLLSEFENTTKAG
FT                   KKAITLADDDSLVDVKLTSGNDEIVLVSSNGYCVVFNENDVRSMGRTAQGVKGMTLEDG
FT                   DFIVGMEKASDGKYLLCVTENGFGKRSEIEEYRKTKRGAKGVLTYKVTDKTGRIVDIKM
FT                   VNDEDEIMLCSTEGIFIRLEVSQIPVQGRNTQGVKLMRIDGDNIKVSSIARIRVNE"
FT   gene            9441..11360
FT                   /locus_tag="Calkro_0010"
FT   CDS_pept        9441..11360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0010"
FT                   /product="Beta propeller domain"
FT                   /note="PFAM: Beta propeller domain; KEGG: ate:Athe_0009
FT                   secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44931"
FT                   /db_xref="InterPro:IPR014441"
FT                   /db_xref="InterPro:IPR019198"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC06"
FT                   /inference="protein motif:PFAM:PF09826"
FT                   /protein_id="ADQ44931.1"
FT                   /translation="MMKKRFLGMMVALFIILSILSSGINFVMSDQSKPKSFLQKVGTFS
FT                   NFKKLVDEAQKKNPYMGSGENIMYESAPDFVIKDENKEGSESFYSQTNVQVMGVDEADI
FT                   AKTDGQYIYIAKPYPKIKDNGIVIVKAYPPEEMKVLSKIKLSDEFYPEEFYVDGRYLVV
FT                   ICEKEKIVDREPVIQKNNFPDIDTKKIKVYVPYQLLIETYCIVYDISDKSNPKEIRRVS
FT                   ISGRYLTSRKIGTSLYIVTEKQFPYRIYANKSYSEQDFKPYFSDSITGDSKKIYISFDR
FT                   IKYIPDFINYGITVIGSFDIESEDEICVECVLGGGDIVYCSQENLYLCSEVIKKVYWPE
FT                   KWEDNTRPWYSYVRKTMISRFELSKGKINLEAASVISGKVLNQFSMDEQDGYFRIATTG
FT                   ERLYFLEKNYDYFNAVYVLDKNLRVVGKIDNIAKGERIYSARFIGKRLYLVTFKELDPF
FT                   FVIDLEDPHNPKVLGYFKIPGYSTYLHPYDENHIIGFGRDAEDLDERYAIPLGLKIAMF
FT                   NVEDVENPKELFKVIIGGKGTYSELLNNHKALLFDKTKNIFAFPVEVYDKKGHNFTGAF
FT                   VYSIDLKEGFVLRGKISHEIDDGYCEKIDRLLYIGDVLYSVSNSMIKASSLESFKEIAR
FT                   LRLD"
FT   sig_peptide     9441..9530
FT                   /locus_tag="Calkro_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.528 at
FT                   residue 30"
FT   gene            11446..11565
FT                   /locus_tag="Calkro_0011"
FT   CDS_pept        11446..11565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44932"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC07"
FT                   /inference="similar to AA sequence:KEGG:Athe_0010"
FT                   /protein_id="ADQ44932.1"
FT                   /translation="MKVKKKKIGSVIMIFAILLSVIAPVLTATYQSKSYLETT"
FT   sig_peptide     11446..11529
FT                   /locus_tag="Calkro_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 28"
FT   gene            11566..11878
FT                   /pseudo
FT                   /locus_tag="Calkro_0012"
FT   gene            12618..12710
FT                   /locus_tag="Calkro_0013"
FT   CDS_pept        12618..12710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44933"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC08"
FT                   /inference="similar to AA sequence:KEGG:Athe_0011"
FT                   /protein_id="ADQ44933.1"
FT                   /translation="MVFKSDKNLIYLVTGKVKKNDLGMGIYICE"
FT   gene            12909..21893
FT                   /locus_tag="Calkro_0014"
FT   CDS_pept        12909..21893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0014"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: von Willebrand
FT                   factor type A; S-layer domain-containing protein;
FT                   Fibronectin type III domain protein; SH3 type 3 domain
FT                   protein; YD repeat-containing protein; KEGG: ate:Athe_0012
FT                   YD repeat protein; SMART: von Willebrand factor type A;
FT                   Fibronectin type III domain protein; SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44934"
FT                   /db_xref="GOA:E4SC09"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC09"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ADQ44934.1"
FT                   /translation="MRFPKKLKALLAFFILFVFVFNTNLYVFSQGSSLKDQNPNYKDLR
FT                   GHWAENEFRWMIEKGIISGVKVNGVMLAKPDEKLTRAEAVVILLRTIFEKELLEEEIKK
FT                   LREDSFKDISNHWSRDYINVAARYGLVKGYSDKTFRPNQKVTREEFVLMLIRVSKYREQ
FT                   AASESKQNDKKIKFKDVSVNNFGYKEIIFAVEKGLIKGYNDGTFRPRSYISRAEAAEIV
FT                   ARALKVDVFITYKATDHQITKENASEFFELVVDKEEVGIIEKAKLTLKSKVKGVKFTAE
FT                   WKASGGKLEVAKDNQSAIWSPTDAEEGKDYIVTVEVTVLTDDGDKIKIQKIARIRVNEC
FT                   VQLTKNENIEGPVNEIDPLFTKRESNNLVQENSSYNPLEEKLTAPVLKIAKKGEYVELT
FT                   WNEVKGARSYIVKRGKVSGEYEVLASGVITTAYVDGPMDGKTTYYYVVAAVGANGTTSM
FT                   NSNEVVYKALPQSPKLFGTYNGTSARLTWTKANGAERYTLYRSTVSGGPYYAIAENLLT
FT                   NVFEDTNLTSGTVYYYVVKAINELGESEYSNEVAMGEGVTVAAKFNPDDDEDGDGLTNV
FT                   EELKYATSLKKNDSDGDGLSDGYEVKKGTNPLVPDTDNDGIYDGSEVVMGTDPLAKNPL
FT                   TSAEKYAVSEDGKVFVKALSDANILIAPLQVKRSDNVFINSLKGIVGKAIEITAGGFDI
FT                   KRAEIVVNYDEAELNGVDENNLMLYYVNYDKKILEPLEDVVVDTVYNRVSGKTEHFSTF
FT                   LLGDKNMPVDLSKVDIVFVLDNSGSMSSNDPNYYRIEATKKFIQNIDELNNRVGLVDFD
FT                   SSVYVRSNLTSDKNKLLQALNAMRWTGGSTNIGGGLKAALELFDQEQSKKIIVLLSDGY
FT                   HNTGIHPNDVLPELIKQEIVVNTIALGKDCDRELLHDIADKTKGDYFYVDNTGGLSQED
FT                   VDKQIELIYEKLTKWITLQKEAEKNLKPQEVLSIEYNDVGLDNEEFHKWITTAMTNLLT
FT                   GNYMEEFEDISIEGNGPEFKFVRYYNSFANQQKTIVGKGFRTNFDSKLTKVAGVGIVQA
FT                   GVLNVREGPNVNTKKIGYLTKGTKVQIEEDGNKNGSGWHRIVYKGKSAYICAAYVKELN
FT                   NGIEVTYPSGSTIVFVDDNGDGIYLSDSNKADKVVLSGSEYVLIQRDLTRYVFDKSGKL
FT                   IKIGDRNENYIIIEYSGDKIFAARDVFGRKLEFIFQGDNLVCIRENIKGKIGRKVEFVY
FT                   DNKDRLIKVIGVDGAETKYEYDEKDRLKRIIDANGHQVVRNEYDILGRIVRQYDGEDII
FT                   RFLIYDDEDRVRYYIDENGNESMIVFNEELKPIKERNALGGGCDYKYEIYDGSKWIDVT
FT                   TPDLDKDVVVSDLTREKYQELKEKGSMTKQVTIQIIKTSPSLETAKTTQIYDGRGNIIQ
FT                   VIDAYGNSIKMKYDNNNNLIEQTDRIGATTKYVYDAEGINLIEKIDPLGNKERYEYYSI
FT                   NSGIKLKGLLAKYIDKNGNETRYYYEDEYNNLTRVVDAEGYETKYEYDQLGRKIKEINE
FT                   RGYVTRFEYDPEGRITKEIDAFGKTKVYVYDKVGNLIEEIDRLGNKTRYVYDDKNRLIK
FT                   EIDAMGGEYQYFYDPVGNKIKEIDPEGRVTKYTYDELNRLVEVEDAEGNKTKFKYDLAG
FT                   RKISEVNALGKETRYEYDLLGRLTKVIDPLGKTRSYQYNAEGYKISETNKNGATTSYAY
FT                   DLAGRLITVYYPDGTRRSYNYDDNGNVISITNPRGYVTKYYYDKLNRVIKVEDSNGKAV
FT                   TYEYDGCGNVICFKDKKGRETRYEYDARDRVKRVIAPNRAQTEYEYDAESRVVKVTDAK
FT                   GRSEEYMYDELGRVVVYKDKLGNVIKYAYDKMGNRTQLIDRRGNATKYEYDKLNRVVKV
FT                   IDAYGNESRLEYDAVGNNIAKTDRRGNTTKYEYDANNRLVTIIDPYGNKIRFEYDGEGN
FT                   VICRIDARGNRMYYSYDGLNRLRTVQDNDGRKTIYEYDENGNIVKIIRPDGKYVTYRYD
FT                   NLDRLVRVTQENGAVTEYRYDEEDNLIEVKDGNGNITRYEYNEIDRPVKVIDAIGNEER
FT                   YSYDLVGNIVYAIDKNGVRIEYSYDQLDRVVHVKAGGVEVRYSYDEEGNRIQMSDKTGI
FT                   NKYEYDKLNRLIRKIYPDGKSIEYEYDQEGNVIKVKDPSGYVTQYKYDKMNRLEEVITS
FT                   DGSTRYSYDENGNVKSIEYPNKLKFEYEYDSRNLLKGLVVTARDVVRNEIDKYYTPSSV
FT                   IEQGGGTSTYIYKYEYGYDDNGNMIYKQEPIGRTEYKYDEVGRVAEVKDRFGRLTRYEY
FT                   DNVGNRIKEIVEVPTGISRDSLNSEGLNIRYDYGEVYSVEKTYTYDKLNRLLSIESRDG
FT                   EGNIVGVNNYSYDNNGNLIRAEERWRARVYKGQESKVVAKGIEKQDLQTVYQDAYTAEN
FT                   VQVQTSVYNSAYSSNNSTVVVSVYDSVHGSAYDSQNSTYDQSIAVKEVVYETVYEDVYE
FT                   IEEKIKVSEFRYDELGRMVWAKIDNNVVEFEYDGDGLRTKKITANDVKTYYWSGSNLIY
FT                   ESDATGKGFSSIWGLSMIGRTDGSNTEYFMKDGHGDVLITFDKSGQRKNIYEYDLYGNV
FT                   IKEIETGQENPIRYAGYYYDKELEWYYLKTRYYDSRIGRFVKEDSIRGDITDPESLNLY
FT                   TYCTNNPVNLYDPDGELAIVPLLVLVGGLALQTAIGVGLDTLVHRIEHKGSLKGFNWKR
FT                   SILTNLVVSAAGVLIGGSFTAITYSAKAVKAAKAAKAATVAAKTLSSQAIKESIKNGAK
FT                   KLIDPKTHFKAAIKALPSTVEETLRNKKPDEPVYKTFLKNYLANVAASAVSVNWDRKVE
FT                   KYVGQYFQNVSKKSAIFYQKLVEEAAKGINLGRIIVRGIKKGISKWRELGSQEPLIPNV
FT                   ISETNQRTERVKELEPKPYIQDNVRTSEDNVWLKESKRIIPENVVSRNVIRIVPNGPSI
FT                   VEQIQNFSWSLQSMLGADFNLGAVRGGEPRVPGVDLTFGYMAPVNRMIVPRVGRVSAY"
FT   gene            22002..23312
FT                   /locus_tag="Calkro_0015"
FT   CDS_pept        22002..23312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44935"
FT                   /db_xref="GOA:E4SC10"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC10"
FT                   /inference="similar to AA sequence:KEGG:Athe_0016"
FT                   /protein_id="ADQ44935.1"
FT                   /translation="MESREKVERAVNKLIKALLISVLILFVLRLILYFADIVYVSKRIT
FT                   GDVSDGILLFFKQVFLYILFLGVVGIGLSTLVFFGGGYISYLALYELLTIFKKIVVVIV
FT                   AVVIRKFWVVNKYFETTAFKRDFLVYSSEKEIALILKCNESNCKYKTDEEFYIFKRIVT
FT                   EGGEEIYLPYSVKEDRYLDGYVVGKNIRYHEEDSGRKILIEELLEEEIVENNENKKEQA
FT                   EERINEEILAEKVARAAIKLLKLRRQEKTIVSCSNISPIYYVTALGNSRGFFGKIVPSL
FT                   IVGSLIAGIFVTIEFTYWLIQDITNSSRITVLKIIWIMSMLLMVMLLAIFVVKGFYERE
FT                   KKDEEKLSIEIVKIPMILYRENKKAEVKEGGIFVKDEENIVLVKKGDKEDEELLSELKI
FT                   KKERVEGLYEVRLISKNSSDEEVKSTLGCLVRIGGEA"
FT   gene            23316..24077
FT                   /locus_tag="Calkro_0016"
FT   CDS_pept        23316..24077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44936"
FT                   /db_xref="GOA:E4SC11"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC11"
FT                   /inference="similar to AA sequence:KEGG:Athe_0017"
FT                   /protein_id="ADQ44936.1"
FT                   /translation="MNRIVVRHIEDKKEKSTITKISTLQRTVVVVVAVIFTFLLFKYAK
FT                   EVVNRNELNVDDRIRPITKTLVFGLSIEPGFIGNELFDFPAVGCYSLIALIWRHIMKDD
FT                   NITLSENLVELTSEEKRSIEMALGKLKYILLDNPKEGFMRWIKSEDFKIYKKEYEDDVL
FT                   EDFWAFHFLDMNVIFIGVSIISFIFWATYIFCNMLFLIIVTMVEFVINLRAVILKKEER
FT                   VEDEEEKEIYENIKEKIRRIIYDGEEARGLR"
FT   gene            complement(24591..25631)
FT                   /pseudo
FT                   /locus_tag="Calkro_0017"
FT   gene            complement(25873..28332)
FT                   /locus_tag="Calkro_0018"
FT   CDS_pept        complement(25873..28332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0018"
FT                   /product="LexA repressor"
FT                   /note="KEGG: ate:Athe_0022 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: Peptidase S24/S26A/S26B, conserved region;
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44937"
FT                   /db_xref="GOA:E4SC12"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC12"
FT                   /inference="protein motif:TFAM:TIGR00498"
FT                   /protein_id="ADQ44937.1"
FT                   /translation="MNLNIEQKKLSQAKPNGHMLVKGVAGSGKTTVAIYRLVYLLNEYC
FT                   FAPDDKILMVTFNKTLVNYLKYLYNKLEDAYISFDSLVNDNKDKVKIASIDSIIYGFFQ
FT                   EYKEYSGENLEIVNNKAIKYNFLNQAIVKIKEKYPKVQYIDLSFANFLLDEIEWIKSCN
FT                   IRELEEYQSTDRIGRTVQNQKDMPQKIAKNSETRKAIFELMQLYTSLLKENKLVDFKDM
FT                   ALIVLDYLKTNEHKITKYTHIIIDESQDLTKVQLEILKLLYNSEKSYSSIMFIADTAQS
FT                   IYTHSWLVRGRSFASIGFDMTGKSYTLSKNYRTTVQIANLAYSLIEKTPEIIENENFVK
FT                   PALIDKQGPLPVLKIFQTEEQEAEFVCNEIANKLACEFQLKDIAVICKNRRYLESFYNY
FT                   ASSKGIKAIFLNSDSGENFEEEGIRLITMHSIKGLEFKVVFIIGLNSNIIPYSSCEDNE
FT                   VAKLQETTDKKLFYVGMTRANERLYLCCSRKPSKFLSELNTKLLRIDSKCSLRSFYKLR
FT                   IDDYRYINKIRDIYCKEEEVRQWLINELIETYKYPEELIDVEYRINVFSKPAFVDVVVF
FT                   RYDQNKEKVPFIIFEVKPYLSGINHGAEQLKSYLNIIPKCSFGVVTDGNSILIFDSRFE
FT                   NVDDFPHFDISMLPSQIEEYEVVDFRRSKTYRLRKLVDTGHIDLVQDGHLIEIKSEDVL
FT                   KINLYEKVSAGVPVETSDEAIGKVALPTSIISDPERYFAIKVKGDSMVEANIKDGDIAI
FT                   VQKCNTAENRDIVIAWLDGEITVKRFCKMGSTVLLIPENSKYEPINIKEGELRIVGKVV
FT                   GVMRKKR"
FT   gene            28589..29251
FT                   /locus_tag="Calkro_0019"
FT   CDS_pept        28589..29251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0019"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: ate:Athe_0023 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44938"
FT                   /db_xref="GOA:E4SC13"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC13"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADQ44938.1"
FT                   /translation="MENINRIPLLGEKFPSMTVKTTHGMKKLPDDYAGKWFVLFSHPGD
FT                   FTPVCTTEFVAFAKKAEEFKKLNAELIGLSVDQVFAHIKWIEWIEEKLGVKIPFPVIAD
FT                   ELGKVATTLGMLHEAKGTNTVRAVFIVDDKGILRLMMYYPQEVGRNIDEILRALKALQT
FT                   SDQNGVATPENWPNNGLIGDKVIIPPAATEDLAKERLQKAKAGEIECFDWWFCYKKL"
FT   gene            complement(29383..31653)
FT                   /locus_tag="Calkro_0020"
FT   CDS_pept        complement(29383..31653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0020"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: dth:DICTH_1291
FT                   ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44939"
FT                   /db_xref="GOA:E4SC14"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC14"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADQ44939.1"
FT                   /translation="MNIMHYAEKFSKSPLTETQQNILKVNFPFYLKAGAGTGKTELLVE
FT                   LIIKCLNENPKASISNFVVITFTNKATSEVKRRLVERLYFDYSLNHKKLSSLSSLLADN
FT                   RNIMNRQEDEKRKFVDLTSMLNVYTIHGFCEIILRQYGYLIGISPKFEIKSVTWKLNEI
FT                   IRKAIDNYAENEFLNVLPSYRLHQLVRTLYEECDNKGDEITEKDIKNKFRKNQEQYFWS
FT                   NFKDSFLDLFLEVGREIENFKKENNILTPNDLIKYASKLVKGNDFVATKLASKYKYLFI
FT                   DEFQDTNRSQFELVNTLLEKGVNIFLVGDEKQSIYSFRGADIQSSIEMGNIIANKCNSP
FT                   LIEMTDNFRSNKNVIEVINKIFSQSYSATYKGKLYQIKFDNYQPLIFPQINKSYVDQRS
FT                   FPQYKWKGKTSKIENTLTIEEMDISTIIKKIKNEMCYSDNSDIKYSDIAVLCRKNRQVE
FT                   KIADELKKNKIPVKIYGGGGFFQSNAIISTCKLFEYISYPSEITKHEVKNTDYYFAMLS
FT                   TGRNDLEKFLNELSLYARSNIVADILNFVFENTNIEEYYISTSQHQELYNLYKLREIVR
FT                   NIHNQEFLHPLSFFEYLNNMILTGQKEENADFIEDKQQDSIQVMTIHKSKGLAFNIVII
FT                   PFIDEPIVISDTEPLITYRKTEKEMMIGFNKHKLKIYNNIEDDLDFSSMVTDEIKKQFE
FT                   EELRVYYVAITRARELIILKTNNRRENNIYRNTITSFLDWIKQIDNFNFYNKHFKLLEK
FT                   GKL"
FT   gene            complement(31650..34760)
FT                   /locus_tag="Calkro_0021"
FT   CDS_pept        complement(31650..34760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY01185 235 kDa rhoptry protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44940"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC15"
FT                   /inference="similar to AA sequence:KEGG:PY01185"
FT                   /protein_id="ADQ44940.1"
FT                   /translation="MLETHNKVRLLSHENIEGLKNKIEESKGNFLLITATVNLKRLRLI
FT                   QGKKMNINFVKYRHINNESSEIPCDDFNLCTFEDFKEYLRFLIHKEGKYISTLDQKIIL
FT                   YELIKNFYFSKTSDECHIYHSLLNELFELYQFLIFREVTKIPQSILSNIKDKYPSFFYN
FT                   VFELFNKFLDELENIRIGNTPTIKINSEQLNQLIGKDVYINKLKSKVLEVLNKYNVIFF
FT                   DGFLFFDDIQYFIIQQAIKLNKEVYLISKSNILDQTEGIILQYYKTLFNIELSEIINFS
FT                   KNFYLSKPTDSEHTSPENPKKWLVTVRNNFLKDTSFEKDQEDHSIIIYKPFSNREEELI
FT                   FVIKKIGELIREKIDPEKEDLKNQINNILNEIAIVIGIEKDKHEEMIDALLRQYGVFLF
FT                   DQKMMSEEELKTIDINSFNKIYYSKFDFFRTEIKKINGSELSFKEKLELFDKCFKRINV
FT                   IKAKRPISSYPVAQFIIQLCELIVKGIDVDKFKIILFSNWKYFTDNSDKWSDYLFQFRI
FT                   IQEYFRNSNDISEWIAITLRIKEEKKSLLNKYSGHPFLAVSDDFLNVMEDILLLLNEIK
FT                   NKLKDEETSIKNFIEKIRDYLLDFDSDDILKVGDPETDFERKLILKISETLKEISISSF
FT                   LTTDVEYFANNIINIIDEFKNEPEEFENDELYLNVENLENMHKFKYVFFVMAEDDKYPR
FT                   PYRLEFPFSEEIIEIIENYKICEKPAHIHSLDYHLQLEKYLFKNVLDFTQERIYFTYSQ
FT                   REGDKELTHSIFIEDLISILGKEGKNIEEVALSPKYQPRINRSSINIDKNNIVICKGKF
FT                   KEKIIRNEVVLYNYCKKLFFYKKLLSDGKHIAYFDTYQLGRFSSWFYFSSCLYEHSQIY
FT                   SGKVYSIHDNEYCLDLINIMKNNEARLKSYFSLLNEKEFDDCIKFTKGYIYRLIKRIAQ
FT                   KKINNFNAMSVYDKYIITSIANEKSTIQIPLFSYLEFVIMLTIWEQNNPNDAKRIFDRY
FT                   YNRQIDKNSIQDFSLKLSDISIPLLKCNACEIKNICKLDKVSWGVSD"
FT   gene            complement(34782..35759)
FT                   /locus_tag="Calkro_0022"
FT   CDS_pept        complement(34782..35759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfs:pQBR0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44941"
FT                   /db_xref="GOA:E4SC16"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC16"
FT                   /inference="similar to AA sequence:KEGG:pQBR0304"
FT                   /protein_id="ADQ44941.1"
FT                   /translation="MLHFVTTLKDEFIRYIPTLEKKITILSAYVTYEAFLFVNNELIKN
FT                   KKDNIEKVIVLRFDLKDFYNSVSEFKFEESIKKYKWKVYINFDMHSKNYYFDDKFAIIG
FT                   SHNLTKSGIGLVKVGESNIKESGIVCNLTSSMLQYIEEVIKSSIEVDETLATILDNFIN
FT                   QSKEKQTLSEVEELDSELKKSLLLKKINKTAVTINKEESQDIEKVLLQIIKKSPHNFLE
FT                   EIPLEERALYKFIQYNEWFRNYIIDLDRNEFSLHRPFENLVKLYKLKNKIYREKVDLEN
FT                   PKIPQESIEELAIKIKEKFNITVIKDRVSLLGDKILFKVFHPNH"
FT   gene            36132..37835
FT                   /locus_tag="Calkro_0023"
FT   CDS_pept        36132..37835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0023"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: fnu:FN0444 phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44942"
FT                   /db_xref="GOA:E4SC17"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC17"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADQ44942.1"
FT                   /translation="MIIRYCENCKVEYYDLYSSACPKCNQKMSLTSKIYYCEKCNVPIY
FT                   SERCEVCGSEGKYLATDVRPVFLKERLLMELILNKPFELKYSSVWADISGNRYFIDGKE
FT                   LRINKKQVYNNLSESDLKEISGKLREVEDEEEKEKFDESIKKFIVANSSHFQKILFEAK
FT                   NFIKENTKGYNLDEIFISFSGGKDSTVVSDLVMKALSTSKIIHIHGDTTLEFPFTTEYV
FT                   NRFRKNNPYTPLIIASNKDANFFELCDILGPPSRVMRWCCTVFKTGPITKKINMLFKNK
FT                   EKVLTFYGIRSSESNSRSKYSEVTISPKITRQVVISPIFNWTDFDVWLYILTTGIDFNE
FT                   AYKLGYTRVGCWCCPNNSEWSQFLSRIYLTEMTEKWEKLLVDFARRLGKEDAEIYVKEG
FT                   KWKARQGGEGLEYSNNSIISYKPCSNEENTFYYELKKPISKQLYEYFKPFGELNFEIGN
FT                   KLLGEVYVLDSNKNVVLKLQGIEGDTNLKVSVYGSKSKIMKQKIDAQITKYQMCIGCLA
FT                   CESICPLGAIKIIENEYKIDDNRCVRCGNCIHYFDGGCYIRKVLTIKRGV"
FT   gene            37841..38740
FT                   /locus_tag="Calkro_0024"
FT   CDS_pept        37841..38740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44943"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC18"
FT                   /inference="similar to AA sequence:KEGG:FN0445"
FT                   /protein_id="ADQ44943.1"
FT                   /translation="MENVKYKLKGHGSFYIREGWLQKGLKKFQAEGPDLFSKREANEIL
FT                   GVGANMVSAIKYWLISTGLLEYSNDKKTLCISSLGEKIRQYDPYFEDYFTLWILHYNIA
FT                   TNKEYCTLWYLFFNKIDVKYFSKQELFELMKEKFEEIFKPTKYSTQSLEDDCECILKMY
FT                   LYNKYEEVSPEDNLISPFAKLGLIKFKDRKKGVYEKGSPNFNLLPPLVILYALVDYLNG
FT                   KTAIDLEEVVFGSNAIGKIFNIDNFAFYRYLDILEKQGYVKIVRTADLNTLYVNLNSKN
FT                   DVLEEYYTHEARNRYVYN"
FT   gene            38709..42293
FT                   /locus_tag="Calkro_0025"
FT   CDS_pept        38709..42293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44944"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC19"
FT                   /inference="similar to AA sequence:KEGG:FN0446"
FT                   /protein_id="ADQ44944.1"
FT                   /translation="MKQGIDMSITKYSDFIEVEEAYNYSINLRYDLNNLQKVRAFIPTE
FT                   KNVTLLKNLLSNVLSKNKKANIVIGPYGKGKSYVYLILLFILSLPKETSNENSAKITVL
FT                   NELVEKIGRIDSQVVEMIDEIIKKKISYLPVIINYSYKDIQQMFFTALNEVIERENLSR
FT                   LKIFTSFDAAIEKINSWSNEYPEASKKFEEYLEQLNISKKDFVNKLKECDFEAYDLFIT
FT                   IYRKVTAGAEFNPFLNDDVVNTYKTFSYKLRETGLYNGIYIVFDEFSKFIEEAVNEKRN
FT                   PQLKIIQDIAEAVERDDEGLIYFDGIMHKPFDHYLKNASSIRQDQFRAVEGRFREIYFI
FT                   NTMKDDYSLIEQVIKKDETRFNIIWNRQKSKIEEIFLQAKSLFSPIYSEEELKELAKKS
FT                   FPLNPVTLFVLPKLCELVAQNERTLFTFLTGRERGGFLHFLEKKLNGDNIELLNVDMLF
FT                   DYFEFSFKKEIFNKKIIEIYSIVQRALQLTDSDDERKILKALAIFYMVDEMERLPPKEE
FT                   FLKCALQIDEDKFDQIVQDLLKKKVIIRRKSNQFLDFLASRIEDLDEKINLYKTLKVKE
FT                   INVGQTIEKIRGLEFNLPRRYNDEFEMTRYFYKIFMELNELERINRYKDIENIRFADGY
FT                   VIYLIWYNKEDIAKAIEKITQINDKRIVLCVPQRSFERIEDLREYLALQLLIEEAKKEQ
FT                   DETLIYNLEILLEDIEQLLYNYLEGLFDYNECQFYTCEKGFQKIETEKQLSSFLSDICE
FT                   EVYCLTPIINNEMINKNNLTPQMQKALASAIEHILKGNYDIEGNKPEKTIIKCAIINKG
FT                   LLRQEIKDSNLEKVLKEVEIFLQKACGYKKSFCELYETLQNPPYGLRRGVIPLFLAFKI
FT                   KNLLSNTVFYYNDKEIEFNPAIFNGINENPGQYSLLVDENAVEKESYLEKLESLFSDYL
FT                   MDNNKSRYAKIYQAMKRWYFSLPPITQNTDKIEIKEVCSVEQLKTFKREISKIDQNPFE
FT                   FVSYKLLKIFGSNSYKEVAEKIKKLKIILDNYLENIVVNVVIEIKNILGIESENTFASG
FT                   LRKWYLSLPEMTKSRFINDTVNSFLRYLKKLEDYEDKKIVSDLSSILLGIDIYNWNDNS
FT                   YKNFIEKIKDIIRTLQEQKNKSISDFIKISYNNGDREENKIIEKVEISEIGNTLKDALE
FT                   EILNEFGNSIDDTEKLNVLASIILEHLK"
FT   gene            42311..43480
FT                   /locus_tag="Calkro_0026"
FT   CDS_pept        42311..43480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0026"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: fnu:FN0447
FT                   NifS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44945"
FT                   /db_xref="GOA:E4SC20"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC20"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADQ44945.1"
FT                   /translation="MKKIIYLDNAATTYPKPQIVYDQMDYVNRYLAFNAGRGLYKGAKD
FT                   AEEIIAETRELIAKLVNVNRSEYVILFPSATVALNVIINGLKWDKAFNVYVSPFEHNSV
FT                   LRPLYKVSKKENIEIKELPFNKETFEWDIDKTKKLFEENKPDCVFITHISNVTGFILPV
FT                   KEISTLAKQYEAKVILDAAQSMGLINLDLYEVNADFVVFAGHKNLYGPFGVGGFIANPK
FT                   SFSIEALEPFVVGGTGSDSLNLEMPDSLPQRFEAGSPNIVAIAGLNAALKWISEKKGEM
FT                   ERKERELTQILVRELKDLEIELYLPSDLQNHIGIVSLNLDGYRADEVSYILDRRFNVAT
FT                   RAGFHCAAFVHRFLGTVERGGTVRISVGYFNNEDEIKYLVDCLKKIIAY"
FT   gene            43511..45700
FT                   /locus_tag="Calkro_0027"
FT   CDS_pept        43511..45700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0027"
FT                   /product="type III restriction protein res subunit"
FT                   /note="KEGG: fsu:Fisuc_1669 type III restriction protein
FT                   res subunit; PFAM: type III restriction protein res
FT                   subunit; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44946"
FT                   /db_xref="GOA:E4SC21"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC21"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADQ44946.1"
FT                   /translation="MGFDELNLKMVYRSSNDDIVRDFLIPVLEKAVVYKRAVGFFSSTS
FT                   LIEITKGLYGLVKNNGKIYIVASPALTEEDIEAIRKGYEKRAIIEKRILESFQEPKDYF
FT                   EEERLNLLAHLIAKGYLDIKLAFMEDENEIGIYHEKIGIIIDKKGNKIAFTGSLNETRT
FT                   AYMNNFESIDVFMSWMGEDSRIRVEEKEKNFDDLWHDRTYKVRVIDFPKVGYERLKKYM
FT                   KPTLDLELDKKQFFVNYKPEKRESIFVKPQDLQFRDYQLEAIENWLSNNGHGIFNMATG
FT                   TGKTVTALGAISRLAEKLNYKIAVVIVCPFQHLVDQWAEEVYKWNVKPIIGYSGSSQKE
FT                   WLSRLRQTVRNYNLGFVQNFCFITTNSTFSSDEVQNQLAKLKCNSLLVADEVHYFGAEK
FT                   LSKKLLDNFTYRLGLSATIERHFDPEGTNKIYDYFGDECINYPIELAIKNGMLTPYYYY
FT                   PIVGYLTEKELVEYNRLSRELGKYIEIDEDKYRNYDIILNEKAKQIALKRAKIIAGAKM
FT                   KLDLLKEHIKDYVNERHILVYCGVSNPSYEDAEVERDSINFGVKQIDKVTKILGKEFGM
FT                   KVARFTSKETIQEREWIKEEFEKGEKLQAIVAIKCLDEGFNIPAIKTAFILASSTNPKE
FT                   YIQRRGRILRLARDKVYATIYDFVILPRQLEEVKHKTWEEIKLDISLVKREIARIEEFC
FT                   RIALNSSEGYKLIDRIKEVYDLDNIKGADSDGRIY"
FT   gene            45684..45833
FT                   /locus_tag="Calkro_0028"
FT   CDS_pept        45684..45833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0028"
FT                   /product="Centromeric protein E, putative"
FT                   /note="KEGG: phu:Phum_PHUM625920 Centromeric protein E,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44947"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC22"
FT                   /inference="similar to AA sequence:KEGG:Phum_PHUM625920"
FT                   /protein_id="ADQ44947.1"
FT                   /translation="MEEYIDKEKAIRMLLKIIDKERENLKTKKYKDRDMVEKLKKIIEE
FT                   ELRK"
FT   gene            45830..47865
FT                   /pseudo
FT                   /locus_tag="Calkro_0029"
FT   gene            47894..48424
FT                   /locus_tag="Calkro_0030"
FT   CDS_pept        47894..48424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN0451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44948"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC23"
FT                   /inference="similar to AA sequence:KEGG:FN0451"
FT                   /protein_id="ADQ44948.1"
FT                   /translation="MFEREYAFKGRHAKYVKKLCEVLFPRYVDVYILAPIVGLYYNKKA
FT                   SVDNNQNETAKIFAEQLVAEKHRLEFAYRLVILCDKNFLKDESLEERIKRAFSNDENII
FT                   NENMQIFEEYVLGGIEVLYEKIIEEDKEDKDEYIGKFIEFIADFAEDFMAYGIDNELTN
FT                   STLIKEILETLKD"
FT   gene            48448..50583
FT                   /locus_tag="Calkro_0031"
FT   CDS_pept        48448..50583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0031"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; Protein of
FT                   unknown function DUF2081; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44949"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC24"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ADQ44949.1"
FT                   /translation="MGTTLREIFKAIEENKLVLPDFQREFVWEIEKQKRLLASLLVKLP
FT                   IGSFLILEGERGMFPAKKVCYVSEYINLNEVKEECGYILDGQQRISTLCSAFKDYGNDI
FT                   EKIYKNLRYRWFLRIKPQDGEEDIFGWTRLKFNGLDKYEPEQVIDFIECKKINEREKNK
FT                   WFHPKYKMELLENDEMNKRLNEIAEKAAEEYFVPLYSIWQYTAHDKDQDLHRQVLYKIA
FT                   EKRRDELKADMKDGKIKPEDILSNINPLIRQYIESGLEEKINDAWASLVARWVESVASY
FT                   LENLFDTEINLIKLDKDQMPRAISVFESINEGGTQLSVYDLVVAKAATPDLISLTNRIK
FT                   EIVITKIDISDALWGNNIGSKPTNWQANRIGLIEDNNISKFFKNQYLNLLSLYSNVKYG
FT                   NVDELKVELIKKSKQLSIERDKINTNTEKVVRALIKAAAFLHFRCGVIGVTNIPYDLMI
FT                   LPIAYVFIHDDEFQYNSFKVWDDRKSLNKIEYWYWASLFGGAYRERQNEQCIRDIVTLY
FT                   KWIFEKDNEEINKYFKRYYDRILEEEGYSNLQVLLREDPIHDTIPKAIEKAILQYIISL
FT                   QPLDFKPDKDIYITAWDIAENKIQVNIHHICPLASGKDIKIGQSTKAIREKKDHILNSP
FT                   LNMTYISKEANNAIKEMDLRIYLEKINQLARHEHLMPDINMHSEYRGEEAFFKEFLKKR
FT                   YEKLKDCIKRELNRLLT"
FT   gene            50837..51289
FT                   /pseudo
FT                   /locus_tag="Calkro_0032"
FT   gene            complement(51318..52841)
FT                   /locus_tag="Calkro_0033"
FT   CDS_pept        complement(51318..52841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0033"
FT                   /product="KWG repeat protein"
FT                   /note="KEGG: ate:Athe_0032 KWG repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44950"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC25"
FT                   /inference="similar to AA sequence:KEGG:Athe_0032"
FT                   /protein_id="ADQ44950.1"
FT                   /translation="MIRIKRFVCFLLVFIWLIGSLTMAYSQQASSQKFVYIKPQFENVM
FT                   FWENGWISYLQGGKWGILSSSGNVLLKPQFDKIEPVVYDGPSIMGIEDKFYKDIFVVWQ
FT                   NGRAGFVDTSAKILVKPELDSLEVLNPWLNLYFCKQEGKYGFLNLDKKAYISPQFDKMY
FT                   FVVVSSYNPIAKYPNPYIKCTLPNEDKKEFCLYALDLKDGVWQNSYLEYVLASKDGKCG
FT                   AVDTFGNVFVDFKYNSFEEVLSDSKFTKAVQNMLANESKPATSLNKNETNKTSPDYISS
FT                   EISGNKYFLVFQKATSKGYTQTKSKEYYDNVKNIGFTNFIAVCKNKKWGIVDINGKYVV
FT                   KPQLDDIKELSEGKIAFKQNGKWGFMDKNFKVAIKPQFDKAENFSEGYAAVMKSNLWGY
FT                   INSSGNFVIKPQYTQAGPFFAQMAAVATKDYVGLIDTKGSFVLKFSAKNSQYMFVDTET
FT                   YRFRYAPDSVLNSSGYSIYKYTLNFPKFGYVVIDKKTKKVGLVLRGQGK"
FT   sig_peptide     complement(52767..52841)
FT                   /locus_tag="Calkro_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.569 at
FT                   residue 25"
FT   gene            53090..53659
FT                   /locus_tag="Calkro_0034"
FT   CDS_pept        53090..53659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0034"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: ate:Athe_0033 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44951"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC26"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADQ44951.1"
FT                   /translation="MKKGTKILLAILVLVVVAVVYTFSTYNSLVRFKENVDSKWSQVEN
FT                   QLQRRADLIPNLVNTVKAYAKHEKEIFETLAQARSKLLSSNTVEDKAKANDELSSAVSR
FT                   LLMIVENYPNLKADRTFVQLMDELAGTENRIAVARKDYNEAVKQCNMKIKVFPNVLIAR
FT                   MFGFEERQYFQASSQAKSVPSVDFSK"
FT   sig_peptide     53090..53158
FT                   /locus_tag="Calkro_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.514 at
FT                   residue 23"
FT   gene            53677..54540
FT                   /locus_tag="Calkro_0035"
FT   CDS_pept        53677..54540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0035"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   ate:Athe_0034 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44952"
FT                   /db_xref="GOA:E4SC27"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC27"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ADQ44952.1"
FT                   /translation="MKVKQGLVCKTLALVFIIAVSSLLFVSFAEASAQIPKKPVENVYI
FT                   FDYADLIDSSDEEEMRALAKEIEDKSKAEIVVVTVESLGNYTIEEYANELFNSWGIGDK
FT                   ELNNGVLILVNKENLLSGKKGRIRIEVGYGLEGAIPDGKAGWILDTYAIPAFENKEYSK
FT                   GIKDTFFAVASEVANEYGIKINGLSEYSTSEDFTQNDSSSTTVHVGDEEKDISGFGVFI
FT                   VVFLIIIFSLINRRQRRTYWWGQDPWDKDHHHFGGFGGFGGGGGSSGGGFGGFGGGSSG
FT                   GGGASR"
FT   sig_peptide     53677..53772
FT                   /locus_tag="Calkro_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.639 at
FT                   residue 32"
FT   gene            complement(54580..55212)
FT                   /locus_tag="Calkro_0036"
FT   CDS_pept        complement(54580..55212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0036"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="KEGG: ate:Athe_0037 proton-coupled thiamine
FT                   transporter YuaJ; TIGRFAM: proton-coupled thiamine
FT                   transporter YuaJ; PFAM: thiamine transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44953"
FT                   /db_xref="GOA:E4SC28"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC28"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ADQ44953.1"
FT                   /translation="MKYLENIFKDFEKMKWYSFAIIAVLIFISIFVYLAQKRQKFTTKA
FT                   LVYGGVAISLSFILSFIKLYRMPQGGSITPASMLPLFAYAYMFGPFAGIVAGMAYGILQ
FT                   LIQDPYVVHWAQLLLDYPLAFGALGLSGFFKKNLALGILAGGFGRFVFHFISGVVFFAS
FT                   YAPKGTSPVVYSAIYNATYLGPDLAVCLIISFIPGLRSAIDRLKSHA"
FT   gene            55367..56647
FT                   /locus_tag="Calkro_0037"
FT   CDS_pept        55367..56647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0037"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: ate:Athe_0046
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44954"
FT                   /db_xref="GOA:E4SC29"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC29"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADQ44954.1"
FT                   /translation="MQQIRAIVGTQWGDEGKGKIVDFLAKEADVVVRAQGGNNAGHTVE
FT                   AFGKVFKLHLIPSGILYNNKLNIIGNGVVIDPESLIQEIESLEKEGISTENLKISDRAH
FT                   LVMPYHKVLDEEQEKLRGEESLGTTKRGIGPAYTDKTERTNLRVCDMLDEEEFVQKLRT
FT                   VYERKNQILTHVYHKTPMKFGELLEQFMKYGEILKPYITDTIKLLNDSIKAGKKVLLEG
FT                   AQATMLDLDYGTYPYVTSSHPTVGGFCIGAGIAPKYIQEVIGVVKAYTTRVGKGPFPTE
FT                   LLDEIGDSIREKGREYGTTTGRPRRCGWLDLVVVRYAVLINGIDKIALTKLDTLSGLPK
FT                   IKVCVGYKFEGKVLDLFPASLRVARECEPVYEEFEGWSEEEIKAAKEYEALPKSAKRYI
FT                   EFIEKETGAKVFLIGTGPAREDIIIKD"
FT   gene            56812..58554
FT                   /locus_tag="Calkro_0038"
FT   CDS_pept        56812..58554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0038"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0047 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44955"
FT                   /db_xref="GOA:E4SC30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC30"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ44955.1"
FT                   /translation="MDYLKRLMKYLDDCKLLVAVGLILALAGIFCSMAVPKVSKHIIDD
FT                   VLVARHFEKLYYFALILAGLVLSKAILSYFQSYIFEYTSQKAIYKLREQLYTKLQYQSF
FT                   EYFDRASTGAIMNRMVGDLEAIRNFLNQGFVQVISIVITLILALSIMLSMNLLLSFLSL
FT                   ATTPLIYFNVKSLAKKLQPTFREIRTSFEKLTSKVQENITGIRVVKAFGNEEFEKKSFE
FT                   KVAFEFTSKNIQAADIRSVHNPLANFLNGLNSVIILVVGGYLAIKGKLSIGTLFAFVSY
FT                   VNLFSAPIGNIQNLVNQWQNAFASLEKVFEVLDSEVLIHSPKNAIHLKNIKGDIKFENV
FT                   YFKYKDKFVLKGINIHIQPGEVVAILGQAGSGKSSLINLLARFYDPTSGRILIDDVDVK
FT                   NVKLCSLRRNIGIIMQETFIFSDTIAANIAFGKPDAKEEEIKWAAKLARADEFIERLPE
FT                   GYSTVVGERGIGLSGGQKQRIAIARALIYNPKILVLDDATSSLDFETEAEIQNTLKEVI
FT                   KGRTTIIITHRISQLVVEANKIYYMQDGRIVEQGTHEELMRHKGRYYTTFKKQLLERAN
FT                   SLPA"
FT   gene            58586..60382
FT                   /locus_tag="Calkro_0039"
FT   CDS_pept        58586..60382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0039"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0048 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44956"
FT                   /db_xref="GOA:E4SC31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC31"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ44956.1"
FT                   /translation="MADPVAKKQIFSQEETNYELKIPYLKRLFKFLLPYKKWLVLTLIF
FT                   MFAATVADLVSPYLLKQAVDHYIPKKDFNGILIIGALLILMLFVNKECSKNKIRLANRT
FT                   GQMVLFDIRKALFDHVQSLSFSFFDKNSTGRIIVRIVNDVNTLNNLFTNGIVNVITDMS
FT                   SLVLAAIIMFSINPKLAMVTFAALPIFLVVLFTTRNAIKRNWRAVRRKIANLNAYIHEN
FT                   ISGIRVIQAYVRQKVNRAIFKDVIDDVFLSWMKAVRINGIFSPAVEVCSMIGTLIIYFY
FT                   GVKLLKINGVTVGTLIAFVSYLDRFWRPVVTLSNFYNQLLVASASSERIFEVLSIQPEI
FT                   KEDKNPVEISTFRNSIEFKNVWFAYKDEEYVLKDVSFEIKKGMMVALVGATGSGKTTIV
FT                   NLLARFYDPQKGSILIDGIDLKKISFKSLRKLIGIVQQEPFLFSGSILDNILYGKPDAK
FT                   LEEVIEVCNFLGAHDFISQFEDGYFTQVNERGNRLSTGQKQLISLARLLLQNPQILILD
FT                   EATASLDTHSELMVQNALNKVMKDRTSIVIAHRLSTIKDADLIIVMDKGKIAEMGTHES
FT                   LIRKKGIYYELCASQIRFVKAG"
FT   gene            60474..60549
FT                   /locus_tag="Calkro_R0001"
FT                   /note="tRNA-Lys1"
FT   tRNA            60474..60549
FT                   /locus_tag="Calkro_R0001"
FT                   /product="tRNA-Lys"
FT   gene            60572..60646
FT                   /locus_tag="Calkro_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            60572..60646
FT                   /locus_tag="Calkro_R0002"
FT                   /product="tRNA-Glu"
FT   gene            60925..62058
FT                   /locus_tag="Calkro_0040"
FT   CDS_pept        60925..62058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0040"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: cth:Cthe_0236
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44957"
FT                   /db_xref="GOA:E4SC32"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC32"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADQ44957.1"
FT                   /translation="MLYRRFGNTGVMISALGFGAMRLPQKRVNDKMIYDEDESIKIIHR
FT                   AIELGVNYIDTAPYYCDSQSEIIVGKAIKGIRDKVYISTKNPIEDDSGDNFLKRLESSL
FT                   KKLDIDKIDFYHMWGINYETFKEKIIKKGGPLSAAKRAKEEGLIGHISFSFHDRPENMI
FT                   KIIDEGEVFETVLCQYNLLDRSNEKAIEYAAQKGLGVVVMGPVGGGRLGAPSPVIQNLL
FT                   PGKVVSSAEIALRFVLANLNVSCALSGMSTIEMVEQNASVASNPNPLSTEEVELIKKAM
FT                   EENKKLADLYCTGCNYCMPCPQGVNIPLNFQIMNYHRVYGLTEFAKAEYARIGTVQWLP
FT                   GKKAEECIECGICEEKCPQKIQIRKQLKETAQTLGSK"
FT   gene            complement(62119..62691)
FT                   /locus_tag="Calkro_0041"
FT   CDS_pept        complement(62119..62691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0041"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: ate:Athe_0049 protein of unknown
FT                   function DUF95 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44958"
FT                   /db_xref="GOA:E4SC33"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC33"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADQ44958.1"
FT                   /translation="MRYIISTFKSEKKLLLIALLIFILSCILGILLALAFEPQITKLFN
FT                   TVIRKFFQNLLKNVSNSSDLFFVILKNNLRVYLVILTLGTISFGLVSAFILITNGLIVG
FT                   IVSTIYAKQTSILKTLLLILPHGIFEISAFVIGSVASAIFLKEAISKKQPNLKEAFKKF
FT                   FALSIAGALLVVFAAFIEAFITPIFAK"
FT   sig_peptide     complement(62584..62691)
FT                   /locus_tag="Calkro_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 36"
FT   gene            62850..63482
FT                   /locus_tag="Calkro_0042"
FT   CDS_pept        62850..63482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0042"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: ate:Athe_0050 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44959"
FT                   /db_xref="GOA:E4SC34"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4SC34"
FT                   /inference="similar to AA sequence:KEGG:Athe_0050"
FT                   /protein_id="ADQ44959.1"
FT                   /translation="MKVTYLAHASFLIETKSGVKILTDPYDASVGYTVFDVSADVVLTS
FT                   HKHFDHGYTGSLKGNYVLVDKEGEFNVKGVKIKGIKTFHDKEKGQKRGENIVFVIEDEF
FT                   SIAHLGDLGHELSSPELEKMGKVDILLIPVGGVYTIDAKEAFNVAKAVNPRVIIPMHYK
FT                   TEKLKFDLGKVEEFTKYFEEVEVLQTSEIEINCLPEKQKVMLLKYKG"
FT   gene            63498..65714
FT                   /locus_tag="Calkro_0043"
FT   CDS_pept        63498..65714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0043"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ate:Athe_0051
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44960"
FT                   /db_xref="GOA:E4SCA5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCA5"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADQ44960.1"
FT                   /translation="MAKKSDKKSIYQSANKFGESGTSIFPDKTLVAYKAFVLFAFCVLV
FT                   LMSPYYRGLYFDYELSVFQAVMAGIFILFAIYLYLSKEGFLINSKLELILLLFMVAYIV
FT                   PYFFAANRRLALGEFFKYAFYFAVFYVASRISKGKAEKLAILNTLFLSTVGVAFFGYQA
FT                   AVKLIPETARPLGMAMNGLWVGNMINSTLQYHNTAGTVLAFGFIISLMLAMYSRNKLLK
FT                   SSYFAFSSFIFTAFFFTYSRGSYITLLLALLVFFLLLPREKRISLIFNIAIVGAFVIAF
FT                   LNKVGANLNEHGKVKLWLVLLIQMLLVFVLTYAFGFVERRLYGISNNIYLVVAGVVGIL
FT                   AIIGFAVALRMHLIPSDMVEKIKSIAMFWKERNFVERMVFYKDGLKIFLKSPLFGYGGG
FT                   AWVSLYFMYQSYLYFTTQSHNYFLQVLLDTGIVGFSILLVFLWLLFSASIKAWDKKEQK
FT                   ENVIIAGLVAAAVQLYSHSVLDFDFSLASVQVLLFAALGVLASTSSQILQKHNQEKVIY
FT                   TSRKANFVPVLLTIFYLFVIIISLNFRLGNYYANIGQQALQAGNLSAAYSFLSKAVTYD
FT                   SLNSNALSDYAVALYRIGDQNKDVNLIAKADGYFRQAIVNDRFNAKIRFKYAVYLLSHG
FT                   AIDSGLSQIEEGIKLQPLQPANYELKADAYAKVGDYYLGKGDKEKAKKYYEVVLKIPQE
FT                   IERVKKERERIPPVLKGKENINVFIMTARTQEILNIVKSKFKDL"
FT   gene            65729..66838
FT                   /locus_tag="Calkro_0044"
FT   CDS_pept        65729..66838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0044"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cno:NT01CX_1528 glycosyl transferase, group 1 family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44961"
FT                   /db_xref="GOA:E4SCA6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCA6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ44961.1"
FT                   /translation="MNRGKLTILHIVESFSGGVFDFISDIVNELPEYDHVIIHGLREDT
FT                   PHNYTQLIKASEFIEVKNFQREINLIKDFKALIEVISILRRFKARKIVIHLHSSKAGFI
FT                   GRIASRFLKLYNKVVYTPHGASFLRKDVSSLKRNIYILCEKIAARCGGFVVACSKSEAE
FT                   EFKKYKINAFYINNGVKNYSKIFMDETKSFNKEKIIVGNSGRIVEQKNPDLFNSIAKEF
FT                   IGVKEIEFLWIGDGPLKDRLTSPNIRITGWLSRDKAIEYLANDVDIYLSTSLWEGLSLT
FT                   ILQAMSLKKPLVLYKCVGNIDLVSCDQNGFLFTTKDEAVKALKILINDENMRKRFGENS
FT                   YSLYINEFNDKKMLSQYKKLYKELGGMTT"
FT   gene            66984..67949
FT                   /locus_tag="Calkro_0045"
FT   CDS_pept        66984..67949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0045"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bfs:BF1371 putative LPS biosynthesis related
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44962"
FT                   /db_xref="GOA:E4SCA7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCA7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADQ44962.1"
FT                   /translation="MNKEVCAIVVTFNRERLLIENIESLLKQTLKLKWIIIVDNNSQGY
FT                   KEVKEKYFRYGRKSEFSQVILHKFKQDVEEILYDDTKETEFLYVRLNNNKGGAGGFKIG
FT                   ISIALETKCDWFWLLDDDVESQEDCLEKLFKYTEISECIHPRRVYYDNTECLWEGGLDI
FT                   VTGLRYSLDDISFKNGKPFCVVNVGCFEGMLISRGMVERIGLPDERFFIVDDDTIYGFL
FT                   ASLYTNVLYVRDAVIIKKIKKLNYELEPVFVYYYLRNYKLKLQYMDEYFSKYTFVRKVF
FT                   FYFSIFKFVIQTFFNKRPFLLKYIIKALIDSKKSKFGKGL"
FT   gene            67952..69382
FT                   /locus_tag="Calkro_0046"
FT   CDS_pept        67952..69382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0046"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: abu:Abu_1814
FT                   putative O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44963"
FT                   /db_xref="GOA:E4SCA8"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCA8"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADQ44963.1"
FT                   /translation="MKSKENNKRAITYDKMIRILLAIFIYFSFLLYPMGGLYIGYERLK
FT                   LYVIEMVLFCIFLTITMNREIFKFIKEILLYKTKRKDKIGLLLIWNILLYISWACLSLL
FT                   WSNDKVSTLVSLSKLVVMIYFSFCVLIYMNYYGVQAAKVILGSLLITVVLLLGIKIYKI
FT                   INVLGTSYFLMMLKTKQVQSGNPIYSLFIYKVFATPPLGNSQNVTDSLIISYIGISILV
FT                   YLQYKDNLNVRFYKFLLVSTAVIGTMQLYIGISKTAFLSLCLLIFFLLIGYLIYKEKSI
FT                   LYLGCILIFINSLILLLNPFNIRNAVTERFSVLTTLKLSRVEEQKTQREDVSITSRLEL
FT                   WKEALKIFENHKVCGSGYRSNKALYLRKYKVDNPHNIYLQTLSELGIIGFTFLVSIIIG
FT                   WLLLAIKAIRKNQYILLCIGLIFIYFFRGLNGWQFEELDIWLLMFLAIYLYVKYFTIKI
FT                   YKDRRTGYERCSCFNSSL"
FT   gene            69348..70172
FT                   /locus_tag="Calkro_0047"
FT   CDS_pept        69348..70172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0047"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mrb:Mrub_2021 family 2 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44964"
FT                   /db_xref="GOA:E4SCA9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCA9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADQ44964.1"
FT                   /translation="MNDVVVLIPHYNNIEGLKKSIASINDDVDILIVDDGSFSKPTEEE
FT                   LRDLCVNPRVQIEIIYLKKNQGIEHALNAGLKTVYQKGYKFIARLDAGDECLPYRFSVQ
FT                   KQFLEYNPEIYLVGSWAEVVEENRVSYILKKPTDYKTIKKLIFVNNTFIHPAVMFRREV
FT                   IDEVGFYPEKYKYAEDYAYFFKITKKFKCANIDKPLIRYTLGESNISWKYYKKQLKSRI
FT                   KIIWDNKALNPYWFYGLIRNIFLLIVPKQFIEKLKKILFTLLTNKEYKKANF"
FT   gene            70228..71676
FT                   /locus_tag="Calkro_0048"
FT   CDS_pept        70228..71676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0048"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   fno:Fnod_0573 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44965"
FT                   /db_xref="GOA:E4SCB0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB0"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADQ44965.1"
FT                   /translation="MSIQRNYIYNVIYQCISLVIPFATIPYIARVLGPLNLGITAYTNS
FT                   IVQYFTLIASLGVGLYGTRQIAYVKENKERRSKVFCGIFYTKTIVAVVVYFVFLIFVIL
FT                   TGKQYFSVFMLQSIYIISAILDISWLYTGMERFDKLMIRNIIVRITGVILVFLIVKERS
FT                   DLIKYIFIGVISELVGQLIMWLQIKKYVSFTFVNFSTIKEHFLSMCKLYIPQFIIQVYT
FT                   VFDRTIIGISTYKEEVAYFDLAKKLINMLIIFPTSLGTVMLPKISFLVENNKNEVIKIY
FT                   LHRTIEFMFYTSLPMFLGLIIVSDNLVRWLYGYNFYKSAILIKIMAPTIFFISISNVIG
FT                   IQFMVPYKKERELTISVFAGAIMSILSNVVLVFWLKSIGAAISFLLTEATVTIIQIAYT
FT                   RNIWEYKYIIRMLLKYFIISITMVFILILIDVFIKIENFTAIFVQVIIGFLFYILSNVV
FT                   LESEIQRDVFSQIKKFLRRSKNEI"
FT   gene            71666..72763
FT                   /locus_tag="Calkro_0049"
FT   CDS_pept        71666..72763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0049"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="TIGRFAM: UDP-galactopyranose mutase; KEGG:
FT                   cac:CA_C2169 UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like; glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44966"
FT                   /db_xref="GOA:E4SCB1"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB1"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ADQ44966.1"
FT                   /translation="MRFEYVVVGAGFAGCTIAERIANVLNKKVLIIEKRNHIGGNAYDY
FT                   YNEDGILVHKYGPHIFHTNNKIVWDYLSNFTKWRLYQHRVLAYVDGKYVPFPINLDTIN
FT                   ILYNKNFSSEDFKLFLETVRKKSEKITNSKDVVTSQIGEELYEKFFQWYTKKQWDIFPD
FT                   ELSPEVTARIPVRFNRDDRYFTDRYQGVPEYGYTRLFENLIDSKNIHILLNTDYKEVIN
FT                   EIKFEKLIYTGPIDYFFDYKYGKLPYRSIRFEFETLSCEYYQPVATVNYPNDYDFTRIT
FT                   EFKHITGQIHPKTTIVKEYPTSEGEPYYPIPQNENYEIYRLYEKEARMLTNIYFVGRLA
FT                   SYKYYNMDKVVEEALKLFEKIKFTS"
FT   gene            72922..74292
FT                   /locus_tag="Calkro_0050"
FT   CDS_pept        72922..74292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0050"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; KEGG: ate:Athe_0062
FT                   undecaprenyl-phosphate glucose phosphotransferase; PFAM:
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44967"
FT                   /db_xref="GOA:E4SCB2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB2"
FT                   /inference="protein motif:TFAM:TIGR03023"
FT                   /protein_id="ADQ44967.1"
FT                   /translation="MMHDLERLYNKLSKIIDVVSILLSFYIAWFIRFEMTLIPSTDHLG
FT                   FESYMTVMAFYIIFYFLISIVFKMDLDSFQIDAFKLVYKVIRTNVLTVVFVMTIFYIMK
FT                   LVDYSRIFLITYAVINSVLSLCLRTELKNFLTKRQKKFFSQETVLFIGQNDEVNKIVDY
FT                   FKINNYFTIIGFLDDTNPEAIGKVSELENVLNKYHVDEIIICLKLEEYNKIPYIIDISE
FT                   KYGIRTYIVPDYFRYIPSKARVEELRGIPLINIRYSPLDEWTNRFVKRAFDIFVSLIGL
FT                   IVCLPLFIIIAILIKLTSKGPILFTQERVGYNRRVFKMHKFRTMYVQDPDEEKVRWTTK
FT                   DDPRRTPIGKILRRLSLDELPQLWDVLVGNMSLVGPRPERPYFVEKFKEEIPKYMIKHR
FT                   VRPGITGWAQIHGLRGDTSIEERIKYDIWYIENWSFWLDIKIILATIFGGKFMENAY"
FT   gene            74375..75019
FT                   /locus_tag="Calkro_0051"
FT   CDS_pept        74375..75019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44968"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB3"
FT                   /inference="similar to AA sequence:KEGG:Athe_0063"
FT                   /protein_id="ADQ44968.1"
FT                   /translation="MSEREMLEKIILGIEELKNDVKEVKVRLDRVEERLDRVEERLDRV
FT                   EERLDRVEERLDRVEERLDRVEERLDRVEERLDKVEERLDKLEVRLSSLEDGFGRLEKR
FT                   VSDLEQKVYALENEISTVKNDIRNMQTEMQSLKQAILENTGCIDTLFNAFGGVIQFKAD
FT                   IENFRSDVNNFKNETSTKIENLVEVTNKIKEEYGRHDIDLRIMKEKIGILI"
FT   gene            complement(75089..75634)
FT                   /locus_tag="Calkro_0052"
FT   CDS_pept        complement(75089..75634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0052"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: ate:Athe_0064 Appr-1-p processing domain
FT                   protein; PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44969"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB4"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADQ44969.1"
FT                   /translation="MSTKEIFQKIAIKKGDITKENVDVIVNAANSHLRHGGGVALAIVR
FT                   AGGQEIQKESDEIIKKIGFLPTGHAVITNAYCLPCKFVIHTVGPIYGEGNEDEKLSMAI
FT                   YNSLYLAHLYNLRSIAFPAVSSGIFGFPKDRCAKILIDTAVDFLSSINTSIEKVVFCLF
FT                   DDETYGYFEEYYKNLLGK"
FT   gene            complement(75681..76034)
FT                   /locus_tag="Calkro_0053"
FT   CDS_pept        complement(75681..76034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44970"
FT                   /db_xref="GOA:E4SCB5"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0065"
FT                   /protein_id="ADQ44970.1"
FT                   /translation="MKSSLILISGLLAGMGLIITYNKVVPLILFKKEKPPIKIFPEKKS
FT                   FDELVQVYDSVSQDIKRYLEEYCSFPTTDCGKLLAASLFTQVTVCLSILSSLEKFGIDT
FT                   KTVFDEILSKNKA"
FT   gene            complement(76158..76451)
FT                   /locus_tag="Calkro_0054"
FT   CDS_pept        complement(76158..76451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44971"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB6"
FT                   /inference="similar to AA sequence:KEGG:Csac_0640"
FT                   /protein_id="ADQ44971.1"
FT                   /translation="MSQNGWLFQEAIRLAQEYGFKCYEIHSNLVRVRTVCDEWLIEYVQ
FT                   ESKKPFYLHHYKDKPHFQRKFYDLPFLFKSLFQHDRFVLNGRTTMPVKPIRV"
FT   gene            76970..77551
FT                   /locus_tag="Calkro_0055"
FT   CDS_pept        76970..77551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44972"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0072"
FT                   /protein_id="ADQ44972.1"
FT                   /translation="MFKKVLSILLIFACLLSFSVVFADEVQSSGSSSTSSVVSQIKQAA
FT                   VCETVGGSVYDITQYKWFWDPIKVVGTKTVSFRDPWKRIFSYRNDTPNKVKVTITQTYT
FT                   VTNSTGGSVTLSPQLIQAQLGVNVNASVTRTYTNTVTIPPNTTFYLEAAGTGRNIYFDV
FT                   YVPHLFDSGYDYEGSGWVKEYTGISFWGHY"
FT   sig_peptide     76970..77041
FT                   /locus_tag="Calkro_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            77944..78654
FT                   /locus_tag="Calkro_0056"
FT   CDS_pept        77944..78654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44973"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB8"
FT                   /inference="similar to AA sequence:KEGG:Athe_0073"
FT                   /protein_id="ADQ44973.1"
FT                   /translation="MATEEIIKKLKFTMLEGANNSKVKINKVKIVSKKPFIIGGFNYYT
FT                   FNLYLSVDDLQKGIYIFNKLKYTLNGKTEGKEILCYVEVTKESDNYNFLWVGGYQQQKF
FT                   VANQSVEEIINNREKGYLGEEWEYIFENATDKNLKVIKIDVPSKIYPTVKIQMTDNIPS
FT                   GGYLLKPKEKIEFKIFIPKNYPEVYHVLTLSPRILYQKENEKYLKIAYPETSTGIDCYK
FT                   AIDNPENLTKKVAK"
FT   gene            78726..78836
FT                   /locus_tag="Calkro_0057"
FT   CDS_pept        78726..78836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0057"
FT                   /product="abortive infection protein"
FT                   /note="KEGG: ate:Athe_0074 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44974"
FT                   /db_xref="GOA:E4SCB9"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCB9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0074"
FT                   /protein_id="ADQ44974.1"
FT                   /translation="MLENGIKLKNKIAQNVLIIIIAIIAGITLIICRVSK"
FT   gene            complement(79054..80278)
FT                   /pseudo
FT                   /locus_tag="Calkro_0058"
FT   gene            80393..81517
FT                   /locus_tag="Calkro_0059"
FT   CDS_pept        80393..81517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0059"
FT                   /product="S-layer domain protein"
FT                   /note="KEGG: ate:Athe_0077 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44975"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0077"
FT                   /protein_id="ADQ44975.1"
FT                   /translation="MTFDSYDPQNLTVYNDIYNSHVLLSVYECTYAVVNADVYVIDRDT
FT                   YKELFVGTTDSNGELPLVITNGEYIIKIAYNNPETGAYDFYYKALQVSQDSVVELDLSQ
FT                   FSQIQYIPGFTEGGVGMGDKLLLGFDFDYDGKFVVSSIEQARRAWFAPGDYGWVWVLAH
FT                   NPYYSDNYLAFSLEYKPLQRLIIPEGVPQQYTVDLRVDRSKITLSCERKPEGSWDFVPT
FT                   TLDSVYEKDDLIIDIYIFTYSQNYIVGGHTVPEHFVEDNGDERIMWVSIPGIYPINVFT
FT                   ISNDTQKELFTGHLGFVDTNNTWRIAVLDVVSGQNSVLRIYLPLSPYDIDIIIDREITI
FT                   YPLSTSSGGSRREMYIQKAKIFNQTIKMQRLPRK"
FT   gene            81691..83316
FT                   /locus_tag="Calkro_0060"
FT   CDS_pept        81691..83316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0060"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="TIGRFAM: CTP synthase; KEGG: ate:Athe_0078 CTP
FT                   synthetase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44976"
FT                   /db_xref="GOA:E4SCC1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC1"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADQ44976.1"
FT                   /translation="MEKQVKYIFVTGGVVSGLGKGITAASIGRLLKARGLKVTMQKFDP
FT                   YINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLTKNSNVTTGKIYWSVIQR
FT                   ERRGDFLGGTVQVIPHITNEIKERIYRLGKSNSTDVVITEIGGTVGDIESLPFLEAIRQ
FT                   VATDIGKENVLYVHVTLVPYLSKSGELKTKPTQHSVKELRSIGIQPDIIVCRTEKPLSQ
FT                   ELKAKIALFCNLKPEYVIQNIDAESLYEVPLMLEKEGLGEIICEKLGFVCTKPDLSDWI
FT                   EIVEKEKNLKKSVRIALVGKYVELHDAYLSVAEALKHAGIANDSYVEILWTNAEEVTYD
FT                   NAHEKLKSADGILVPGGFGDRGIEGKIAAIRYARENKIPFFGICLGMQCAVIEFARNVL
FT                   GLEKANSTEFDEATPYPVIDIMPEQKDIFTKGGTMRLGLYPCKLEEGTLAHRIYNDELV
FT                   YERHRHRYEFNNEFKEKFKQAGMVFSGISPDRRLVEIIELKDHPWFLGVQFHPEFKSRP
FT                   QRPHPIFTDFIRASLENRQKKEGI"
FT   gene            complement(83365..83853)
FT                   /locus_tag="Calkro_0061"
FT   CDS_pept        complement(83365..83853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44977"
FT                   /db_xref="GOA:E4SCC2"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC2"
FT                   /inference="similar to AA sequence:KEGG:Athe_0079"
FT                   /protein_id="ADQ44977.1"
FT                   /translation="MENRNVAFEIFLWLLIYLCFFAGTNLFSNDGMLLLVWSLICLISI
FT                   FLITIILRFYITSTLLLLPGFVISCILAVLFMFNAHFPNFMILLLQVFSIHLMGFVEFA
FT                   RESSNMVILQRPLYIYIHVGLNLVLFLIHLFVIYLISELPRQQRPKTLDLTYTRRRRR"
FT   gene            84038..84730
FT                   /locus_tag="Calkro_0062"
FT   CDS_pept        84038..84730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0062"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: ate:Athe_0080 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver;
FT                   transcriptional regulator domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44978"
FT                   /db_xref="GOA:E4SCC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ44978.1"
FT                   /translation="MSKAHILVVDDEKPIVDIIKFNLEKEGYKVTASYDGEDALNRIKN
FT                   ENFDMVLLDVMLPKLDGFSVCKKVREFSDVPIIMITAKADEVDKVLGLELGADDYITKP
FT                   FGIRELIARIRANLRRTAQSAAQDGKVLKAGNLTLNPETFEVKKDGKVIELTVREYELL
FT                   KFLMSQKGQVFSREELLEKVWDYEYYGDVRTVDVTVRRLREKIEDNPSEPNFILTKRGI
FT                   GYYFNPNI"
FT   gene            84754..86469
FT                   /locus_tag="Calkro_0063"
FT   CDS_pept        84754..86469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0063"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ate:Athe_0081 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44979"
FT                   /db_xref="GOA:E4SCC4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ44979.1"
FT                   /translation="MTKSIESRLIIVFGLLILILMFISSFFVIDRTKSYFYDDIKNKIE
FT                   FMVSSSLIRILEDKSLTQQKIQEIIDQSMKQSQYGFMIQKLIVTDNRGRLLASFPRMDI
FT                   SFYPSDEILTSLAGYKVIKRDSENQTMIFAFPIKSGKSVERSLYLEVSCQSILETVTDI
FT                   KNILFMAYVIGMGFSLFIGFLFAKTLSNPLRKLTRQALEMAQGNLDVKIEISSQDEIGK
FT                   LASAFKIMATNLKRYITELEFEKQKLERILQNMSDGVLAINSRNEIIHINESAKRFLKD
FT                   DIHGFLDKIQAQKSSVVSQPIIYEVDGYTLEVSIAFFVDSFQSTGMVFILHDITEQAKL
FT                   DRMRKQFVADVSHELRTPITTIKTYSETLLDVDDESVKREFLTVIIKECDRMTRLISDL
FT                   LYLSRLDSGENILRIEEVNISELVRFVCEKMRIHANKKHQSLLCNVQEDIIIDADRDRL
FT                   EQVLINLINNAITYVQDGGRIEVCLKKENGNIELTVEDNGPGIPKEDLPRIFERFYRVD
FT                   KARSRSLGGSGLGLSIADEIVKAHGGRVLVESEEGVGTKFTVVLPLKEKGQVTL"
FT   gene            86543..87046
FT                   /locus_tag="Calkro_0064"
FT   CDS_pept        86543..87046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44980"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC5"
FT                   /inference="similar to AA sequence:KEGG:Athe_0082"
FT                   /protein_id="ADQ44980.1"
FT                   /translation="MVKKKMKKFASMAVIMLILFNLTLTYAFAGETLSKAKNINSIEID
FT                   GSKIASTSTSLVEIADYNSNITTSAFVLSGKSSEGVEISIYTKKDKKEAFTQNNIVEKF
FT                   TVGKSGYFAKKINVDEGTTYILVVAKKDSDVQISMLKVSYQKEESFGRWIEKVISNIIN
FT                   SFGK"
FT   sig_peptide     86543..86632
FT                   /locus_tag="Calkro_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            87064..88362
FT                   /locus_tag="Calkro_0065"
FT   CDS_pept        87064..88362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44981"
FT                   /db_xref="GOA:E4SCC6"
FT                   /db_xref="InterPro:IPR009996"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC6"
FT                   /inference="similar to AA sequence:KEGG:Athe_0083"
FT                   /protein_id="ADQ44981.1"
FT                   /translation="MKYSKKEFLKSIVLSILVILSIYLYYKIYFDYKTEDIIKLALAYK
FT                   KEQSQQQLLKKAKEILVSPKEMYLNISKNITLRILSNQNEYLKVVSKFIEGIERGFVKR
FT                   EVEVSTKNLNIDFFKSGRYLIFCYDYPVNLNVFLYELTRRTTDKIPKGFEFDKIFIKED
FT                   SNATIVYFFNSQKQVAILQKFDQFGFLPLERVIEKNLSIIYSWADGLGFTEIAKNDVLI
FT                   PIEFSDVQFSEIKIKDSSFKKEWIVRRLFPDTILTRKNILKDGDIAITDERKMLVFKND
FT                   RGFEFEYTEKAFGDRVDSVCDTLMFYLKTFYTDEDLRVFSLKTEKEGNFTIKLGLRTSG
FT                   IDIASSDEEYCVEIEVKSGRIYRISGYIFDIIKVRTSQIKVEGIAAIDTLKERKGDIFI
FT                   EDIDIEYVLGGASSYPYWKIKTQNGVAFVETIK"
FT   gene            88387..89115
FT                   /locus_tag="Calkro_0066"
FT   CDS_pept        88387..89115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0066"
FT                   /product="Protein of unknown function YycH"
FT                   /note="PFAM: Protein of unknown function YycH; KEGG:
FT                   ate:Athe_0084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44982"
FT                   /db_xref="GOA:E4SCC7"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC7"
FT                   /inference="protein motif:PFAM:PF09648"
FT                   /protein_id="ADQ44982.1"
FT                   /translation="MNWSRVKTIAILVFALIFVFLVIRYLNLFPKEEYLTKQQVDIAKS
FT                   ILSQNSIKLLCDVDRRIYYVSKLSVTTENKYDSIVTKLFGKRVDRYQNEFESSIYHLKI
FT                   VNQTLFLESKYYQDPFELFDIKKGDYIKDYDGSFIQVFRGYPIFDGRLKVIKQKDNTLY
FT                   IFSKINPKRFEIKRTRAISALEAVFNLLNQQKGIKEIQNIKFGFYLKDFNVIQGQAIPV
FT                   WRIIADGNVYYINGFTGMLE"
FT   gene            89338..90294
FT                   /locus_tag="Calkro_0067"
FT   CDS_pept        89338..90294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0067"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0085
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44983"
FT                   /db_xref="GOA:E4SCC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ44983.1"
FT                   /translation="MESVISPNMQHSRQSGFKRFLHKLNEQKYLQAMAIPGVIWMIIFN
FT                   YIPMYGIIIAFKEYDITLGFNKSPWVGLANFKEFFADERFWLIIKNTVGISFFKLLVGF
FT                   PLPILFAVLLNELVSVRFKRTVQTISYLPHFISWVVLGGILMNWLSETGLINIILTKIG
FT                   ILKQPIAFLAEPKYFWGITVVSEVWKELGWNAIIYLAAIAGIDPELYEAATVDGAGRFT
FT                   KMFKITIPCISGTIAIMFILAVSGLMNSNFDQIFVLRNPLNADASDVIDIYVYRMGIEA
FT                   FRFSYATAIGLFKSIIALMLLLTANGVTKKLTGKSLF"
FT   gene            90342..91226
FT                   /locus_tag="Calkro_0068"
FT   CDS_pept        90342..91226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0068"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0086
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44984"
FT                   /db_xref="GOA:E4SCC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCC9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ44984.1"
FT                   /translation="MKIKSSFGDKIFDIFNITLMLIICFLTLYPIWYIIVYSFNEGKDA
FT                   MLGGIYFWPRKFTLDNYKTVFSNSDITTAFMVTVARTVITTTLHVFFTAMVAYAFLRKE
FT                   LLGRKIYMAMGTITLFFGGGLIPYFLLIKSLGLYNTFWVYVIPGMFNFYNLIIFQAFFR
FT                   ELPIELEESAKIDGANDFIIFTRIILPLSTPVLATIALFVGVYNWNDYFMGVIFINNPK
FT                   LQPIQTFLYKVIAQVTSNQMLAYAPGGIATRNVTSQSLKMATMVITTLPIVCVYPFLQK
FT                   YFVKGLLIGAIKG"
FT   gene            91318..92931
FT                   /locus_tag="Calkro_0069"
FT   CDS_pept        91318..92931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0069"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2552 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44985"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD0"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ44985.1"
FT                   /translation="MRNLKLKRLLALVVAIAFVASLVPFAIGSAASSVKPGWKEDAKKP
FT                   ITFDWYINFSWFGTKWGGNAVSDYITKKTGVKINFIVPAGNENEKLNVMIASNTLPDFI
FT                   TLGWWEEAVKKMIAGKLVYALDELAKKYDPYFFTVANKQRLGWYTEPDGHVYGYPNASY
FT                   TPSDYQNPKLKIYSNQTFLVRKDMYEALGKPDMRKPDTFLKALADAKKKFPTVNGQPLI
FT                   PIGFHEFTDTGCYSLESYLWNFLALPREKNGKLYDIVAHPEYIRWLKTFNEAYRRGLIA
FT                   KDVFIDKRAQMEEKIAQGRYFSMIYQRTDFVAQQQELYKKNPNMIYIAVDGPANSKLEK
FT                   PKLAGPGIAGWTLTMISKNNKDPKRAIRFMSYWLSPEGQKDFYLGPKGVTWDVINGKEQ
FT                   FKPDVVKLMQTDRGAFDKKYGAELTYWMLGDWPYVSQWDPGMPPYLQQMADWTLGKTVS
FT                   YAQYDNLNPPADSPEGVIARKIALKWGQTLPKLIMAKSSAEFDKIFNEFQNYKKQIGFD
FT                   KLLAWQQKKLEENKKKLGLK"
FT   sig_peptide     91318..91398
FT                   /locus_tag="Calkro_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.302 at
FT                   residue 27"
FT   gene            93103..94929
FT                   /locus_tag="Calkro_0070"
FT   CDS_pept        93103..94929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0070"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_2551 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44986"
FT                   /db_xref="GOA:E4SCD1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD1"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ44986.1"
FT                   /translation="MKHSTLKHIIKNIFKFNIRQKLILTYIFIVAVPLSILQVNAFYRV
FT                   RIMTEKEYINNVNFEVSKLKNDIMKNIEQFIKATQFILNNQEFIEFASTYQERNVEDIY
FT                   SFKVNVLDKIEYLQYVNFNINRIRFFTNNHFIPEMWPTLYHIERLKNFKFIDKFLSDKK
FT                   QTSLWKLNNTDILGPPLNSDEKVVSLYTKVTDLVGNLIGIIEVNMKIDEFFASELSRES
FT                   DNSVTIAISQNGDAIFSKQTPPFLKRLNLSSKKLVELLEDKVKTIESEGIVHFKINKNS
FT                   AAFIYTYIPVLGVKLYKIILFDELTKKINEITLQMLGQALVLIIISSILIFILITLILK
FT                   KLRQVILSMRAVENGNFDISIDIKGDDEIDELAQHFLNMVEKLKILIGEMVRREVAQKD
FT                   AQIKALQSQINAHFIYNVLENIKMMAEYSENYDVSDAITKLGKMMRYNMSWKRKFVTLK
FT                   EEIENIQNYISLMNIRYDNEIKLLVNVDNEILNIEVPKLILQPIVENAINYGIEPKGEG
FT                   GSIFIDGSIIGNYIVISIIDDGLGIEEEKLVAIQTALENDTETECYHGQGIALKNVNER
FT                   IKLAYGKEFGIKIDSKFGEFTKVTITLPYNRF"
FT   gene            94965..96512
FT                   /locus_tag="Calkro_0071"
FT   CDS_pept        94965..96512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0071"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2550 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44987"
FT                   /db_xref="GOA:E4SCD2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ44987.1"
FT                   /translation="MRKVLIVDDEKLIRKGIRTILERNIADLGEIKEASNGKEALDLLF
FT                   LERFDILIIDIRLPQMDGISVLKKIQNLSHKPKIIVISGYDEFSYAKECMQYGARGYIL
FT                   KPIDKKEIIEIVEKVKSELQEEENNLRLISLQKILRAKMFESEINNIIFSGMDIDRFKE
FT                   RLKDMEILADEKVMAVYFLLPGNNPDLNDFSAEEDKLKLSKILPEGSYVSTIYNQRKDI
FT                   LMFTKMAFCYEDIKKSYETLTGRKVYMGICDLQESFENVKLLYERAYKAAFYSFILNKE
FT                   IEFWSQISWREKEKLSQSDSIEKLKELILAGKQKEAIRFLESIFDYHFFNKYSADSILA
FT                   LSEKLYTQIVDWFCHHVPKKVLDIHEYQVLASMFNFATISDYVNHFKKFIVEATEMVSS
FT                   LKGILNVKDEIDEAIKFINQNYHKDINMAMVANHVSLNYYYFSSIFKEKIGMSFLDYLN
FT                   KVRIEKAKELLANTDLKVWEIAEKVGYKNPKHFARIFKDITGLTPNEYRDAQKRLKE"
FT   gene            96678..101876
FT                   /locus_tag="Calkro_0072"
FT   CDS_pept        96678..101876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0072"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="KEGG: csc:Csac_2548 carbohydrate-binding CenC
FT                   domain-containing protein; PFAM: glycoside hydrolase family
FT                   16; S-layer domain-containing protein; Carbohydrate-binding
FT                   CenC domain protein; Carbohydrate binding family 6"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44988"
FT                   /db_xref="GOA:E4SCD3"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD3"
FT                   /inference="protein motif:PRIAM:3.2.1.39"
FT                   /protein_id="ADQ44988.1"
FT                   /translation="MRVKNLVANILLFAFFIMIIFPGGIAKANSVQIFKDVSTNFAKDD
FT                   ITRFYQLELINGYPDGTFKPAKNTSVAEFCKILNSYMGFVQEAPLDVSLRISPLAWYYR
FT                   ELKKAQAAGYLALFVKEGKINPNRFITRQEAFAAVAAALKLESQKEDILNSFSDVQQID
FT                   PRYLPGLAALVSFGFVKGYPDGTLKPEKGITRAEIVKLLSGIGALIATKPGEYTLSQKE
FT                   GFVIVNSSDVVIKDVSIKGNIYINQSVGEGSVTLNNVTIDGGKLFIFGGGENSVKLVNT
FT                   KVKEIVVDSKLFKTNIEIGQNSQAENIIVLSSANVTQMSDGSSIKFITLKQSGNQSADV
FT                   EIKANCETLYVFSPNIKVNIKNSKIKNLIASDLAQNFTLSVSSSKIESVELNSNGNLNI
FT                   DKESGIEKLIVKALAKDVKINSNGKINEASVYSEGVVLNGKTLSKGEKVDINAVESKQP
FT                   SSSTAAQNTLPVQFSGSSSSTTGGTSQGSTGAAPDQTGNNNQNQQGGNQIQPTWQLVWE
FT                   DDFNSSSIDTTKWNFTIGAGGYGNNELQYYSSRPENARVENGNLIIEARKENFEGSPYT
FT                   SAKLTTQGKFSFTYGKVEVRAKLPEGQGVWPAIWMMPEDMNLYGGWPVCGEIDIMELLG
FT                   HEPNKVYGTIHYGNPHTYHGGNYTLPNGQKFSDDFHVFGLEWEPGKIKWYVDGQLYYET
FT                   SDWFSRSSNEAFDYTYPAPFDREFYLILNVAVGGNWPGYPPKDANYFPQKMVVDWVRVY
FT                   KKAGVTYPDNVVKPQESITYPQDARPPLSDGNLIYNGSFDQDSPDIDGIEGVANTDYWQ
FT                   FLHLPDFGGDGTIENIGGSVKINIAKPGSQTYSLQLIQRPICLIKGKTYKLTFRAKSEG
FT                   SRTIEVKFSSGGGDNGSTWIDYAVKTFNLSSDWQDYSYIFTMQSSTYTKARIEFNVGLN
FT                   NLPVYIDDVKLVEYDVNDPSAVKEPLPNGNLIYNGTFDQGDGRFAAWEFVKETVADATY
FT                   TIGSKPEDRYFKAIVANGGQNFSDIKLVQSNIKVGAGENLLLSFSAKAFESLRQIKVYI
FT                   SDQNFNPITEVKEVSLSLDWNVYKFNLKSIDNLPSDTRAKLVFEIGASNSDVGIDNVSL
FT                   KKVLPSSFIVVQAEDFGSISNATNNRQYVAFSQGGAASFSVNIPKSGEYLVSYRLKAGQ
FT                   GSSLKLIVGSIVYDAEVAPISTNWVIVSDTVYLESGENSMQLLADNVDLDYVEFSPNFI
FT                   KNGDFSKDIENWTTWFGNGGTGAAQVSRGQLKVSITNIGLAFWSIQVIQGPMTLESGKT
FT                   YRITFDAKSTSARDIFIKIDDSNYYGHLERYVPLTDKMKNYTFDFEMDATRSDIRLVIG
FT                   LGTMSPGGANPQNQAHTVTIDNVAIAEVSENCGYFEREVSEILTGEAPSEPQQFVGDKL
FT                   LPDGSFETQEALDNWHWWSSAGNNVAMSIENGELKLSVSSIGSDPWDPQLYRQEIPLVN
FT                   GKNYKISFKARATYPRKINVAIGKPLTSDPWFIEYMPKKTIDITSEMAQYEIYFAMNNP
FT                   TDLGAKLAIEIGNVAGYSQVPFDIYFDDIQIEVVDSIPQETVPPAQHTQKVGDQIIPDG
FT                   TFDTGLGEWVYWSGDQWSGVSDMQVAAENGKLKVHLNSVGWQPYSAQIARKNLTLENGL
FT                   TYELKFKMNASQNTKIQVNIGKELTSDPWFIPYAPTTVFDIGTQQQEYTLRFKVTQPTD
FT                   VTKVVFEFGPINGQYPPLPLDIYLDDVTLTVVSDQ"
FT   gene            101988..105221
FT                   /locus_tag="Calkro_0073"
FT   CDS_pept        101988..105221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44989"
FT                   /db_xref="GOA:E4SCD4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD4"
FT                   /inference="similar to AA sequence:KEGG:Csac_2547"
FT                   /protein_id="ADQ44989.1"
FT                   /translation="MQANPKYYYDEKTNSFCIENYQLSKPFSSFLPGIAGIFGIPLWCF
FT                   YVNRGQCIVSFGTKNKDGAILEFLPADRAYRLASTHGFRTFLKLNKNLFYEPFQTENLL
FT                   NFAKSKMYIFADHLEICEENPDIGIKAEVRYYTLPNKNVASLVREIKVTNISQRSLDIE
FT                   ALDGLALIVPYGKNDFALKNMSRTSEAWNFVENLDKKAPYFRFHSSADDTTEVVEIKEG
FT                   NFFVSFDNTHGSFERCDVVIDPKIIFGISSEIAKPYEFIFSDRLDISNQVFANKTCCAF
FT                   AYAKRTLEPQQTLILHSIIGHAKSIDELNYFVDSICSSEFFKEAFEENKAVIDAIVTNN
FT                   TIVTSDKKLDEYAKMCYLDNILRGGVPFTIVHGDKKDVIYLFSRKHGDLERDYNFFEIQ
FT                   DTYYSQGNGNFRDINQNRRNDILFNPDIFDFNVWYFMSLIQLDSYNPLVVKGIKYRLNS
FT                   FEPLDKYVISGKEELKKFFDKDFLPYELIKFLENQNIEINISKEDFVNCCLVNSEKVIE
FT                   ADPGEGYWIDHFTYNFDLIENFESIYPDKMRQLLLQRKYYYYDNEHYVKPRKERIKIID
FT                   GQIKQHGAYALDKEKKELINSRADKKRYVRTHNGLGGIYTGSLIEKLLVILLNRMATLD
FT                   PFGVGVEMEASKPGWNDALNGLPGIFGSSACETFELLRLVRLLKKYFEVYLEDVKEIEV
FT                   FEELYYFFVKLKKLLSQTQNDEETLFYWDESNNIKEEYREKTKFGVSGNMACINREEML
FT                   KFLDLCSEKLSKAKEKAFDSEKGLFYTYFINQPVEYEYDAQKQEIKIKKFSQKKVAFFL
FT                   ESQVRAMKVIDDVETKRKIYQSVKKSDLYDKVLKMYKTNESLANQPNQLGRIKAFTPGW
FT                   LENESIFMHMEYKYLLELLKGGLYTEFFEDFKMALPPYMDPAVYGRSIFENSSFIASSS
FT                   NPDKSVHGTGFVARLSGTTTEFLNMELIMLFGEKPFEYKNGELIFKLSPKLPSWMFAEE
FT                   EREVEIMVNGNRQTIILGKNQLAAVLFGKTLVIYHNPSKTNTYDKDAKVSKYILHFDDK
FT                   VVEVEGEIVKEPYSYDIRKGLCKKIEVLL"
FT   gene            105309..107078
FT                   /locus_tag="Calkro_0074"
FT   CDS_pept        105309..107078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0074"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_2546 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44990"
FT                   /db_xref="GOA:E4SCD5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD5"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ44990.1"
FT                   /translation="MIKKLLGKWNDIKLKNKLLIAFMILILVPMFLIFILSYTSLKNST
FT                   LSKFTIYNQVLFENAAKEVQNFLEELNSIKYDFIMDDGLMSDIGKTFARYTDPQDSFLY
FT                   TNILTKISQYISTKEIIQSVQIINKSKEIYFFSKLQGDVPYEDDKQIKKGFFNEIVKQE
FT                   GKYVNGGYDKSRGVYVVGCELFSRDRIQPNGEMIVSFSLDFLKDIIGKYHLTEGGFYVV
FT                   DGSSNQVIFKTTDKFESIIEKLILKDETKLIPKTIFFEETIPDLNWKIIYIVPESFLLN
FT                   NFSYTKRLLILSFSFLAIFAILFLIFISENITGPITKLIYQMRNLEHSKLKNNIKIARK
FT                   DEIGDLLNSFYQMLKKIDELVIRVYEEEIARKNAEINLLYMQLNPHFLYNTLDTINALA
FT                   ELGRCKDVSVVAVSLAKFLRSNMTINKSTVSLADEIKQIEHYLTIMKIRFSGKLSYRIV
FT                   YSQEEVLKAEVPRHLLLPLVENSIVHGFKNKSGDAKILIRAKKIENIFQIEVVDNGCGI
FT                   ELAKIEKIKNASNDGIGIPNIINRLKLLYKEDFDFEIRSKVGFWTKIIIQLPWDKVVKK
FT                   EEKENVHSFDSGR"
FT   gene            107050..107805
FT                   /locus_tag="Calkro_0075"
FT   CDS_pept        107050..107805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0075"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2545 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44991"
FT                   /db_xref="GOA:E4SCD6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ44991.1"
FT                   /translation="MCTLLIVEDEEILLERLVKTIDWKSIGINKVIGKAYSEEALNVLI
FT                   TENVDIILTDIRMPVMDGLDLAEFVRSRLKHPYVILMSGYKEFEYAHRAIKLGVVDYIL
FT                   KPFTKEEVLETVKKAVEKVAAEQSRQKRLDSCENKNIIDMVFDFIFANCSKQISLNDVA
FT                   EYVHLHPVYLSRLLKNKTGKTFKEILTEVRLKKAEKLLKTSSLKHYEIAEAVGFSDAQY
FT                   FSQVFKKVYGMTPIEWKKKAYAQDSKLKI"
FT   gene            107760..109202
FT                   /locus_tag="Calkro_0076"
FT   CDS_pept        107760..109202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0076"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2544 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44992"
FT                   /db_xref="GOA:E4SCD7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ44992.1"
FT                   /translation="MEEKSLCARLKVKNLNKKVVFVYINYWAFNTKIKSKEQKIKGGSF
FT                   IMKKCLKVVALAILVVFSISVVLVGQMGEKKVQGATNELTFWSWVSDSDTIKQVYEQAI
FT                   KEFNSTNKYGVKIKAVYTPGEQYKTKLQTAMAANNPPDILNMWAAGKMKPYVDANRLYP
FT                   ISDIMNKDSQWKSRYVDGVFDLTTFNGKIYGIPQIRVATVIYYNKQIFQKYKLTPPKTW
FT                   SELVNVIKVLTKNNIIPFALDARDPWILAMYAEYIANRIDPDAYRKVQKDPNAWTDKAF
FT                   IETGKKIQELVKLGAFPKGATSLDYVAARNLFDQGKAAMYVMGIWDVGYLSTQSPVKKY
FT                   VGAFKWPAIEGGKGNINNFLAGIEQVIAVSSNCKNKQAAAAWLKLLSEQRYAKDLLAEK
FT                   AGYFPTVKVNPDPKKVTGLYLEVLNLLKDQNTKDSFTYYDVMFGPIIGDGFNNTIQSIY
FT                   LGKDPVEAFKKLAEIAKKEMKK"
FT   gene            109302..110180
FT                   /locus_tag="Calkro_0077"
FT   CDS_pept        109302..110180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0077"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2543
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44993"
FT                   /db_xref="GOA:E4SCD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ44993.1"
FT                   /translation="MERAFGNKLAIAIFIAPALILFTLVIPLPILHSFYMSLFKWDMLS
FT                   TMTYVGFENYKELFSDGIFLFSIWHTIEITVLSLIFQVILGLFLALCIVNITKGRKYFQ
FT                   NAFFIPNILSSAVIGILWFFVYNYDFGLINSILKSIGLDSLQQEWLSQKYVILALSITT
FT                   CWQWVGYHMILYIAAISGISQDIIEAAIVDGAQGLKMVTKIIIPQIRPVLRVSIVLIIT
FT                   GSLKYFDMAWIMTEGGPDFASETIATYIYRTAFNKLQYGLGSAASTFLFAVSILITVLI
FT                   NKLAAKREEVY"
FT   gene            110202..111050
FT                   /locus_tag="Calkro_0078"
FT   CDS_pept        110202..111050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0078"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2542
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44994"
FT                   /db_xref="GOA:E4SCD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCD9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ44994.1"
FT                   /translation="MFAKYIKLSPVAKAIIFAFLTFYSILTLFPLIWLVYNSVKTNNDF
FT                   LANPFGLPQISNLQLKNYYDAWVTMGIQRFTINSLIISSVSVIFSLIISSMAAYAIERM
FT                   IWRSSQKVLNYFLSGIMVPIQIILIPLFINFKKLNLLDSRIGLLIPTVAFALPTLIFIL
FT                   TGFYKTIPRELEEAALIDGCSVYKIFYKIILPLTMPAFVTIAVFNFLGAWNDLLIPLVL
FT                   IQTPEKMTLPVGLLNFRGMYGAELTKMFAAVVISAIPSIIIYFVLQDKLLKGMIAGALK
FT                   G"
FT   gene            111182..114337
FT                   /locus_tag="Calkro_0079"
FT   CDS_pept        111182..114337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0079"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="KEGG: cth:Cthe_0660 glycoside hydrolase family
FT                   protein; PFAM: coagulation factor 5/8 type domain protein;
FT                   glycoside hydrolase family 81; SMART: coagulation factor
FT                   5/8 type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44995"
FT                   /db_xref="GOA:E4SCE0"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE0"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ADQ44995.1"
FT                   /translation="MKYSKRIINILLILVFILTMVWPMGSYVFAGTITVGAGSYTDTLP
FT                   SGQVGPPSTVYKTSNLTGGIPTNSWESSILWSQYSEAMYPHPLSVKFTANGLEVGRPQK
FT                   SGEGTSAYTGRFVLWQHRVDMTIKNSNYSSYTDARADKITDWSFDGVLTSGSSTVLKAT
FT                   ITKGSPYIYFDFPTGKPQIVFPAVPTVFYGNSSSQYLGITINGVSYGLFAPAGATWSGI
FT                   GTTTLTCNLPSGKTYFSIAVLPDNTTSTLNYFKDRAYAFITNTQVSWSYNPNTSEVTTT
FT                   FTITTTAKEGSNLDTIICLYPHQWRNNSLSYLPYTYNTVRGLMKTILGRSFTTKYKYYG
FT                   ILPTMPLNGSDLSTLNSLLNSESTTISSSDTYWNGKEQNRVSSIVQLAKMNNNTTVMNS
FT                   AISALKNNLQDWFTYSGTSDSKYFYYNSTWGTLIGYPPSYGTNDQINDHHFHYGYFINA
FT                   AAQIALVDKNWASQNQWGGMVNLLIKDIANWERTDTRFPFLRYFDPYEGHSWASGHANF
FT                   VDGNNQESFSEAMNAWQAIIIWGTVTGQTAIRDLGIYLYTTEAEAMYNYVFDLYNDVID
FT                   HSGVYNWHYASLIWGGKYCAEIWWDAGSVANFAAQSRGIELLPITGGSFYLAKDKTYVQ
FT                   NYYNEMLTQAGTSEPSSWRDIWYMYLALANPSLALSKWNTSIQNETGQSKSFTYVWLNA
FT                   LNTLGTPDFGVTANYPLYQVFNKSGAKTYVVYNPTDSQLTVTFSDGKVVNAAANSLVVD
FT                   NGSSSSATNIALNKPATASSIENSNYPASYAFDGNLSTRWSSAFSDPQWIAVDLGAIYS
FT                   VNKVILYWETAYGKSFQIQVSTDNTNWTTVYSTTNGTGGVNEITFSPVNARYVRMYGTE
FT                   RGTQWGYSLWEFEVYGTPSGSASYLPQTTWYLFNQQTSGVTPSGENLQTSNSSVTGWQP
FT                   TTTISTTTKHWYSPVINGTYKAGTWQFILWTNSPGSSSQVKVEIYKVNSDGSGATLIGS
FT                   QTIDVNTTGTGNHQSVFNISNSSDVSFNSQRIRVSITKVSGVDCTIAYNTNDFPTRLIT
FT                   PGQ"
FT   gene            114809..115468
FT                   /locus_tag="Calkro_0080"
FT   CDS_pept        114809..115468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44996"
FT                   /db_xref="GOA:E4SCE1"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE1"
FT                   /inference="similar to AA sequence:KEGG:Athe_0088"
FT                   /protein_id="ADQ44996.1"
FT                   /translation="MTDLYITILFVSIIIAFGIEILQSKTFHKSCVTGDKNLFLPIGMT
FT                   FLGIHLLITFPGMISIKIWMMLNLIVLWILSYYKETIKKEILFKNISKLLKSQRRKIFF
FT                   ISSILCYIIVCLLLNYYIAYKFIYSSVVSKLTITFTISFLILTEAKNIACFITILKFYC
FT                   ISLVTIWGENLVKYEGWLIGATRDYYILKEKFSGKLITVKKDIVNQIVIMGKVFER"
FT   gene            115754..116830
FT                   /locus_tag="Calkro_0081"
FT   CDS_pept        115754..116830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0081"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="KEGG: ate:Athe_0089 endo-1,4-beta-xylanase; PFAM:
FT                   glycoside hydrolase family 11; Carbohydrate binding family
FT                   6"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44997"
FT                   /db_xref="GOA:E4SCE2"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE2"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADQ44997.1"
FT                   /translation="MRFKKFLKVLIAVLMCFVLGNPFYAQAAITLTSNASGTYDGYYYE
FT                   LWKDSGNTTMTVDTGGRFSCQWSNINNALFRTGKKFSTAWNQLGTVKITYSATYNPNGN
FT                   SYLCIYGWSRNPLVEFYIVESWGTWRPPGATSLGTVTIDGGTYDIYKTTRVNQPSIEGT
FT                   TTFDQYWSVRTSKRTSGTVTVTDHFKAWAAKGLNLGTIDQITLCVEGYQSSGSANITQN
FT                   TFSITNDSTGGGSTTPTTTKVECENMSLSGQYASKISSPFSGVALYANNDKAYYTQYFA
FT                   NSTHTFSLRGCSSNSNRAAVDLRIGGTKVGTFYFTGTTPTVQTLSNISHPTGNQTIELV
FT                   VTSDNGTWDVYLDYLEIK"
FT   sig_peptide     115754..115837
FT                   /locus_tag="Calkro_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            117217..117636
FT                   /locus_tag="Calkro_0082"
FT   CDS_pept        117217..117636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaO19.11807 low complexity protein with
FT                   similarity to trypanosomatid mitochondrial ATPase 6 (MURF
FT                   4)"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44998"
FT                   /db_xref="GOA:E4SCE3"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE3"
FT                   /inference="similar to AA sequence:KEGG:CaO19.11807"
FT                   /protein_id="ADQ44998.1"
FT                   /translation="MKNEKIYAYFIIMFGFTSLFYMGLIIFGYIREILNKIHIKRVKGY
FT                   VKRYLMPQNKIEKIFTIIIVTFLVFFYISILIFLFIKYKFLGILLFVLILVLILTFVLL
FT                   LLIFLVKQIKFEDYLYKGIKNSNCTIWVITNILLI"
FT   gene            117717..118166
FT                   /locus_tag="Calkro_0083"
FT   CDS_pept        117717..118166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ44999"
FT                   /db_xref="GOA:E4SCE4"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE4"
FT                   /inference="similar to AA sequence:KEGG:Csac_2541"
FT                   /protein_id="ADQ44999.1"
FT                   /translation="MGNIKPFLILFLAIYNHLYYIYLWIGYPEYLLQYYSKGININNSF
FT                   IVRTKIFLSVLVWNTYYLIFEFLTLLPLTNTNNIGIRLNQIINVVVFVANKIAGIDGMI
FT                   ELSDISESGQKILNLFVLWGKIIYFVVIGLFILSLIKEKSLKNSR"
FT   gene            118401..119822
FT                   /locus_tag="Calkro_0084"
FT   CDS_pept        118401..119822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0084"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: dth:DICTH_1903 putative sugar uptake ABC transporter
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45000"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45000.1"
FT                   /translation="MSRLFYLKNWRLVAIVTALIFLAGIVLGVTLISSKPAKAVASQTV
FT                   SIRVGIWPLDNDEAGKKAWEKYAANFKKKYPNIKLIPDPYSYSPETFLPKAESGDLPNI
FT                   FYTWFTEPRKIIPAGYAADITTYAKKYGYDKAINPDVLKLLTYNGKIYGIPRDGYALGL
FT                   YLNMNLFKKAGLVDKNGLPKYPKTWDELAKTAQIIKQKTGKAGFFMPSKDNVGGWHFTA
FT                   IAWCFGAEFEKKVGNKWVQGLDSPGSVAALQFIKDLKWKYNVLLPNTLLSWGDWIKFYG
FT                   TDQVGMVLAAPDVINLPVQDYKMSKDAIAIVPIPKGPKGQYTLMGGTAIMFSSNSTPAQ
FT                   IDACFKLLEVIGMSPKVDKETLNAIEISLKEKAAQGLPVGPRALPVWINPERVKAEDEI
FT                   YKKYTNVNMALFKPYYDEAFKHLKPEEPYYCQDLYRILDGCIQQVLTNKNADPKKILQA
FT                   AGKEFQTKFLDKVKE"
FT   sig_peptide     118401..118487
FT                   /locus_tag="Calkro_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.517 at
FT                   residue 29"
FT   gene            119925..120824
FT                   /locus_tag="Calkro_0085"
FT   CDS_pept        119925..120824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0085"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dtu:Dtur_0174
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45001"
FT                   /db_xref="GOA:E4SCE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45001.1"
FT                   /translation="MNKKNVMKLTNSLSENISGWLILLPSIILFTFYIWEPMIYSLILS
FT                   LNETKGFRIERFVGLQNYIDVLKDSVFHQALINTFFYVIWSLIIGFLVPIVVALIINEM
FT                   VHLNSFFRFSIYFPNMVPGVAALVLWGFLFDPSEGGLLNAIRIKLGLYPSDWLQNPKLT
FT                   IPLLIFIMTWKAAGSTALIYIARLQGINQELYEAACIDGAGIFRRIIHITLPELYSTAR
FT                   MLLIMQIIFVFQVLYEPLVLTGGGPNNASLSLMLLAYNYAFVDFVAGKSATVSVLVTLI
FT                   LMCLTFIYMRVTKENNNV"
FT   gene            120843..121727
FT                   /locus_tag="Calkro_0086"
FT   CDS_pept        120843..121727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0086"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dth:DICTH_1901 integral
FT                   membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45002"
FT                   /db_xref="GOA:E4SCE7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45002.1"
FT                   /translation="MNLNKLDSKTTGIINFLDLRKPAVKAFYYILLFISCCIAFVCLAP
FT                   PLWVFLSSLKNIKEFAQVPPTIIPHTFEPQKIITTWKTLNFTKYYINSFIMVAGSVVCA
FT                   IVFNGLAGYVISIIKPRGYRFVFNLILWSLMIPATINLVPIFKNIVALKLNNSYIPLWL
FT                   SYGANAFYVLLFKNFFDEIPREIIEAAKIDGCPNLRLFYKIVMPLSVPIIMVVTIFSIN
FT                   ASWSDFLLPYIVLKNRESYTVMIKIYEMSFGNTWMSADMKMLAVLYAILPPVVLVIFFQ
FT                   KYLTQGVVIGSLK"
FT   gene            121782..124079
FT                   /locus_tag="Calkro_0087"
FT   CDS_pept        121782..124079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0087"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: cpy:Cphy_3314 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45003"
FT                   /db_xref="GOA:E4SCE8"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE8"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADQ45003.1"
FT                   /translation="MINKKGSRYVKVDPWRIIEENFDKSNMRILESLFTVSNGYIGTRG
FT                   YFDELYTGDTHIGTYVAGVFEEVYEKPSYKGVPNRTQFVVNNANWLYTRIIADGEELDL
FT                   NHSNFSEYKRVLDLKRGILTREFIWHTKKGSSFKLKFERFISMTKSNVCCHKMEITSLD
FT                   KSGKIKIITGVDFSHKHRIYDTNYWEGLFKSNENDYISIGCKTIKTNKISIANFKIEVS
FT                   KACAQGIVEGEKKIAKEMVFDIEENENIEIKKVVVINSFDRLNENLQSENGKLCQYIFG
FT                   QYSYSILKQEHERFWERMWEEVDIEIGQDSENQQGIRFCIFQMLQAYSGMQDVVTGIGA
FT                   KGLSGEVYNGNSFWDSEVYCLPFYLFTNIDAAKKLLEFRYFTLPQAQQRAKELDLKGAF
FT                   YPIATIDGTESCTLWQHANLQLQVSTAVAYGLYHYYIVTKDEKFLFEKGTEILIEVCRM
FT                   LESRCQLGQKDGKYGFFGVMGPDEFHMMVNNDFYTNYMAKKTFEFTIEVLKLLKAKDEK
FT                   LYNEITRKTKLERNEVERWADIAKNMNIIQDPQSKVFEQHEGYFNLPHIELSTIPEDQI
FT                   PIYKNWAYDRIFRYDMIKQPAVLLCMLLYSSDFTFEEKKANYDYYDLRCIHESSLSPSI
FT                   HSILACELGYYDKAYEYFKYATRLDLDNYNRNTDEGLHITSLAAAWLNIVYGFGGMRSD
FT                   TVPIKLAPIIPENWSYYSFRIKYNGAVLKIVVDPQNVTIKKLKGADVELMVYDKTYTIT
FT                   EDEIKIPLQQRR"
FT   gene            124088..126367
FT                   /locus_tag="Calkro_0088"
FT   CDS_pept        124088..126367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0088"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: cpy:Cphy_1874 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45004"
FT                   /db_xref="GOA:E4SCE9"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCE9"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADQ45004.1"
FT                   /translation="MSWRISKEGFDPSSIELDGSRFLIANGYMGYRGTLEEFGKNELVA
FT                   CTVAGVYDRYDDKWRELVNVPNGLFVKVNYNNTLLSPMTFQDCAHTYGLDLKDAYYFRN
FT                   TKFFVDKEKWIKIKTKRFASSTDYHLLCLEYSITANFDCEIEIETGIDCDIWEINGPHF
FT                   KGMSFQKLDGIYVTRLTTNEGKNFAVAETADHLDNFIDKEYLRLYARKSKVKLASDKEF
FT                   KFYKYMCVTHSIEFENPFDEAIKRINEAKNLGFDYLFEKHRERWQERWSICDISIDGDE
FT                   KAMLALRFSMYHLLSIAPYHSEKLSIPARGLSGQMYKGAIFWDTEIFMLPFFSYTLPDV
FT                   ARNIVMYRVHTLDGARRKAKEYGYGGAFYAWESQETGDDACSLFNVTDVITQRPIRTYF
FT                   RDKQIHINGDVVYGFFTYYNATGDFSIFLEGAAEAVFECAKFYYSYAYYKPLKDRFEIL
FT                   DVTGPDEYHERVNNNAYTNRIAKFTFEKAIWLYDILKEKYPNILQEIDSKTCISQYIEK
FT                   IKEAEQKIFLQKPNEEGIIEQFDGYLKLEDIEVEKLKDKMLHPYEYLGGGNGLATQTQV
FT                   IKQADVVVLLNLFESEYEKAILKANWEYYNGRTEHGSTLSYSMYGLLAAKLGKLKDAYE
FT                   YFLKTALIDLEGNYKQYVGNLYIGGTHPAANGGTWMAAVFGFGGIRVEGTKVEMDPHLP
FT                   AHWKSLRFNLIIHGNLFEFEISNSKILIKSTRLKNSKNRSYRIVANKSEFIHEIGQLLE
FT                   INLKGE"
FT   gene            126372..127040
FT                   /locus_tag="Calkro_0089"
FT   CDS_pept        126372..127040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0089"
FT                   /product="beta-phosphoglucomutase"
FT                   /note="KEGG: cce:Ccel_3242 beta-phosphoglucomutase;
FT                   TIGRFAM: beta-phosphoglucomutase; beta-phosphoglucomutase
FT                   family hydrolase; HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45005"
FT                   /db_xref="GOA:E4SCF0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF0"
FT                   /inference="protein motif:TFAM:TIGR01990"
FT                   /protein_id="ADQ45005.1"
FT                   /translation="MVPIEVLLKSIEGAIFDLDGVIVDTAKYHYSAWKKLANMLGFEFT
FT                   EKDNEKLKGVSRKESLEILLKIGGKENEFSRAQREELMDIKNNWYLEYIVKLTEDDILP
FT                   GTKETILTLKEQGIKVGLATASKNAMLILERLKIKDLFDAIVDGTQISRAKPDPEIFLK
FT                   CAQKLEVDPKKCIVFEDAAAGIKAAKLAGMFAVGVGSLDTLSEADIVVSSLAQLVKELN
FT                   "
FT   gene            127092..129086
FT                   /locus_tag="Calkro_0090"
FT   CDS_pept        127092..129086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0090"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   cth:Cthe_1307 cellulosome anchoring protein, cohesin
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45006"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF1"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45006.1"
FT                   /translation="MVKRLWILSLIVILLLSSFSVAFADIRVETPYMEYQGDTLKFYST
FT                   VESDIYGELSIGDEVLVAVYAIKEDGNSILLGQGKIVILDVYQDQTDGKVYYNGSNYNL
FT                   IETSIPVLSALLTNSSKIKFYAASLNKISNTSNSSYSIFALPPIILPNPASVDKTTLGN
FT                   SDLELSMYLPASVQISKIIKSATQTELRKDIDYVISNSKLYFKNAYVKNLSLGQNTFEI
FT                   YDTLGNITILKVNVTESAQVPSNQQGSTPSQSSGSAATNAGSNQQGTFQQSSAEDKSKL
FT                   ESTIQISVDKNLNTANAVIDKDTISKLLLSQKVEETKKLILNVKAEGNISTYNMNLPKD
FT                   TLQVLSDKVESLKITTPVCSLELNKMLLQDIKDKEVSVKVSNKTENIAESVKQILGQKP
FT                   IVSVQITAGDAKLESLGKSAVKLEIPYKPSAIEKENTHKLVGVRIDGDNIVTLKQSFYS
FT                   AQDGHFVIFTDHLSDFSLLYRDVSFDDAFYSYAKKQIEFLAARDVIKGVGKNKFMPKNN
FT                   ITRADFVTLIVRAFGLDARVDSNFDDVLPSDYYYQTVGIAKKLGIVNGVGKNKFEPKKA
FT                   ISREDVMCIMERTLKLLGLLEVQEEPTKVLDQYSDSNQISDYAKDAIAQLVKNQIVKGY
FT                   NNMLNPKRNLTREEAAVLLYNIYQNVLLR"
FT   sig_peptide     127092..127166
FT                   /locus_tag="Calkro_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.876 at
FT                   residue 25"
FT   gene            129118..133203
FT                   /locus_tag="Calkro_0091"
FT   CDS_pept        129118..133203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0091"
FT                   /product="Carbohydrate binding family 6"
FT                   /note="PFAM: Carbohydrate binding family 6; KEGG:
FT                   pjd:Pjdr2_4054 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45007"
FT                   /db_xref="GOA:E4SCF2"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF2"
FT                   /inference="protein motif:PFAM:PF03422"
FT                   /protein_id="ADQ45007.1"
FT                   /translation="MKRRLISIITIFIQLLSLIAYVPAVHAQGLPDLIVTDISWQPANP
FT                   QAGDKVLFSVTIKNIGDAPTPSGVIHGVGFHIDNDFTRFWWTDNFTGPLQPGEEKTLTV
FT                   TGGMGGPDRNLPTWDAIGGRHTVWAFVDDYDPNPGDDITGRIKESNEDNNVFGKEIIVA
FT                   AGSGGPRIVRIKSAWTGQYVYQAGDKLQYSYDIPANDARSQWIIEEFEGSIRIKNRATY
FT                   NYIHIENYDSKKYVECGNIDDSWYSARWVLEDAGGSYRIKSVFKNTQYLNIEGNPGYVV
FT                   LSEAYPEWDSAKWILEDVDITQNFTAPLPDLVIEDVYWDPANPQEGDDVLFKVKVKNIG
FT                   EGAVKEGEQIAAGFNVDGRAPWFWTDLYTGGLAVGQSIVLPVIGGTEGKYWKAKSGIHT
FT                   LYCNVDDYDPDPNDDKVGRVKESNDNNNSFHKRLPYIPKAQPKEEPLPLMCGAIYVGGK
FT                   LNVAKDVYHNDTRAENKVMKIREKFSNLKNNNNVDASLFDELAKYKIEKVVVGTPNPAN
FT                   TKPSKFAMYWDENYLYAVVRVYDAAKRKDAPDPGQIWNNDSVEIYLDMDRNKEDSYTSD
FT                   DFQYFFGWNYSQPMEFKHNAIQNVRFTQHDFDDGYGMLIEIPWTTLGVSAQKNMVFGFD
FT                   IAIDDNYANQTRGCQYIWNSKDDQAWQYPNRFGDCQLVLGLGTPKQLPPPQKQQAQKPE
FT                   APPYQVPAGIGASVPWIEFEAENASTNGDIIGPSYEVNDEANEASNRRFVRLDQVGEYV
FT                   ELTATSEVNSIVVRYSIPDSDDGKGIDATISLYVNGQFRQKLNLTSRYSWVYGAYPWSN
FT                   DPSFGAPRYYFDEVRALIGQVNPGDKIRLQVDSGDDSPYYDIDLIDIENVAPPLPKPDN
FT                   FLDIRDFGAIPNDGKDDTKAIYDAIFAAKQQGKGVWIPKGVFEKLEGPVVDNVYSGFSG
FT                   TGYVKGFDVIGATEKLLISGIPSDGNYTMEIRYSNATGIDQALSFMVNGHRYEVSLPPT
FT                   GSWDSWQTTTIDVVLNTGRNLLQIIHQYEDTGNIYLDYVKVNTTLFEAEDGWLTCPIYV
FT                   DNVTIRGAGMWYSTISGPYSQFVLMGNNCKFYDFAIFGETNSRIDELDDNAFLGWGGTG
FT                   SVLENIWVEHKKCGFWVGNSKYGRTDGLVIRNCRFRNLMADGVNLCDGTINSIIENCHA
FT                   RNTGDDAFAIWSATYNQNVWACENNIIRNNTIQQPWLAQGIALYGGSNNIVENNLIIDI
FT                   PTSAGILISTTFPCIPFSGTSEVRNNSIVRAGEQSGKLGAIRIMCDQQDISGIVIKNID
FT                   LYDCTDVGIRFMGTKQANGIVFENVRINYTGSYGIYASGETKGTVIFKNVTIDNTALDK
FT                   VMFETPNMTVEKLEGNNW"
FT   gene            133347..134354
FT                   /locus_tag="Calkro_0092"
FT   CDS_pept        133347..134354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpe:CPE0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45008"
FT                   /db_xref="GOA:E4SCF3"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF3"
FT                   /inference="similar to AA sequence:KEGG:CPE0369"
FT                   /protein_id="ADQ45008.1"
FT                   /translation="MYKSIKYRITLVTSIIFIGFIALVALASNFIFKDFLMDYYYQLLQ
FT                   KNDQSITNNYKIYVTLIEESAKQIGTNSKVFELLKNNNAGGNITEILDGIKLSNTRILA
FT                   VVLYDTNGRYYTSSYVVDYPTLSELLKDKRIKEFVANDKKQSLWLIRNRELAPYYNNTY
FT                   YKSTYGVVSFISKIYDENKRLCGYLVIDIDPKYFYQRHFGVSDHADISVYLYDKDIGLL
FT                   PRQDEQTQTLLKLSSVVKNRKIDSKALKKENTLVRIDDNALLDMVKIFDSGYIVILYNI
FT                   SEFGRDIMTYTIFVIIISVLLIGMSFLSSTILTQTIYKPLINLVSKIRNYNYNN"
FT   sig_peptide     133347..133430
FT                   /locus_tag="Calkro_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.988 at
FT                   residue 28"
FT   gene            complement(134357..136090)
FT                   /locus_tag="Calkro_0093"
FT   CDS_pept        complement(134357..136090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0093"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: csc:Csac_2533 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45009"
FT                   /db_xref="GOA:E4SCF4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF4"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45009.1"
FT                   /translation="MNTNFLRRFKLKSRITFFLVLGIVIFTFTIIYFSRVFSEFIIQKY
FT                   YYKHLKDIHSDIQEGIYLLLTNINLTSVRLLQNQDIYDLLSNTNLSYNEKEKKLTTYLN
FT                   TMGINDYIGDIVIVTKKGEVFNFNTKVNPSLFITKELLSHIEDRRNLFVWGPIVKDNGN
FT                   NYIVLGKRYYNFYTGQYLGYLLMLIDENSIAIICNKSKSSDIVSTLVIDQQNKIISHPE
FT                   SKYVGNIIFENWLSDAKKEFSYSLRTINEGQFLVAISKPSENLERLNCKWFIISLLPLS
FT                   NLKNQLTKINIIIIWLVFFTLILCVVIAIKAASSLTNPIRFLLNRINSIGQTKNVKPYI
FT                   YKNLHDEIWELELAFEEMTKRISNLVETINHDMEKQRELELIALQSQINPHFLYNTLDA
FT                   IAWIAKIKKQPEIENIVMALAKFYRISLHRGEKYIRLSDEIELVKNFVAIEKIRFPNKF
FT                   DIEFEIAPETTDMKILKFTVQPLVENSIKHGILPKKEKGLIVVKSMLVNEDLHIEVSDN
FT                   GVGFDPSELDNLSKNGKGGYGLKNVDERLKIEYGKEYGLFISSEKNKGTTILIKVKARN
FT                   E"
FT   gene            complement(136080..137360)
FT                   /locus_tag="Calkro_0094"
FT   CDS_pept        complement(136080..137360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0094"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: tex:Teth514_0399 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45010"
FT                   /db_xref="GOA:E4SCF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45010.1"
FT                   /translation="MMIVDDEYYVKEGIKQTIDWAKYQIEIVGEAENGEDALNLAKILN
FT                   PDIIITDIRMPILDGVEFMKKLRENEINSHLIVISAYDHFEYARAAIKYGATNYILKPI
FT                   DNNELIETIQKVIKKIESERNFIDSYNSFKNNISALKLGLLREIVYGKVLDSQSIKETL
FT                   SYFKIDSNNIVVITIRISNYDKTALTTNEHLYMLKDYITNQMLNNVFARISNSGICLEK
FT                   DEDEFVIIIGLDGDTDTLYEQLKNELCYLMRKINRKFQNDNFTVAVGISDVHLWDNIFK
FT                   AYREATFASNYSPLPELNIIGCARDKDLIGIRKEVKDALKMIVENYNRDITIDEVANKL
FT                   HISTSHLIHLFKDELGKTFYDCLVEYRITKAKELLLSTNLKVYEIAEKVGYQDAKYFSQ
FT                   LFKKYTGYTPKEFVDYHTFAGELKDEY"
FT   gene            137553..138833
FT                   /locus_tag="Calkro_0095"
FT   CDS_pept        137553..138833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0095"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gym:GYMC10_2443 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45011"
FT                   /db_xref="GOA:E4SCF6"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45011.1"
FT                   /translation="MKNFKKILGLIVLVVFMVSIVGMYGNTGVDAKTTEKVKIRAVTYF
FT                   TGADPWTNTWKEAIKDFMAKNPNVEIVDEATPAANDAIRTKIKTDFASGNEPDVTFFFV
FT                   GADAEPLLKSGKVFIWDDELKKDTKWSSNIYKSALAFTTYNGPIKEYKGKVYAIPTIGF
FT                   YEGLYVNVDLFNKYNLPLPTDWDKFIKAVNTFKSKGIIPIAGSILESYYLIETFILSAG
FT                   GPQGHNTPFHPSWEKGLNIIKDLYKMGAFPKDALTLQDAQAQALFADKKAAMMINGSWC
FT                   VGGLKDKVNTKIMPVPVVPGGKAHPTDIIGGFGSGWYVSKDLNKKKNGWPVKFVKYITS
FT                   PEVEAKFIAVGGVPAIKCKVPNVTPVAQSGYDMMAKANSVSMPIDAQILPEAFTKIRTD
FT                   LAYVVTGKKTAKHLLAEAKKIQDSVKK"
FT   sig_peptide     137553..137648
FT                   /locus_tag="Calkro_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.742 at
FT                   residue 32"
FT   gene            138947..139819
FT                   /locus_tag="Calkro_0096"
FT   CDS_pept        138947..139819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0096"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_2444
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45012"
FT                   /db_xref="GOA:E4SCF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45012.1"
FT                   /translation="MQILKNKKYAIGLLLPALLLVSVFIYYPLFATFYYSFFDWRDFSN
FT                   YKTFVGLNNYVQMIQDYAVRKALVNTFIMMVCVIVFQVGIALVLALIVDSIKAGYKFFR
FT                   TVFFFPVVISGTAIGLMFYLAYAYDYGLLNAIMTAFGGQKKVWVTENSALIMVLIPVIW
FT                   QYVGFYFVIFLAALSKVPHDIYESALIDGITGIKKAIYITIPLIWDVITVCISLAIVGT
FT                   FKVFDIVYVITGGGPMDASQVLGTYLYKIAFTGQNQGYASAIGVLIIVLGIILSTISNK
FT                   LTERETITY"
FT   gene            139840..140685
FT                   /locus_tag="Calkro_0097"
FT   CDS_pept        139840..140685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0097"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_2445
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45013"
FT                   /db_xref="GOA:E4SCF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45013.1"
FT                   /translation="MSGMTKKFSFVDVIKYLILILWACTTVLPLLWVLNNSFKESNEIL
FT                   LNPMKLPSKLSFFNYSQLISYGNMNIFRGFLNSLIISGSVVLLVLLFGGFAAYVIARFD
FT                   FKLTGIVKIFFTGAMLVPAFSIVIPSLVILRKLGLNGSYLALILPQTAGLLPFATLTLA
FT                   GFMKTLPVELEEAAIIDGAGVLRIFFRIIVPLSIPGLVTAAIFVFLWSYNDLFMSLIFI
FT                   PIREKQPICVLLSLVSSVYGTNYGAMMAALIITVLPVIILYVFLQEYVIKGMTAGAVKG
FT                   "
FT   gene            140749..141786
FT                   /locus_tag="Calkro_0098"
FT   CDS_pept        140749..141786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0098"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="KEGG: dtu:Dtur_1620 glutamine--fructose-6-phosphate
FT                   transaminase (isomerizing); PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45014"
FT                   /db_xref="GOA:E4SCF9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCF9"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ADQ45014.1"
FT                   /translation="MHKMLKEIYEQPSVIKRCYEDNIEIIRLITKNIKDRNINNIIFVA
FT                   RGSSDNAATFGRYIIEILSGIPAGLAAPSVASLYKKNLQLEKTCVIGVSQSGQSEDICS
FT                   FLDMAKANGAMTIAITNNPRSKLSLIAEYKLNMNVGIEEAVAATKSFTAEVVLLELFAA
FT                   FLAEDDKLVFELSNIESIIEDALNQEGLIKENIERFRYMNECFILGRGVSFPIALEFAL
FT                   KIQETSYVRAKGFSTSDFRHGPLAMIDKNIPVFIVAPVDETIEDNIEIAERLTKEGIDI
FT                   VTFSDSKKLNEKACKYVDIRKDLNKFIKPLFAVPLVQLFSYYLCVLKGNDPDKPRHLSK
FT                   VTITK"
FT   gene            141874..142662
FT                   /locus_tag="Calkro_0099"
FT   CDS_pept        141874..142662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0099"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: cpy:Cphy_3861 two component AraC family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45015"
FT                   /db_xref="GOA:E4SCG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45015.1"
FT                   /translation="MKKVVIIDDEEIIREGLKTFVNWKKLNCEVVALAENGTEGLYIVE
FT                   KYKPDIIITDIRMFGLNGLEMIKEIKKKNKKSKIIIITAYRNIEYAQEAIKLGVFRLLF
FT                   KPAKTDEIEKAVQEAIEEMEYEKIADDKEALRQCVLQVIKTQKNEEEEKPLSFIASKIL
FT                   SYLLENYYKEISLQELAEEFYISHWHLSKLIKKELGLNYTDLINIIRVEQAKRLLAIPR
FT                   YRVNEIGSMVGYNDNTYFCRVFKKLTGMSPQEYRNKYFAN"
FT   gene            complement(142686..144455)
FT                   /locus_tag="Calkro_0100"
FT   CDS_pept        complement(142686..144455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0100"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: cce:Ccel_2114 putative sensor with HAMP
FT                   domain; PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45016"
FT                   /db_xref="GOA:E4SCG1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG1"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45016.1"
FT                   /translation="MKYIKSLFSLTSIKFKLLLALVLITCIPTLILGYIGYLKYTEVLK
FT                   NKFLKSQEVNIIQMSSIIDYYTQNIYKFTQEVLYDNSIYNFYKTLIDRNDDPELFNYIF
FT                   KKDFEGYLNSLLLSRNDINLIAFNFSENNSLFYVSRENERIDSSDVCVIYQKAKKTDGK
FT                   PIIYVKPINKLYSDVYIGRIVYDRNTLDEIGLLIVKMNLNKLYDSITTLKIKNYDAIAF
FT                   AYRDKLIYVNFLNSTNSTDLEDLIVNKHKFELTSNFKNNYYFVKSDVPISGWTCYMFFS
FT                   KKFLLNEINLVSKTLFFLFIITVLLSLLLINYIYLDITSPINQLIRYMKKVENGEMQIK
FT                   IESNRKDEFGYLISSFNRMTEKINHLINQVYKARLIAKDAQIKALQAQINPHFLFNTLD
FT                   VINWKAKFLGAEEISEMITALATLLEYSINREDSTLVSLQRELEYIDSYIFLVCKRNNH
FT                   LKNLNFIKDVKNNDLLNFKIPFMTLQPIIENCIKHAFDSNIKEPTILLEIEEYNNKLII
FT                   KVKDNGKGIEPEKLSYISSRLHKMPDFSEKDGCGIGLLNVHRRLRLLFGNQYRLLINST
FT                   VGSGTEIVLVIPK"
FT   gene            complement(144585..146000)
FT                   /locus_tag="Calkro_0101"
FT   CDS_pept        complement(144585..146000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0101"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; KEGG: vex:VEA_002577
FT                   GlcNAc phosphomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45017"
FT                   /db_xref="GOA:E4SCG2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG2"
FT                   /inference="protein motif:PFAM:PF02878"
FT                   /protein_id="ADQ45017.1"
FT                   /translation="MIKFGTGGWRAIIGDDFTKENIQKVAQAVSIYMKEKGIDSDGIVL
FT                   GYDRRFLSDKAARWFSEVLSANGIKVFFINKVAPTPLVMFTVKKLNTKFGATVTASHNP
FT                   ADYNGIKLFIEEGRDAPFEVTSEIETIANSLLSDSIKRLKFEKAIENGWIEIIDPFDDY
FT                   IDAILSMIDIEAIKKRKLRILLDPMYGVSRTSLQTILITARCDVDTIHERHDTLFGGRL
FT                   PSPTTSTLYRLKHLVVEKGYDLGIGTDGDADRVGIIDEIGNFIHPNDILVLLYYYFLKY
FT                   KGWKGPVVRNLATTHLLDRIASSFGEKCYEVPVGFKYISAKMEETGAIIGGESSGGLTI
FT                   KGHIKGKDGIFAATLLVELICKTGRKLSEILEEIHRIYGILYMVENDFSFEPEEKEKIW
FT                   EILFDKKHLPDFPFEISNVSYIDGVKVYFKNGGWVLARFSGTEPLLRIYSEMEEKVHAE
FT                   EVCKIFAEFLNLR"
FT   gene            complement(146043..148442)
FT                   /locus_tag="Calkro_0102"
FT   CDS_pept        complement(146043..148442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0102"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; carbohydrate binding;
FT                   glycosyltransferase 36 associated; KEGG: vfi:VF_2147
FT                   N,N'-diacetylchitobiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45018"
FT                   /db_xref="GOA:E4SCG3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037828"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG3"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADQ45018.1"
FT                   /translation="MKYGYFDNQNREYVIERPDIPVSWTNYLGVKDMCTVISHNAGGYS
FT                   FYKTPQYHRITRFRQNGVSLDRPGHYVYLRDDETGDYWSISWQPVGKSLNIAKYICRHG
FT                   LSYSKFICDYNNIHAEQWLFIPLDDAVEIWDVRVKNTGISRRKLSIFTYAEFSYHHIEI
FT                   DNQNLQMSLYASGSSYKDGIIEYDFFYIPDMYHFFASNFEPDSFDCVRDIFIGNYRTET
FT                   NPIAVEKGMCSNSEDLTGNHCASLHKRFVLEPGEEKRFIFMLGVGDRNKGREIKEKYSK
FT                   FENVDNSFYELKKYWDDKLSVFQCTTPHEGLNTIINIWNLYQAETCVVWSRFASFIEVG
FT                   GRTGLGYRDTAQDAMSIPHTNPQKCKQRIIELLKAQTSEGYGLHLFEPEWFEEEEMPKP
FT                   KFKSPTIVPKPKKDSIIHGIEDACSDDALWLIPTISEYIKETGEIEFLDMVIPFADKGQ
FT                   ASVYEHMKRIIDFTAKYVGPHGIAKGLRADWNDCLNLGDGESAMVSMLHYWALQSFIEI
FT                   ARYLRKKDDVEKYSALAENIKKVCNDVLWDGRWYLRGITANGLKIGSNECEEGKIYLES
FT                   NAWAVVSGVADYERGISAMDAVYEYLFSKYGLHLLHPPYSKPNDEIGFVTRVYKGIKEN
FT                   GAIFSHANTWAWVAECKLGRGSRAMELYNALLPYNQNDIIEIRESEPYSYCQFVYGKYH
FT                   KSFGKARHPWLTGTAGWAYHAVTHWILGIRPTFDGLVIDPCIPSNWDKFEMIRKFRGAT
FT                   YKITVLNPNRVEKGVKHITLNGKDLEENFVPVQPKGSINEVIVVMG"
FT   gene            148694..149662
FT                   /locus_tag="Calkro_0103"
FT   CDS_pept        148694..149662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0103"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csc:Csac_2540 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45019"
FT                   /db_xref="GOA:E4SCG4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADQ45019.1"
FT                   /translation="MVFRTLNESELEKWFYHCASVFGENQNLDFWLDYFKRHYFNDPFR
FT                   DINSIFVAADGSSIASTVRLFYRKIYFHGEEITVGGIGEVSTKHEYRGMGLASKLLCMA
FT                   VDTMRKKRLCISILFASLHNFYGKFGYKVLPREFCLVDRDTFQKYYESKTTQIGEIKEI
FT                   NLSDNNVEIIDEIYNLYSTNFNGPVVRNREYWLGWVKLEPKTSLGYFVEGRLAAYLFYR
FT                   KNGKEINILEYGCSDSSNKEIPLMEFIKFIINNENAEAIKYPKAIGLELTGCTEYKDNS
FT                   LMLNLITPFKLEGLLVDSTEKLISILTREPNKFLFWGTDNF"
FT   gene            149703..151337
FT                   /locus_tag="Calkro_0104"
FT   CDS_pept        149703..151337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0104"
FT                   /product="Glycoside hydrolase, family 20, catalytic core"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: csc:Csac_2539 glycoside hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45020"
FT                   /db_xref="GOA:E4SCG5"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG5"
FT                   /inference="protein motif:PFAM:PF00728"
FT                   /protein_id="ADQ45020.1"
FT                   /translation="MFKIVPKPKKLDFTGKWFEFNGFENIPDFISREFSIPKGSWKIEI
FT                   VERPGTGISIEDKKVKVWGNVNVAYATLVQLLIQRRDALPQVTVEEEFRFYFRGFHLDI
FT                   ARGGVPSFSTFKNILRWLFLLKYNYFAIYFEDLFPWEKHPKIGAGRGRLTKEELKEIIE
FT                   YGKNLGIEVFPSLELTGHMENILSIPEYSKYSEWYLPREGCLDLSSEEAKKFAYELLEE
FT                   VLEFFPSKYVHIGGDETWALGRGKSLEKNWAFEGPKLYEEHHKNMIDMVEKYRKIPIMW
FT                   ADMLTGMFLRPDERKVWEKLLQSDIWQRTILANWDYAAMPKEHFINRIESLGKNYQSNQ
FT                   IVCPGFSNWNRFYPDFEVAIENIKNFIEAAKTKGIQGFLVTSWGDDGQECLFSFLYPLF
FT                   VATIELAEGDGDWEKSFIILSGENEKLFDVRKVFGTSKIASNIKGLLYGSKEVVQMGTS
FT                   EKQGLKRCFEEALQKAIGANLPEDLAFIRQAIRVAIKRLENTVTAGDLIELGSYYCRLW
FT                   RKERKKEGLDRIVGRFWAAAGRDDLGL"
FT   gene            151373..152515
FT                   /locus_tag="Calkro_0105"
FT   CDS_pept        151373..152515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0105"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="KEGG: ate:Athe_0096 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45021"
FT                   /db_xref="GOA:E4SCG6"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG6"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADQ45021.1"
FT                   /translation="MRKKFLVKKIFNGYSFIRDNVLVVEDGIILGTQNGIDIGKDEIID
FT                   RRDFILSPGFVDKHTHGIGGVDFFDTTENDLKTIQNYYFKHGVTTILPTIVSAPFENIY
FT                   KLARAIKEAKKDPNFKLNIPGIFLEGPFINPAKKGAHDERFLQMPTVEKLEELISNCEE
FT                   KIIDIALAPELLDNPNKFISKAIEHKINISLGHTESSFEQAAKAHTLGAKNIVHLFNAM
FT                   PQLHHRQNSITTYALLNDIKVELICDLIHLSPEIIKLTYKLKGAENIILISDSIAATDL
FT                   SDGEYSLGSLRVKVENGICKLADGTIAGSTLTIDKAVKNLVKIGIRLEDALMAATYNPS
FT                   KLFSLECATIKEGFRADFVLMDEDLNVKEVYVGGELVYKA"
FT   gene            complement(152522..154111)
FT                   /locus_tag="Calkro_0106"
FT   CDS_pept        complement(152522..154111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0106"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: csc:Csac_2518 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45022"
FT                   /db_xref="GOA:E4SCG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45022.1"
FT                   /translation="MIKLFIADDEPEVIEGISTLVDWRGNGIEIIGFATNGEEALEKIR
FT                   ELCPDIVLIDIKMPKLDGLQVIENAKKEGYIFESVILSGYDDFYFAQKALELRSLNYLL
FT                   KPCRPKEVLDAVLKAKNVLEKEREKETLINRFIEYYNETLPILKERILNEVIFGIRSKE
FT                   EIEKLFERYNIKLSSGKYCIALAKFDIENVSNTYPTSFVKQEAYTLACVNLIQEELEDF
FT                   RAEVFRGRNEIVILINSDFEFDREMMDDILTKVKKIVDKKLGLKLYFGVSRWIDKIEKI
FT                   NFCYEQALNALELKFFADDIDILYYDDICLNKNTLLYPIDEEKAIINSLLLCQKDTIKE
FT                   KVENFINSLYAINTFNKWFIKSAVLALLGSIIKVCHEKCIDLNDVVNSKVFENILKTEK
FT                   KELLKASLLSFLNATADKIEQSENKNLIVKAAINFIEKNYNKNITLESVAKEVYVTPAY
FT                   LSILFKRELKINFVDYLHKIRIQKAQELLKNPSLKTYQVANMVGFSDEKYFSQVFKKYT
FT                   GLTPSQFRESLF"
FT   gene            complement(154111..155910)
FT                   /locus_tag="Calkro_0107"
FT   CDS_pept        complement(154111..155910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0107"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_2517 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase
FT                   internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45023"
FT                   /db_xref="GOA:E4SCG8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG8"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45023.1"
FT                   /translation="MLLKLKKHFLRLSIKYKILILFYSIIVITSLVLALFSYTISTNQL
FT                   KEEVGNLLLRDTKRIASSIDFLQRDVNELSSFLFLDQRVQNFINPRPDFTKYSLEPLAS
FT                   LLASKDYISFIMLYSFQGDKYYFSNDNSTGVADFFEIKQTDFFKQVVKNRGAPMWLSLN
FT                   SLPFTLISKNNYPKIAMARLLLDYNTYEPAGLLIICINIPTIEKIYLEDLKEKEACFFI
FT                   VDSNNRIISLESTTPQFTATFAQKLLNENILSRENEIITANSSKLLITSSYISTSNWRF
FT                   VSIVSLENAINSIRNSFVLLYIRVLIMCLIFAFVISMYFSSMLTAPLQKLVNSMKKVRQ
FT                   GNLREQVKIDQYASDEIAIVVSEYNNMVEKINELINKVLKLEIHKKEAELKALEAQINP
FT                   HFLYNTLDTIFWKAEKSHDSEISEMIYSLSRLFRLTLNRGSEFIQVKGEKELIEHYLFL
FT                   QSKRYKNRLKYSVEIDVEIEDYYIPKLILQPFVENAIVHGMENSTSQTYIEITGKKDKD
FT                   KLCFSIKDNGTGMSKEQLDKVKELLESGKENNFGYAIKNVNERLKLYYENRYNLSIQSQ
FT                   SGQGTEVILTLPIEDIEFEGVKR"
FT   gene            156239..157561
FT                   /locus_tag="Calkro_0108"
FT   CDS_pept        156239..157561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0108"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2516 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45024"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCG9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45024.1"
FT                   /translation="MSKRTLKVFISVLLVTVMIVSLLAGFQGTFTASASTKKTVEIKFF
FT                   SNLPDRTSNQGKLEQMLIDSYMKANPNVKIKVEALQDEPYKQKFKVYVATNQMPDIFMV
FT                   WGQPSFFLPVMKGGYAAEIKPEQIKNYGFKTSSLKDFMYNGKIYGLPRNTDFMVLYYNK
FT                   GLFSKYNVKVPTTFSELLDAAKVFRKNGIAPIAINGKDKWILAILYQELVVKESGDQKL
FT                   IYDAISKKSVSKNQILLKAAKDLVELVNVGGFQDAFVAADYGAANNLFAQEKAAMYYMG
FT                   SWEVGMAANPNFSDSFKKNVDATYFPIISGGKGKKTDILAWHGGGYAVSANSKVKNEAM
FT                   KLLLYMMHPTRWAKIGWQQGLVVPGQNWEKFMTGKETVLQKKLTQIFSSATSVSGTVWQ
FT                   DAFTPNFKTEAETLCQMLVAKAITPEKFLSKIEELAKLEVK"
FT   sig_peptide     156239..156343
FT                   /locus_tag="Calkro_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.949 at
FT                   residue 35"
FT   gene            157644..158531
FT                   /locus_tag="Calkro_0109"
FT   CDS_pept        157644..158531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0109"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2515
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45025"
FT                   /db_xref="GOA:E4SCH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCH0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45025.1"
FT                   /translation="MQKVLSDKKTILLLVLPGLLIYTFAILFPIILSIYLGMTDWSGIG
FT                   KPNFIGLENFKKIIFSDTTFWKSLRNAIFLALAYVFVQHPIALIFAIMIDKIGGKPEKV
FT                   FRTIFFIPCVIPVVVTSRMWVSLYDPQYGLINKILDFLHLGFLKQQWLGDMKTALISVI
FT                   IICMWQGFGWALLIYYAGLKGIPEELYEAARIDGATGFKLYTKITVPLLKPVIKVNFTI
FT                   AIIYALKQMETVYLTTNGGPGDASQFLANYLYIRAFNSYQYGYANAISVLFVIACLAVN
FT                   IFFQKIFKSENYEF"
FT   gene            158553..159395
FT                   /locus_tag="Calkro_0110"
FT   CDS_pept        158553..159395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0110"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_2514
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45026"
FT                   /db_xref="GOA:E4SCH1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCH1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45026.1"
FT                   /translation="MSKQSSIAKRDKTILLILLGVFSIGQLFPLVWLVDFSLCKSGDVY
FT                   GANILKIPSPPQYINYIVAWRDGKIPQYFINSVIVNFVSVFLVVLFSLMMGYAFVRMNW
FT                   KWSNRVLTYVLLGLMIPIHATLLPNFVIFRQLNILDSYFALIIPYVAFSLPQAVFLMTG
FT                   FIGSIPRALEESAIIDGCGIFRILFQIILPLSKPALVTVTVTTFLNTWNEFIMAATYLT
FT                   SDRFRTLPFSVYNFAGQYASNYAVQFAVMTIVALPSLIVYIALNEQVTKGVTLGAVKG"
FT   gene            159478..166785
FT                   /locus_tag="Calkro_0111"
FT   CDS_pept        159478..166785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0111"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="KEGG: cpy:Cphy_1775 S-layer domain-containing
FT                   protein; PFAM: glycoside hydrolase family 16; S-layer
FT                   domain-containing protein; Fibronectin type III domain
FT                   protein; coagulation factor 5/8 type domain protein; SMART:
FT                   Fibronectin type III domain protein; coagulation factor 5/8
FT                   type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45027"
FT                   /db_xref="GOA:E4SCH2"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCH2"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADQ45027.1"
FT                   /translation="MKRGGAKFLSVLLVVLVLLQWTIPLRGIAHGQNDLSGHWAENELK
FT                   KWAEKGILKGYPDGTIRPNATITRAEFVALIDRICNYVEKSPNVFKDVEPQKWYADVIS
FT                   KAIAAEIIKGDDRGRFRPNDPISRQEAGVIFAKVFNLESANKNVLNKFSDSAEIAEWSK
FT                   DALSAMVEKGYLIGRKNNRIAPNDYLTRAECVKIIGRIVGELINKAGTYTEKIKGNAVV
FT                   NTKDVTLNNMSIEGDLYLTEGIGDGDVVLNNVNVKGRAIIKGGGENTITIKDSVIQGSL
FT                   LIKKANGRIRVVINGSTQIGGTVQLLSGSTLEEDNVTTKGFDKVVVLESVIPGQEVTLK
FT                   GDFSEVEVKASNVKINIQNGTIALLKINEATKGVSVQLSKDAVINTLNAHKDVSVEGNG
FT                   TIRSSNIEIKGVSSKTSKETSSQTGRISTGGNETGTLTAGETTSSQGTSTQTGGTTGGS
FT                   VASFPSTGGTSSSGNVRTAPTTPTNLTVTVSAYNIVDLSWGVVEGATGYNLYRAESVNG
FT                   QYVKINTSVITTPCYKDTTVAPNKTYYYKVSAINANGESALSNAVNVTTATVPSVGEWK
FT                   LVWNDEFNGTPGSGLDTSKWVYETGGSGFGNNELQYCTDRTENVYIEQDPNNPSNRFLV
FT                   IKAIKENYGGKEYTSGRIKTEGKFDFTYGKVEIRAKLPYGGKGIGASFWMLGSNYNTAG
FT                   WPNCGEIDVMEWNGNTPTKIYGTIHGPGYSGGDGIGTWHEYPGGFSNEFHTYAIEWEPN
FT                   VIRWYFDGQLYQERRVEDLFGKTWVFVHDFFMILGLGVGGTWVGNPDGTTVFPQKYVID
FT                   YVRVYQREGNVYPNPPSRKLVQIKNVENGQFVCADKFNGDYLYANRSSAALWETFEQKD
FT                   LGNGNIALIALSNYKYVSADNANNQLVASKETIGATETFKVVVNGDGTKSLLCLSNNKY
FT                   VSVGSSYILEATASTVGNSEKFIIYSTPTTPRGLTATSVRNYSVTLSWTAVEGAAGYNI
FT                   YRSAKSGGPYSKVNTVAVTSTTYTDATLSPGNTYYYRITAVNALGESEMSEEIFVTTPT
FT                   ELTAPSAPTGLYMVSSTENSITISWTQVAGATGYNVYRAAERNGTYTKVNESPIENVSY
FT                   TDTGLSTGAAYFYKVTAVNAAGESDMSDVLFATTSGYGVSGGRSYSYIIAVSNSKFVRV
FT                   DPSNAWNPLTASASDASTDAELFEIVFKADGNVGFASKALNNNLVCADSWSTPDYKLLP
FT                   RSSYSADPGGWETFTLVPQGDGTIAIKANNGGRFVTVEPTTGILKATSATVGVNEKFII
FT                   VTPYAPGQPSVTIDEVLDNSVTFHWSVPSSSVVAGYNVYRATTSGGPYIKLNKALLTTT
FT                   SYTDTSMTANTTYYYIVAAVNARGETKSPEVMVKTLSGPIPAIPTGLDITSCTQNSITL
FT                   NWNAAAGAQSYNIYRSTSRFGTYVKINTEPITSTTYTDTNLTTTSYYYKVTAVNENGET
FT                   KMSEPISLEKKLFGPNVYIFDPNDAPADVQAVCTSIFKQQEAAQFGNGRYALLFKPGTY
FT                   STDVKVGFYTEVLGLGRLPTDTTIHSLTVDAAWMPNNNATCNFWRGAANLTVATDTKWA
FT                   VSQAVSLRRVKINGKLTLHDAGGWASGGFLADSYITGVVESGSQQQWFSRNTYWQAWDG
FT                   QVWNMVFVGVNNPPPGTWPETKYTTVERTPVMREKPFIYIDENGHYNIFVPAVRSDTVG
FT                   ISWNNDMGPGTSIPIEEFYIAHPDKDTADTINAALAQGKHLLLTPGIYNLDKPIEVNNP
FT                   NTVVLGIGLATLRAVNGCILLKVADVDGVIIAGILFDAGEKTSPVLLMVGQENSSANHS
FT                   NKPITLSDLYFRVGGAGVGRADVCVVVNSSNVIGDHFWVWRADHGDGVAWDLNTTKNGM
FT                   IVNGNDVTMYALFVEHFHEYHVVWNGSGGRTYFYQCELPYDVPKQESWMSHNGTVKGYA
FT                   SYKVADTVTSHEAWGLGIYSYFRDAQVECNSAIEVPNNSGVKIHNACTVKLAGYGGIKH
FT                   VVNNTGEPVNVAGQRSIVTEYCNNVDQPEISPSTGVYSSEQMVTITCSTADATIRYTLD
FT                   GTEPTETNGITYSGPFTVSFGTIVIKARAFKEGMNPSYVTTATITVTDSLSFGKPATAS
FT                   STRSGSGNTPDKAFDGDLKTRWESEQRDPQWIMVDLGQSYSITGVKIVWETAAAKEYKI
FT                   QVSSDNINWTDVYTVTDGQPGHTLDISFPSVVGRYVRMYGISRATSWGYSIYEFEVYGN
FT                   KVATPVITPASGTYVGSQIVTITCDTEGATIRYTIDGSNPTPSYGIIYEGPFTITTTTT
FT                   IKAIAYKEGMYTSNMRTETIIITNNLALKKQATASTGNASLAFDGNMNTRWESEWNDPQ
FT                   WIAVDLGAVYNITGIKLVWETAAGKDYKIQVSLDGQTWTDVFERLGWTGGTDEITLDTP
FT                   AQGRYVRMYGTARTTGYGYSLWEFEVYGSK"
FT   gene            166871..167095
FT                   /locus_tag="Calkro_0112"
FT   CDS_pept        166871..167095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0112"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="manually curated; PFAM: regulatory protein LuxR;
FT                   KEGG: ate:Athe_2627 two component transcriptional
FT                   regulator, LuxR family; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45028"
FT                   /db_xref="GOA:E4SCH3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCH3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADQ45028.1"
FT                   /translation="MGISAVNNSELTKREKEIIKLIAKGYSNKEISSFLNISEGTVKTY
FT                   IKIIMLKLNARSRVEIAAYYFQNIDKFKE"
FT   gene            167374..171096
FT                   /locus_tag="Calkro_0113"
FT   CDS_pept        167374..171096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0113"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="KEGG: cbe:Cbei_2675 coagulation factor 5/8 type
FT                   domain-containing protein; PFAM: coagulation factor 5/8
FT                   type domain protein; Fibronectin type III domain protein;
FT                   SMART: Fibronectin type III domain protein; coagulation
FT                   factor 5/8 type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45029"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCH4"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ADQ45029.1"
FT                   /translation="MKKFKKVIALFLCIAFIEGFFFSSPVISKAETNLALNKAVTASST
FT                   QAGLDVKSAVDGNVNTRWGSDWSDPQWISVDLGSVYSVNKVVLRWETAYGKSYKIQVST
FT                   DGMNWTDVYSTTAGDGGVDEIVFSPVNARYVRMYGTERGTGWGYSLWEFEVYGGAAVQD
FT                   TTCGGNLALNKAVTASSTQAGLDVKSAVDGNVNTRWGSNWSDPQWISVDLGSVYSVNKV
FT                   VLRWETAYGKSYKIQVSTDGMNWTDVYSTTTGDGGVDEIVFSPVNARYVRMYGTERGTG
FT                   WGYSLWEFEVYDSEEVEKVATPVITPGTGTYTSAQTVSITCATAGATIRYTTDGTEPTP
FT                   ANGIVYSGPFTVTATTTIKAIAYKDGMLNSDVATAVITINSTILSAPTGLKVSSVTTTS
FT                   ISLEWSPVPGVSGYNIYRSFVPEGPYVKVNSSPITSTNYTDSGLDSATYYYKVSAVNAS
FT                   GESNLSEAVSAKTVLYFGPHVKIFDPSMSSAEIQSICDTIFAEMEKNQFGTQRYALFFK
FT                   PGSYSVNLSVGFYTSVHGLGKRPDDVTITGSVRCEADWMDGNATCNFWRSVENLTVIPT
FT                   YRANNLVSAGTETWAASQAAPLRRVHIKGGLSLWDPGSNYDKSWSSGGFIADSVIDGQI
FT                   TSGSQQQYFTRNTQMGSWSGSNWNMVFVGDIGAPAEQWPNPAYTVVNQAPVIREKPFIY
FT                   IDDSGNYAVFVPAVRTNAQGISWANGMGEGTSLSMDQFVVAHPETSTAATLNQALSQGK
FT                   NILFTPGIYHLSEPLRVSKPNTVILGLGLATLVPDNGTPAMTVADVDGVIIAGILFDAG
FT                   PNNSPVLLEVGPEGSTQSHASNPITLSDLFFRVGGAGVGKADVCIKINSNDVIGDHFWV
FT                   WRADHGDGVGWTINTTKNGIIVNGNNVIIYGLFVEHFHEYQTLWNGENGRVYFYQSEIP
FT                   YDVPNQESWMDGSENGYASYRVADSVNSHQAWGLGVYSYFRDADVKCNSAIKVPAKPGV
FT                   RIYHACSVYLAGYGEITHVVNHTGDTAKAGYMRQTIDEYCNNVEQPDIMPKSAVYGTPQ
FT                   TVTISTVTPGATIRYTTDGSEPTPTTGMIYTGPFSVSSTTTIKAIAYKEGMNNSRIATT
FT                   TIKIDPAYANDIALNKPATASSGNASLAFDGDTTTRWESAWSDPQWIMVDLEAVYSITG
FT                   VKLVWETAAARDYKIQVSLDKVTWMDAFVRTNGTGGTENITFNSPVQGRYVRMYGIART
FT                   TNYGYSLWEFEVYGN"
FT   gene            171241..176160
FT                   /locus_tag="Calkro_0114"
FT   CDS_pept        171241..176160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0114"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="KEGG: pjd:Pjdr2_5486 coagulation factor 5/8 type
FT                   domain protein; PFAM: coagulation factor 5/8 type domain
FT                   protein; glycoside hydrolase family 81; Carbohydrate
FT                   binding family 6; SMART: cellulose binding type IV;
FT                   coagulation factor 5/8 type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45030"
FT                   /db_xref="GOA:E4SCP7"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCP7"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ADQ45030.1"
FT                   /translation="MSKSRVAKYSKRFLIFIYIICLINLVLPLNYLRANAETSYLISVN
FT                   RPCYASSVNGSDTPERATDGDLGTYWQAAWNIDNQWIDVDIGKTAQINKIVFKWQSELS
FT                   YAKRYKIQVSDDEINWQTVYVNENGTGGVQVTGQNGMVYYEEEITISATGRYVRMFAEK
FT                   SASGYGVALREFEVYGYGGVVSPPTQAVNLALGKSCSASSTATPWWAQPGQLDPNKAVD
FT                   GDKSTYWQSKEGNDQWFQVDLGNIYTIGKVNIIWGEGEFGRIYDIQVSTDGINWETVYR
FT                   QIYGNGDPESIPVYAVCRYVRMKGIAMGRGGGYSIKEFEVYQYVPGDPQIRHQIPSLPS
FT                   KQIVSVGKGSYLIDDVNCAQPRYPKYVTKNIKTPIPSNDWWTSVIYKRLSDGMPALPLV
FT                   YWYFDNGLGFYYASDLFTAPNNGGMDTKCRNMDLFVNTSSIIGTPSAKLDGYGDWSVTV
FT                   VFSDDDTPKMRSTLVKGSPYVYNTFTDPNSVEVWSPSLVCIFDENGNPILTNDGDSITT
FT                   DHIGVEVTNVNTAPEPKTLVRSYGIFAPPGTVFTRVGSKIKIKLGSGENYLVIGLLPER
FT                   KNLNYLYQHAYAFVIDTTVSYRFDQSTSTVYTTFTDKVVLKRQGFSSQTLMALFPTQWK
FT                   YTNASFAPVTYNSARGLMKVIEGNSFTTQLKFYGITPSFGEPIESNTYSREKMKEYLNA
FT                   FKESVSRDYWVADPYWQGKKTHPLAMGILIAEQIGDYETRDLFISILRKILINWLTYDG
FT                   NDDYPYYTYYSSSWGTLNGDGGDHGMAINLSDHHFLWGYFIFPAAVLASYDKNFVRDYG
FT                   GMIEHMIRDCMNPSKTDSMYPYMRNFDPYESHSWAGGYGDNQSGNNQESTSEATFAWAG
FT                   LYLWGLVTGNDTYRDAGIWGFTSEVNAIEQYWFNYDQDNWAEDYASGAVGILWGTAYTN
FT                   GTYFSANPCCIYGIHWLPVTPVLTYLGYKPEIAARIYSMFRNDLEKYVANNPNDPEGWF
FT                   HITWAYQSLFDPEGVMNKWDDSKLPDDERFNTYWFVQNMSAKGYRSTEIWSNNWTCYQV
FT                   FKKDGKYSAVVWNPLDSVQYVEFCNKDGVVGSVYVPPHVTVVVNPLVHNGMAQVTIPPA
FT                   PAPDPAPHAVPGLIEAEDYYTNFSCSKVPCSEGGYAIGYIDNGDKLVYEVNVEEEGDYT
FT                   VQYRIINRSSNPGVIFLKSDLAIDQILAMTEVPISNDWTTIASDVHLKAGTQKIILYFN
FT                   KGGFDLNWIKFTKKALSQNLALNKAVTASSTQAGLDVKSAVDGNVNTRWGSDWSDPQWI
FT                   SVDLGSVYSVSKVVLRWETAYGKSYKIQVSTDGMNWTDVYSTTAGDGGVDEIVFSPVNA
FT                   RYVRMYGTERGTGWGYSLWEFEVYGGAAVQDTTGGGNLALNKAVTASSTQAGLDVKSAV
FT                   DGNVNTRWGSDWSDPQWISVDLGSVYSVSKVVLRWETAYGKSYKIQVSTDGMNWTDVYS
FT                   TTAGDGGVDEIVFSPVNARYVRMYGTERGTGWGYSLWEFEVYGGAAVQDTTSGGNLALN
FT                   KAVTASSTQAGLDVKSAVDGNVNTRWGSDWSDPQWISVDLGSVYSVSKVVLRWETAYGK
FT                   SYKIQVSTDGMNWTDVYSTTAGDGGVDEIVFSPVNARYVRMYGTERGTGWGYSLWEFEV
FT                   Y"
FT   gene            176454..177794
FT                   /locus_tag="Calkro_0115"
FT   CDS_pept        176454..177794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0115"
FT                   /product="Glucosylceramidase"
FT                   /EC_number="3.2.1.45"
FT                   /note="KEGG: ate:Athe_0097 glucosylceramidase; PFAM:
FT                   glycoside hydrolase family 30"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45031"
FT                   /db_xref="GOA:E4SCP8"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCP8"
FT                   /inference="protein motif:PRIAM:3.2.1.45"
FT                   /protein_id="ADQ45031.1"
FT                   /translation="MFKKITCYITAKDCSIPLQQVDNIKECEKIEKESVITIEPSTTFQ
FT                   EVLGFGGALTEAAAVNILSLLPHQQEEILRGYFDPKEGLGYKLCRIHMNSCDFCVDSYS
FT                   CDDVEGDTDLKHFNIERDKKMVIPLLKRIKEYCQDLKILVSPWSPPAWMKTNGDMCHGG
FT                   KLKDEYKKTWAKFFCKFIKAYKEEGIEIWAVTVQNEPMATQVWESCIYTAEEERDFVKD
FT                   YLGPTLEEEGLSHIKILIWDHNKDIIYDRVKTILSDKEAAKYVWGVAFHWYGGDHFDQL
FT                   KKIKEEFPDVNLVFTEGCQEGGVKLGSWELGERYAHEIIGDFNSYTIGFMDWNIVLDTM
FT                   GGPNHVGNFCDAPIIVDKDQKKIHYQNAYYYIGHFSKFIRPGAKVVKSSCSSSKLEVLA
FT                   AKNQDDTLAVVVFNKNPEEIEFSMVIGEKIFCGKSPARSILTIVLEK"
FT   gene            complement(177831..180200)
FT                   /locus_tag="Calkro_0116"
FT   CDS_pept        complement(177831..180200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0116"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: ate:Athe_2329 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45032"
FT                   /db_xref="GOA:E4SCP9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCP9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADQ45032.1"
FT                   /translation="MLKFLKNRDFLVKLLLSYFLVFFIPFVAGLYAYYNGYSISLNNLK
FT                   SYSKAIMTNLPSKINDVTLRPLELIEESINASPFYLTLISNHNLLASKNDIILDIRNFT
FT                   QQLMLYYTSPFILEIGIYIPFENIIITPNFFESSKLYYDYIIRPIDTDYLDWLNLLNKS
FT                   YNRYFMPMSFLIRGQPRSTILFLHSLPYWTFQDKKATLFILLDEEKLNDFIKSNVLYEN
FT                   SNIYVLNSDNTTLTQYVPDKNIDSLLKDTIKNSFTENSLTEMKTKKDKIILYYKSDMYQ
FT                   WKYIIAISSQSFFKPINNMKIYLLLYFIFSLILGLPTIVLLSLKSYRPVDEIKNILVSK
FT                   FKKQKLSYPYSEGIENIEDKSEMIKLKELASLLVAEEEFLRKQINEFLPTLQNWFLEHL
FT                   LVGNIPSAISEKEVFEKYQIKFDSDLFMVILVEIYDCQNFELQKDITDYSFVRFIIFNI
FT                   LNEVLTSQNNKVYNVILGEKKLGIILNIVDHNDTVDSIVGRLEYGKNFIQSNFAILLTI
FT                   GVSTIKKGISAINTCFEEAEKALSLKFISGNVKIYKFSDALSQLKDETLSFITPEMENR
FT                   ILECILNGNKASLEEIFKNIHSKIFVSDNIPIIQAKLLCVNLYILYENACRLINYKSSS
FT                   ELFKIIENEIITKTNTLTLDDLFFKIQDNFISLAEFVKNNQLSFRFTLVEKVKTYIDEM
FT                   YNDPNLSLSLIAEKFNITPQYLSSLFKEKTGQNLSDYITHLRIEKAKLLLTQTNYSVNE
FT                   IALKVGYIYPNSFINVFKKKVGLSPTKYRTLYSSQN"
FT   gene            180456..182036
FT                   /locus_tag="Calkro_0117"
FT   CDS_pept        180456..182036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0117"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_0358 ABC-type sugar transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45033"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ0"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45033.1"
FT                   /translation="MFARRMSKVIIWLVVIAFLSSMFIFYNVASAQSSKPVLTIFTWMD
FT                   PKAAPVLKNYREMAVYQTIMKKFKVDLQFIHPAMGSENEQFNIMVASRQLPDIIDWHWF
FT                   AYPGGPQKAIMDNVIIKLNPYMQYAPNLKKYFDTHPDIKKMATTDDGTIYMFPFIREDK
FT                   INCTFYGPMIRKDWLEKLNLTVPETVDEWYKMLLAIKKNASKLNSKMPVYPFSADYWSA
FT                   NPRGVFDYCSFLVGAWGIKTDFYVDKNRVKFGPLQPEFKQFMSVLQKWWKDGLIDPDLL
FT                   TMNRQAIQAKIMNDQIGAWLGLLGGTMGKFLQAKKGTEFDLVGAPYPTLKKGQVAELGQ
FT                   RDFPINGDGMAITPKCKNVQLAVKILDWGYSKEGYLAYNFGVEGRSYVMKNGIPTYTEA
FT                   ILNHSKLSAMEAIAQYGRVSWSGPFVQSKYYVNQMVAMLPQQKDALKEWTKPDNSKLLP
FT                   PITFTPDEAAKISNIMNTVNTYYNEMFVKLLTGKSNDMNGFVNTLKRMRIDEALKIYQT
FT                   AYERFMKKK"
FT   sig_peptide     180456..180551
FT                   /locus_tag="Calkro_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.842 at
FT                   residue 32"
FT   gene            182185..183132
FT                   /locus_tag="Calkro_0118"
FT   CDS_pept        182185..183132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2331
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45034"
FT                   /db_xref="GOA:E4SCQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45034.1"
FT                   /translation="MARQINSKKQGQSELLRDLKRNKNLYLMLLPIVAYYFIFHYIPMY
FT                   GVQIAFKDFTPAKGILGSPWVGLEKFREFFVYDSYYVWRIIRNTILLNVYDIIFGFPAP
FT                   IIFALLLNEIKNSVYKRTLQTISYMPHFISTVVIVGIILDFFSRDGLINQILKSLGILS
FT                   EPISFMTEPGWFRPIYVGSGIWQQLGWNSIIYLAAISNIDPQLYEAALIDGAGRFKQAI
FT                   YVTLPGILPTIVILFILRMGSIMNVGFEKVYLMYNPLTYETADVISTYVYRKGLLEMDY
FT                   SYGAAVGLFNSLINFMFVVMANQLSKKFTETSLW"
FT   gene            183148..184035
FT                   /locus_tag="Calkro_0119"
FT   CDS_pept        183148..184035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0119"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2332
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45035"
FT                   /db_xref="GOA:E4SCQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45035.1"
FT                   /translation="MVKIKKGVSEIIFDIFNYIFLGLLCFTFLYPMLYVLFASFSNPIK
FT                   LMAYRGPLLKPLDFSVEAYKLLLSYPMIWIGYRNTIIYVVLGTAINILLTTMGGYVLSR
FT                   RNLKLKNPIMFFIAFTMYFSGGMIPTYLLVQSLGMIDTIWAMIIPGAISTTNLIIMRTG
FT                   FHSVPDSLEESARIDGAGDWTILFRIMIPLAMPMIAVMILFYAVGHWNAFFNAIIYLRS
FT                   RDLYPLQLVLREILIMNSTENMTTGISDASDRFAITELIKYAAIIVATVPILCIYPFLQ
FT                   KYFVKGVMIGAIKE"
FT   gene            184085..185863
FT                   /locus_tag="Calkro_0120"
FT   CDS_pept        184085..185863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0120"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="KEGG: ate:Athe_2086 beta-glucuronidase; PFAM:
FT                   glycoside hydrolase family 2 TIM barrel; glycoside
FT                   hydrolase family 2 sugar binding; glycoside hydrolase
FT                   family 2 immunoglobulin domain protein beta-sandwich"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45036"
FT                   /db_xref="GOA:E4SCQ3"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ3"
FT                   /inference="protein motif:PRIAM:3.2.1.31"
FT                   /protein_id="ADQ45036.1"
FT                   /translation="MLYPRETKSREIKDLSGIWKFKLDKENKGYEEKWYLEPLKETIPM
FT                   PVPASYNDITQDPEIRDHIGDVWYERNFWVSSAWVNKRIVLRVGSATHKAKVFVNGKEV
FT                   IEHKGGFLPFEVEISKYINFDVENRVTILVNNVLDWTCLPPGFIKNYNDPFHPSGYRTQ
FT                   EYLFDFLNYAGIHRPVILYTTPKTYISDITVITEIQDKKGIINYEVKVEGQECDKKEVR
FT                   VTVVDKEGKKVAENIGKSGILEISDAQFWEPDNPYLYALKVETIEDGVVEDLYTLPVGI
FT                   RTVKVEGNKLLLNNKPIYLKGFGKHEDADIRGKGYDPVIAVKDFNLLKWIGANSFRTSH
FT                   YPYAEEILNLADEQGILIIDEAPAVGMNFFNKNEKVFCKDRVNEETLKHHIQVIRELIT
FT                   RDKNHPCVIMWSVANEAATYEEEAYEYFKKVVDEVKKLDSTRPVTIVESSFPDETKVGN
FT                   LVDVICVNRYYSWYTDCGKLDLIEFQLEKELKRWYELFKKPIIVSEYGADTIAGFHSDP
FT                   PVMFSEEYQCEMLERFHRVFDRLDFVVGEHIWNFADFATKQAVHRVMGNRKGVFTRQRQ
FT                   PKAAAFLLKKRWCEKK"
FT   gene            185981..192670
FT                   /locus_tag="Calkro_0121"
FT   CDS_pept        185981..192670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0121"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="KEGG: cpy:Cphy_1775 S-layer domain-containing
FT                   protein; PFAM: glycoside hydrolase family 16; S-layer
FT                   domain-containing protein; Fibronectin type III domain
FT                   protein; coagulation factor 5/8 type domain protein; SMART:
FT                   Fibronectin type III domain protein; coagulation factor 5/8
FT                   type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45037"
FT                   /db_xref="GOA:E4SCQ4"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ4"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADQ45037.1"
FT                   /translation="MNFSRFISLVLVFALILSFFAPASAQTNTRNDISGHWAAGELTKW
FT                   ISKGILQGYPDGTIRPDKSITRAEFVMLLDRIFKFVDKANLSFADVSTNSWYADAVAKA
FT                   TAVGAIIGDTNGKFRPNDPISRTEAAVILSRIFNLEATNESVLDKFSDSDKIPSWGKEA
FT                   LSAMIEKGYMKGRSGNVIAPNSPLTRAEFVKLIDKIVGELVTTEGTRTGNVAGNLVVNT
FT                   KNVTLKNMVIDGDLYLTQGVAEGAVQLENVVVKGRTIIKGGGEIVIDNSSIADKLFVEK
FT                   MKGNKRIIASGSTEIKSVELGCAATLQEDKISGKGIQTVRVLPTVSSMQEINLHGDFEL
FT                   ISLEAANAKVNITKGLIKTFEVKSTATNSSIQVGNEAKIEKLTVNAKVEVKGQGVIQNA
FT                   KINVSGVTMERKPANVETAPGVTLNVVSKEEADKKTSGNTGESISQGPAIITLPVTTPV
FT                   LTSPQAPTGLNIKSISTNSIELNWLPVNGASYYNVYRAFSSAGPYKKINTTAIQSTTYT
FT                   DTNLIAGTAYYYKVSAVNEYGESKLSEAVVATTQTAPEGWKLVWSDEFNATPAPGVDEN
FT                   KWTYEIGGGGWGNNELQYYTNSIKNVYIEQDPDNPNNGFLVIKAIKEDYKGYHYTSGRI
FT                   KTAGKFEFTYGRVEMRAKLPYGQGIWPAFWMLGSNINTVGWPNCGEIDIMEFVGKTPTR
FT                   IYGTIHGPGYSGDNSIGAWHEYPKGFTDDFHTYAIEWEPNVIRWYFDGELYQVRTVSDL
FT                   VGKTWVFDHDFYIILNLAIGGNWPGSPDASTVFPQKFVIDYVRVFQRESGEYPAAQYRN
FT                   LIQIKSIGNGKFVCADKYNGDYLYANRSSAGRWEMFELKDLGNGKVALISLLNYKYVSV
FT                   YGENNSLIPNKESVGLSETFHVVDNGDGTKSLKSMINGKYVTIASNSLLTATAETIGEN
FT                   EKFTFIDCSPPSSPAEVNATSTSNYSVSLSWSPVERATGYNIYRSENSSGPYTKVNATA
FT                   ITSTTYTDSDVDAGKTYYYKVSAVNEYGESALSQAVSATTPVMTTVPAPPTGLMMVSST
FT                   EDSIELSWMPVKGALYYNIYRSATSNGPFEKINQEGIQNTSYKDTNLNPGSVYYYKVSA
FT                   VNSIGESELSEALFATTTGYGIVTSGTTTKYYSYIIALANSKIVHADSTSTPLTASANE
FT                   ATTDSELFEIIFKSDGGVGFASKSLNKLVCADTLNNNNYKLIPRTNYSTTPGGWETFFI
FT                   EPQGDGTVAIKANNGGKYVTVDPVTGILAATSSTVGKNEKFIIVTPQAAGAPGNLTITK
FT                   TLYNSVSLSWTAPLASVITGYNVYRSTTSGGPYTKVNDTLLTSHSYTDTKVSAGTTYYY
FT                   VVAAVNARGEAYSNEVTTTTLNGPLAAVPTGLDIVSSTANSITLTWNEALGAEGYNIYR
FT                   STSRFGKYVKINSTPILSTTYTDENLDRTSYYYRVTAVNENGETDLSEPISLEMKLFGP
FT                   NVYIFDPADDISLVQKVCSDIFAQMERAHFSSDGNGLFNNRYALLFKPGTYNISLKVGF
FT                   YTQVAGLGRLPDDTTIQSMTVDAKWKPNNNATQNFWRSAENLAVNSNTMWAVSQAAPLR
FT                   RVHIRGNLTLHDSGGWSSGGFLADSKIDGTVYSGSQQQWFSRNDTWGSWNGQVWNMVFV
FT                   GVDNPPAGTWPATKYTTVDQTPIVREKPFLYIDESGNYFVFVPDLKTNSKGISWSNGMG
FT                   AGRSIPLSEFYVARPETDTAATINAALEQGKHLLLTPGIYHLTEPIHVTKPNTVVLGLG
FT                   FATVVSDNGVTPMLIDDVDGVIVAGIIFDAGPVESKALLQIGTAGSSADHSANPVCISD
FT                   VFFRVGGPHLGKTEACLVINSNNVIGDDLWIWRADHGYGVGWDQNTAKNGLIVNGNDVT
FT                   MYGLMVEHFQEYQTLWNGNGGRTYFYQSEIPYDVPYQESWMSNNGTVKGYASYKVADMV
FT                   TSHEAWGLGIYSYFRDADVDLDRAIEVPNHPNVKIHNACTVMLAGYPGILHVINNTGDP
FT                   VMVAGQRAEVTEYCNNVDQPVIVPSTGYYETPQVVTITCPTEGATIIYTLDGSTPSRTN
FT                   GIVYTGPFTVPLGITTIKAMAYKDGMNDSYIAISTLYIGVLSLNKPATASSVATNNPGN
FT                   TPDKAVDGNLNTRWESAYSDPQWITIDLGTVCSINTIEITWYSANSYAKDFKIQVSNDN
FT                   STWTDVYSVTNLTLSSPYISKINFSSPVTGRYVRMYGTRRSASYGYSIKEFVVFGTVAE
FT                   Q"
FT   gene            192796..194001
FT                   /locus_tag="Calkro_0122"
FT   CDS_pept        192796..194001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0122"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   gym:GYMC10_4672 glycosyl hydrolase family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45038"
FT                   /db_xref="GOA:E4SCQ5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ5"
FT                   /inference="protein motif:PFAM:PF07470"
FT                   /protein_id="ADQ45038.1"
FT                   /translation="MNGGTKMLKIKDEGIKDRFKFSNSPLVSKAFVGEVLKLVLSKLDR
FT                   MIEKFGDKFPSPASKALKYDVVGNIYWTSSFYTGMLWLAYEVTGEEKYKDLAKRHLDSF
FT                   EKRLKSRIHIDTHDLGFLYTLSCVACYKVTGDERAKEVAIEAAKQLCTRYWEKPGIIQA
FT                   WGAMDDPVQKGRIIIDCLMNLPLLYWASTQTGDKKFFDIARMHAQMTAENIVREDASTF
FT                   HTFYFDVETGKPLYGSTHQGYSDSSCWARGQAWGIYGFVLSYKYTRDWIFIDIAKKLLN
FT                   YFLNRLPEDCVPYWDLVFTEGEQPRDSSAAAICACGILEMLKFLPLCDEYREYYENAAK
FT                   NIVFSLSTKYLASQDLDSDGLLLHGVYNKPKNEGVDEHTIWGDYFFFEALVRFLQYWHE
FT                   YW"
FT   gene            complement(194033..194776)
FT                   /locus_tag="Calkro_0123"
FT   CDS_pept        complement(194033..194776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0123"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ate:Athe_0100 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45039"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ6"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADQ45039.1"
FT                   /translation="MNNVKIYIGTSGFSYSHWRGIFYPEKLPTSKMFEFYAMHFRTTEI
FT                   NSSFYRLPQEKTVLNWLNFSQADFVFSLKAPRTITHIKRFLDVEDEWKKFEDRVKLLKE
FT                   KLGAILLQLPPSFKADEENVKRLLNFLDGKENFRFAIEFRHKSWFVDDIYDILRSKNIA
FT                   FVIADSSRYPKEKIITANFAYIRFHGPKEMFSSSYSEDQLKNFAMDIKVYSEICEKIYV
FT                   YFNNDFNGYAVENAKNLVKILENVL"
FT   gene            complement(194808..195896)
FT                   /locus_tag="Calkro_0124"
FT   CDS_pept        complement(194808..195896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0124"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: ate:Athe_0101 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45040"
FT                   /db_xref="GOA:E4SCQ7"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0101"
FT                   /protein_id="ADQ45040.1"
FT                   /translation="MNHIYKSKKISKRSRAKIFWVIFLLIFVVVGIVILIAHIPDISKN
FT                   EQKVFKPSKVRIGFAMGTLKEERWFKDRDILIAKAHEKGYEVEWVNANENDVEQINQVK
FT                   YLLSKNINILIIVPNNYEKCSSAVNLAKKKGIKVISYDRLVKNSDIDVYVSFNNYKVGE
FT                   LMAKWLLKKVPYGNYVFLLGDPGDYNVQMIKEGYHKVLDSLIQKKQINSLLEKYCYNWR
FT                   KEYAYNYVNNLLEEGKRIDAVLASNDSLAEGAIMALSEKRLAGSVPVTGQDADISACQR
FT                   IVKGTQLMTVYKPIDKLVDLTLDIVDRLIKGKLLKPNYTINNGYKNVPTFFIDPIGVDK
FT                   TNINDTVIKDNFHTWDEVYITK"
FT   sig_peptide     complement(195783..195896)
FT                   /locus_tag="Calkro_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.873 at
FT                   residue 38"
FT   gene            complement(195918..197477)
FT                   /locus_tag="Calkro_0125"
FT   CDS_pept        complement(195918..197477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0125"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_0102 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45041"
FT                   /db_xref="GOA:E4SCQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45041.1"
FT                   /translation="MTYKVLIADDEKIVVDSIKFILENNLNTDFEISIFTSGREALENL
FT                   LFYSYHIAFIDIKMPDLDGLELIEEYRKMKNSEFPIFIIVSAYDRFEFAKKAIKEKAFA
FT                   YILKPYSIEDIISTMHSAIAQVDSILARTKENIEKNAQLIVMRNLLENSFIPTLIFKNA
FT                   FDIVDVNQYEKIFGINLKSGFLMVLTLKDKSDLVSSFKELDNIRKDIKISFEHKALTSI
FT                   GMGEYLICFFPSQSQKEAEVLQEKIQEILKQKPYWNSIKIGFSDLYYLEEGYENAFWEA
FT                   YYSTLDLEFPEENEENEHLLLLTENLEAKLIHSINNPTQIPMIENYITQLCKLYIELFG
FT                   ENNLKYKVIKLIIMLLLETGIATSDESIDVEKLIPQILNSSYEQIVEIFKKAVLTLFSK
FT                   AKTKHEQIINNDSINKAIEFINQNYSEEITLSQISSTFNFNPYYFSKLFKKYTGVSFKT
FT                   YLTKLRIQKACQLLKNTSKSIKEISFAVGFSDPNYFIKAFKKFTGMTPSAFRSSSVDIN
FT                   SI"
FT   gene            complement(197474..198961)
FT                   /locus_tag="Calkro_0126"
FT   CDS_pept        complement(197474..198961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0126"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: ate:Athe_0103 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45042"
FT                   /db_xref="GOA:E4SCQ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCQ9"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45042.1"
FT                   /translation="MKFFSVQSKLLTFFFIIILSLLAIDILIQYNNSYIVSLVNETFET
FT                   INTINTTKEEISLLNSNLQRYLISGDSDSMLSVYGSLNAIDEKLTALENKITTKEEFLY
FT                   YTNLITIFEHLSKLTERLVIYKKGNLPLSKTYSEYLDFSKFLNDYLEKFSEQKIKFTMQ
FT                   IHHRSQKQLNDIRRINTLVILIWTLFASLLSIVFSNSFTTPIINLSKVANKIAHGNLEA
FT                   QLPQYSSNDEVAVLYQSFSNMIFNIKDMVKKLEEKAEIERMYAQQKIEAIKYRQALQEA
FT                   ELKNLQAQINPHFLFNTLNTILQIAMFENAKQTYEILLRTSSYLRYVVHNINRTVRLED
FT                   EIENVNNYMYIYHMRFGNKITLEIDVEDETKLLLMPCMILQPLVENAIVHGFKEKESGL
FT                   IKIVARKVEENAEIVVWDNGRGIEEEILEDLKNFSFEDNKTTGIGLNNIAKRLSYFYGV
FT                   ERPLYIESNVEGGTKVIIKVPFIIDYSKLPKNEVNTL"
FT   gene            complement(198974..199948)
FT                   /locus_tag="Calkro_0127"
FT   CDS_pept        complement(198974..199948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45043"
FT                   /db_xref="GOA:E4SCR0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR0"
FT                   /inference="similar to AA sequence:KEGG:Athe_0104"
FT                   /protein_id="ADQ45043.1"
FT                   /translation="MRKRMQNLSFRLIAFFSAIIFVAIALYDIYNIRFINVTDKKTNFR
FT                   NSVRIMMILPQNQTYWNWFLEKYKDISEKQGIISDIVFYNTSEEAYKYLKLATVTKPDA
FT                   IVMCNIYNSKEIAQMLPIIKSNNIFIVSLFNDMLFRYEDVFVGIDYYYKGKIAGKIIYK
FT                   VLNEKNSIPKDLRIAIINPFYTTIGGTLEVKGLTDFLKSKGIKEISIKNFNFEYPAFPS
FT                   EEVARQLILEDKQKFNVIYIGSETDTLTIAQNIITFNKLDKFIVIGAGTNEKLQKYVKE
FT                   KIINGIINDKGDLIAQKLCEAILSWKKFGHASSHISTNFNVIE"
FT   gene            200163..201218
FT                   /locus_tag="Calkro_0128"
FT   CDS_pept        200163..201218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0128"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: ate:Athe_0105 D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; TIGRFAM: D-xylose
FT                   ABC transporter, periplasmic substrate-binding protein;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45044"
FT                   /db_xref="GOA:E4SCR1"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR1"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ADQ45044.1"
FT                   /translation="MKKSLLRIVAIFVAVAFIVGIGYAVVPKYASAKSSKKQIKIGLSL
FT                   ATLQEERWHKDRDEFVKAAQKLGAKVLVQAANMDDVKQKEQCENLISQGVDVLVIVPNN
FT                   AEVFTSIIEEAHKAKIPVISYDRLIKNANVDLYISFDNIKVGELQGKYLTSKVPKGNYF
FT                   VFRGAPTDNNATLFYQGAMKYIQPLVKSGKVKVLFDQPVKDWKPEEALRLCENALTAAK
FT                   NNVQGILAPNDGTAGGIIQALKAQGLAGKVVVTGQDADLAAVKRIVEGTQTMTVFKDVR
FT                   LLAKKAAEVAVELAKGKKVSQLKDVNGKVYNGKLNVPSILLTPVAVDKSNIDKVLIQSG
FT                   WFTKEQVYGKK"
FT   sig_peptide     200163..200237
FT                   /locus_tag="Calkro_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.847) with cleavage site probability 0.773 at
FT                   residue 25"
FT   gene            201321..202838
FT                   /locus_tag="Calkro_0129"
FT   CDS_pept        201321..202838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0129"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0106 xylose transporter ATP-binding
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45045"
FT                   /db_xref="GOA:E4SCR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45045.1"
FT                   /translation="MSEYILEMVHITKEFPGVKALDDVTFRVKKGEIHALVGENGAGKS
FT                   TLMKILSGVYPYGTYSGDIFIEGKKQHFRNIKDSEHAGVAIIYQELTLVKGMTVGENIF
FT                   LGREPVVNGIINWNKVYADSKKLFEKLNIEIDVYEKVENLGIGQQQMVEIAKAISKDSK
FT                   ILILDEPTAALTESETRQLFRILKDLKNHGVTCIYISHRLEEIFEIADTVTVLRDGKTI
FT                   STDPISNLTEDEIIKRMVGRELTQRYPKVPHKAKRTIMEVRNFSVYDKDNPEKKIIDNV
FT                   SFEIKEGEILGISGLMGAGRTELFMSIFGAYPGRKEGEIWLEGKKISINNPREAIEHGI
FT                   CYLSEDRKRYGLVLMMDIKDNILLPNYQKFANGGIINIPKSLSTALDYVGKLRIKIASP
FT                   FQQVMNLSGGNQQKVIIAKWLLANPKILILDEPTRGIDVGAKYEIYNLMNQFVDQGVGI
FT                   VMISSELPEILGMSDRILVMQKGKIAGELMAEDATQEKIMTLATGGR"
FT   gene            202842..203963
FT                   /locus_tag="Calkro_0130"
FT   CDS_pept        202842..203963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0130"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_0107 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45046"
FT                   /db_xref="GOA:E4SCR3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADQ45046.1"
FT                   /translation="MNLKKNLRTYTLIIAILLIWTIFTVLTDGNFLTPRNLSMLARQMA
FT                   ITALVAIGMVFVIVAGHIDLSVGSVVGFTGAIAGVLQVWNGWSTPATVIAVLIVGIIIG
FT                   IWQGYWVAYRGVPAFIVTLAGMLVFRGGVLLASKGITISPFKDSFRFIGQGYLNKALSI
FT                   AFGAVLIVGYLLLTISQRNRRKKYNLEVLPMGLEIAKATVVIALIVAFTGVMISYEGIS
FT                   IPVLILVVFTILLTFVSQNTTFGKYVYAIGGNKEAASLSGINIRNVTMKIFILMGFLSA
FT                   LAGIVLTSRLDAATSGAGTNMELDAIAAAILGGTSTLGGEGTVPGAIIGALIMASIDNG
FT                   MSLLNLEYSYQLIVKGLVLVFAVWLDIMSRKKA"
FT   gene            204124..206247
FT                   /locus_tag="Calkro_0131"
FT   CDS_pept        204124..206247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0131"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: csc:Csac_2452 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45047"
FT                   /db_xref="GOA:E4SCR4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADQ45047.1"
FT                   /translation="MKSWARLRANSLYKIFKKGSLAQKLSVFVLVLLLIPITIIDIFSV
FT                   SKAVNSVISESKKSYLIATNSTAQYFQVLFETAKNAAIQLMSNDSIQSFCTGESQNLKD
FT                   ENEKAKIAQDAKNIIANLVVTSEMFSGAYILTNRQTSLMFPSIPFDYLDINKVANSKWY
FT                   KTIMDSAGYVLIDSHRENFDEVAENGNSQIPAYACSIGFQFRDLKTNQIKGVMLLDIKE
FT                   EWLREKLQSTELSKQGVMTIGLLPNGKIVLPLDWEDKMNISVKPNEGFVQKILSQVKAG
FT                   KKEGAFEMVYQQKPYLITFSKTQYFDWTVVGMIPVSAIVKSARSMENVIILLTAIFTLI
FT                   AIVFGILFALKIVKDIEKITDVMAIAEKGDLTNTINIRRSDEIGSLSRSFNNMTSNIKK
FT                   LVEKGKNLTQQVTSSIASLTTIATETSAASNEIARAIQEIAEGAGNQAKEATNVSEIVS
FT                   QFGQRIESIVFSIDQVNKLSKEVFNLSENGFEAVKSLDKATVDTVNITDSMIRTINQLA
FT                   EYSKSIGKIINLLGSISEQTKLLALNASIEAAKAGEAGRGFAVVASEIRKLADMSKEST
FT                   REVDEIIKKIINQTKEAQEIAGKVEFVINNQNTAVETVTGAFGKIKSAVEELFEKIEDI
FT                   NKLILSIDNEKTAIIESIENISAISQETAASTQEVSASTEEQLAAIEELKAMIERLNIL
FT                   AQDLYQAMQVFRV"
FT   gene            complement(206385..207584)
FT                   /locus_tag="Calkro_0132"
FT   CDS_pept        complement(206385..207584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0132"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ate:Athe_0112
FT                   ABC-type Na+ efflux pump permease component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45048"
FT                   /db_xref="GOA:E4SCR5"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR5"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADQ45048.1"
FT                   /translation="MNLKHVWIVFKKELKDAFRDKKALLVNIILPMLFIPIIFVIASVA
FT                   TKSAVEVKPEKTPICIIGKENSKTITSIIEKSEFKIVSSSNPKKDLQDGKIKAILIIPK
FT                   DFEIMISQEKQTNLQILTNETDLKSSNVGNILSNLINEFSKQVVKQRLVQKKLDPSIIE
FT                   PIVVKKENVAPPKKQSATILAFLIPMFLALWAALGGLNIAIDITAGEKERGTLEPLLTT
FT                   AATRSSIVTGKYLAVSIMSLLAGLSSLTGIILSFVLLPNALGATYKNSPFSDYSVSPAT
FT                   VLIMLLVVFLTAIIFAAIEVAIASYARSFKEGQSYLSPISLIVVIPPYLTMYKMPNELT
FT                   DIYFVLPLVNAISILKELIYDIVNLQHLGLFIISSLVYIIISIKFAASMFENEKVLFRN
FT                   "
FT   gene            complement(207587..208312)
FT                   /locus_tag="Calkro_0133"
FT   CDS_pept        complement(207587..208312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0133"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0113 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45049"
FT                   /db_xref="GOA:E4SCR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45049.1"
FT                   /translation="MVELIELTKDFGKVRAVDRLSFTINKGEIFGLLGENGAGKTTTLR
FT                   MLATMLKPTSGTAIISGLDITKEPEKVRRKIGILFGSESGLYARLTARENIEYFGLLHD
FT                   MDKNDLKKRINELAEKFGMQDYIDKPAGTFSKGMKQKVCFVRSVIHNPEVMLFDEPTNS
FT                   LDVSSAKEVHDFIRLCKQEGRTIIFSSHSMSEVEKLCDRVVIIHKGKLVALGSIDEIKQ
FT                   RFSGHSFEDVFLRLVGEER"
FT   gene            complement(208374..209075)
FT                   /locus_tag="Calkro_0134"
FT   CDS_pept        complement(208374..209075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45050"
FT                   /db_xref="GOA:E4SCR7"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR7"
FT                   /inference="similar to AA sequence:KEGG:Athe_0115"
FT                   /protein_id="ADQ45050.1"
FT                   /translation="MKEYFLYVRNIKTVIIMALIVAVVSGIFSIFLNQKFARLILAYCL
FT                   FLFILAVLTINKGIYYYNDPIMVGIATNIYNLNFLYVAPIKRIHIAVWDFLFDLTIILL
FT                   NVFGFNIGLLSTKLFFSSEYSYSIIPLSIFLFATTLFIFSLFCLMTAMVFFIKNRTIFA
FT                   LALTMVATVELLPAIMFPLYILSTSNKRVATFIIYLYTDFKSSIIILLFSIVLFAVSFL
FT                   VNVIYLYRREV"
FT   gene            complement(209707..210582)
FT                   /locus_tag="Calkro_0135"
FT   CDS_pept        complement(209707..210582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0135"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0117 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45051"
FT                   /db_xref="GOA:E4SCR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45051.1"
FT                   /translation="MIALCVRNLTKTYKNFKLEVKELVLESGYIMALLGRNGAGKTTLI
FT                   KCILDLVKKESGEVLIFEKPFNCDEVQIKQRLGIVLENPIVPGYLKPKEVKEIMKAFYK
FT                   TWDDKLYKKLCDLFEIDQNKKIFQLSKGTVMKFSIALALSYRPDLLILDEPTSGLDPVA
FT                   RNQFVEILQEFVQSEEKAVFYSTHIVSDIENVADFVTIIDGGKIVFSSSRESIQDDYCI
FT                   VKGAANEYDKIPKSAVLSLKKSSLSFEALCRKKDFKLFQNEFVVEKPSIEKFYVMLVRR
FT                   DEEDEVLEVV"
FT   gene            complement(210584..210967)
FT                   /locus_tag="Calkro_0136"
FT   CDS_pept        complement(210584..210967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0136"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_0118 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45052"
FT                   /db_xref="GOA:E4SCR9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCR9"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ45052.1"
FT                   /translation="MLKLVISQTSNKPIYEQIKDQIKKQIIEGSLKAGEALPSIRVLAK
FT                   ELNVSVITTKRAYDELEKEGFIVTVPSRGTFVAEIDREKISNIGTKEIEEDLQKVVRKA
FT                   KLLRIELKKLIDMIEKLYKGDEG"
FT   gene            211255..211686
FT                   /locus_tag="Calkro_0137"
FT   CDS_pept        211255..211686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0137"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   ate:Athe_2395 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45053"
FT                   /db_xref="GOA:E4SCS0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS0"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADQ45053.1"
FT                   /translation="MYIYNVMKTLIEYASRSNDIPVAAAIVKNGKIISIKRNDSKKAIY
FT                   HAEILAIIDATSKLSTKDLRNCEMFVTKEPCPMCMSAIVLSKVKRLYFGARDFKMGAAE
FT                   SCFNLSQNPFLNHKVEVIGGICEDECRLLLKRFFEEKRR"
FT   gene            211850..212302
FT                   /locus_tag="Calkro_0138"
FT   CDS_pept        211850..212302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0138"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: ate:Athe_2394 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45054"
FT                   /db_xref="GOA:E4SCS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ45054.1"
FT                   /translation="MENKFLQLVFTSNLQLVKVAEKEILSFLTRETNISADELLEFKLI
FT                   VNELLINAVVHGNKEDSSKSVKVKVGIVDKKLSYIVVEDEGEGFDIDRVFKEYTPYDEK
FT                   DEIEDLYEFGRGLMIVASLCEKVKQNQKGNKIVAVRRLKKEEDCYV"
FT   gene            212497..213702
FT                   /locus_tag="Calkro_0139"
FT   CDS_pept        212497..213702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0139"
FT                   /product="Pectinesterase"
FT                   /note="PFAM: Pectinesterase; KEGG: trq:TRQ2_0501
FT                   pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45055"
FT                   /db_xref="GOA:E4SCS2"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS2"
FT                   /inference="protein motif:PFAM:PF01095"
FT                   /protein_id="ADQ45055.1"
FT                   /translation="MFSLKNYLPDATLSKYMKVLVKADESVFVKIFLNKQLKTERFIRE
FT                   DEILDAVVELNEGKNHLQIEGENLEGNKYVLNKSIRYLEKPFAIVDQNYAGCDKDVAGG
FT                   IVFCKSLKSLAEILKKENSSYKTVFIRNGIYREKVNIDSSRVMLIGEDRNNTIVIYSLA
FT                   AGFPAENGGILSTSNTAAFTISGEDFVVENITFENCFDKNVPIEHRQAVAVKALADRLM
FT                   FFNCAFKSTQDTLYADFGRQYYYRCYIEGDVDFIFGAATAVFEECVICSLDREDRKIKG
FT                   YVTAASTKPDSQYGFLFIRCKLISNIREKECVYLGRPWHPSSDPNRWVNVVFRECYLDE
FT                   HIHTDGWCEMHGFCPENERFFEYKNFGPGSSIQNPKRPQLNENEAQMYTKEKVFGDWKV
FT                   EI"
FT   gene            213888..214649
FT                   /locus_tag="Calkro_0140"
FT   CDS_pept        213888..214649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0140"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: ate:Athe_2392 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45056"
FT                   /db_xref="GOA:E4SCS3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS3"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADQ45056.1"
FT                   /translation="MLSATRRQKIKEILMEKKSVTVTELCNIFNVSDETIRRDLKKLEQ
FT                   EGIIEKNYGGAILKEGVSIVPPISQRSKEFIQEKERIALEAINRIKEGMVVILDTGTTT
FT                   QQIARKLKSFQHITVITNGINIVNELITNNSINLFLVGGKVKNSNFSTVGPEAQKAFLQ
FT                   FSADIAFIGTSGISLEKGLTTSDVFEAEVKRAMIDSSKEVIVVADSSKFKKNAMVSFAT
FT                   LSKVSEIITAGEISDELVENFRQKGVKITVV"
FT   gene            214704..216197
FT                   /locus_tag="Calkro_0141"
FT   CDS_pept        214704..216197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0141"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   ate:Athe_2391 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45057"
FT                   /db_xref="GOA:E4SCS4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS4"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADQ45057.1"
FT                   /translation="MEKILTIDIGTTACKVIVFDLQGNILAKANREYPTYTPQIEWAEQ
FT                   DPLDWWKEAVEGIKQVVQVAGADDIVAIGLSSQRETVVPIDREGNVLSRAISWMDRRSR
FT                   VEAEEISRQFGKETIHKITGLIPDSTFTATKLLWLKKHQPEILQKAYVFLQPKEFIGYM
FT                   LTGQAATDHSLASRTMMFDINKRQWWQDIFEFVGVKTSQFPRLCYADEIIGYLKEDVAK
FT                   FLGLKNGIPVVSGGGDRPSEALGAGIVGSRVMESTGTATNVSMSSNKVPESLDPRVVCS
FT                   CHVIRDHYLIEQGINTSGTILRWIRDNFYRGEKEKGENVYELIDNEAESSGPGANGVVL
FT                   LPFFMGSRATRWNPDAKGVLFGLTLTHSRADIARAVLEGISYEIRACIEILESMGLKAE
FT                   NIVSMGGGAKSRVWSKIKADILGKAVVVEKVQEAASKGAMLLASYAIGARKSLIEEKRE
FT                   VLFEYQPDSKNYEIYNRVYEIYNQLYNSVSHLYSKISQY"
FT   gene            216217..217053
FT                   /locus_tag="Calkro_0142"
FT   CDS_pept        216217..217053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0142"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase; KEGG:
FT                   ate:Athe_2390 ketose-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45058"
FT                   /db_xref="GOA:E4SCS5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS5"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ADQ45058.1"
FT                   /translation="MLVNLNQVLSYTKVRKFGVGMFNGLSADFYEGLIDAAEQLRCPII
FT                   IGVADRFVDRLDFEMIAEVMIFLAKRASVPVCVHLDHAKSLKNIMRAIKAGFTSVMFDG
FT                   SSLPFEENIKRTREVVEIAHSVGVSVEGELGVVGRGDFDFKNPEFYTKPDEAEEFAQKT
FT                   QVDALAVSIGTVHGVYKGEPKLDFERLSEIRKRVDCYLVLHGGSGLSDVDFKKCIEYGI
FT                   NKVNIFTDLTLAINAQLPEFVKQTEDLTPAIFEKIREIVKLEAIKKLKIFGSYNIL"
FT   gene            217080..217991
FT                   /locus_tag="Calkro_0143"
FT   CDS_pept        217080..217991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0143"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; KEGG: ate:Athe_2389 xylose isomerase domain protein
FT                   TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45059"
FT                   /db_xref="GOA:E4SCS6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS6"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADQ45059.1"
FT                   /translation="MNEPIKKYFKIGTIHFMSFPEVIGGEGPIEETLKIILEDDYFDAV
FT                   EITWVKDPEVRKRVAKMLKDAHIAVAYGAQPTLLRTGQNPNDLDPEKRKQVINFLKERI
FT                   DEAIELGAQGLGFLSRQYDEAKKEEAFEALVDTTLQLCDYAKSKGNFLIELEVFDFDID
FT                   KKSLIGPAELAAKFAERIKKEYDNFGLIVDLSHLPLTRETAEQALLPVKDYLTHVHIGN
FT                   AVVKDPSHPAYGDKHPMFGIEGGENDVEEVIEFLRVLKEIGFMDPTKRPILSFEVTPMA
FT                   GQDPKIVLASSKRVLNEAWARL"
FT   gene            218060..219031
FT                   /locus_tag="Calkro_0144"
FT   CDS_pept        218060..219031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0144"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ate:Athe_2388 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45060"
FT                   /db_xref="GOA:E4SCS7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS7"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADQ45060.1"
FT                   /translation="MKILVTRRIMEPAIELLKKYGEVEVNPHDRPMTREELLSAIKDKD
FT                   AVLTQLVDKVDKEFFDHAPNVKIVANYAVGYDNIDVEEATRRGVYVTNTPDVLTNATAE
FT                   LAWALLFAAARRIVEADKFMRGGHYKGWGPMLFLGKGVTGKTLGVIGAGRIGQAFARMS
FT                   RGFNMKILYYDFERKENFEKELGAQYVPLDELLKEADFISIHVPLTPQTRHLIGEREFS
FT                   LMKPSAILINTARGPIVDEKALVKALKEKKIYAAGLDVYEREPEFEPELAELDNVVMLP
FT                   HIGSATEESRLDMAMLAANNIVDFIEGRVPRTLVNKEVLNKK"
FT   gene            219203..219976
FT                   /locus_tag="Calkro_0145"
FT   CDS_pept        219203..219976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0145"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: ate:Athe_2387 transcriptional regulator, IclR
FT                   family; PFAM: Transcriptional regulator IclR ; regulatory
FT                   protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45061"
FT                   /db_xref="GOA:E4SCS8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS8"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADQ45061.1"
FT                   /translation="MAQNSVQSVERAFEIIEALAVEPRGLTVSELSERLSLHKTTVHRI
FT                   LQTLLQRGYVQKDRHTLRYKLGVKFVEISSIYLNNIELKTEAHPYLRELVKMLNVTVHL
FT                   AILDEFDVVYIDKVEQVNSIRLYSSIGKRVPAYCTALGKVLLSKYQDHEIKKILKSIEL
FT                   KPYTQNTITDPEILLNEIILARERGWAVDNQELQPSIRCIAAPIYDYRNEIIAAISISA
FT                   PVNILPPEMDEENAKKVVDTAMTISSRLGFVKDRF"
FT   gene            220019..220666
FT                   /locus_tag="Calkro_0146"
FT   CDS_pept        220019..220666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0146"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: ate:Athe_2386
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45062"
FT                   /db_xref="GOA:E4SCS9"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCS9"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADQ45062.1"
FT                   /translation="MEKEQVLERIHENGLVVVVRAESKEKALKITEACIRGGASAIEIT
FT                   FTVPGADEIIRHLTKTYSEDKIIIGAGTVLDSETARIAILAGAKFVVSPYLNPEMVKLC
FT                   NRYRIASMPGAMTIKEVVEALECGADVIKIFPGELFGPKIIKAYRGPIPQARLMPTGGV
FT                   DLDNVDEWIKAGAFAVGVGGNITKYAQNDDFEKVEEVCRQFVEKIKIAKGKV"
FT   gene            220672..221700
FT                   /locus_tag="Calkro_0147"
FT   CDS_pept        220672..221700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0147"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ate:Athe_2385 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45063"
FT                   /db_xref="GOA:E4SCT0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT0"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADQ45063.1"
FT                   /translation="MFEVTSFGEIMLRLSPPGYQRIVQATSFDINFGGAEANVVVALSN
FT                   IGVKTSYVTLLPQNPLGDATINFLRRYGVDTSYIKRKGRRLGIYFLEKGVGQRASSVVY
FT                   DRSDSAINEIQPGDIEWEQILKKTKIFFSTGITAALSQNVLNELKMAFKTAKNAGAKVA
FT                   FDINYRSKLWSYDRANEVISELMPYVDILITNEEHVRRVLKIEMEDKYFEGIDLTVDGQ
FT                   KFLFERLQTKYQNLERIILAARRSISASKNIFFAYTKDENGNIVFSEKREIEIVDRVGA
FT                   GDAFTAGVLYSILRGIETTQMLEVATYMCALKHTVEGDSLIVTEDEIKQVLWQDGSGMM
FT                   KR"
FT   gene            221723..222553
FT                   /locus_tag="Calkro_0148"
FT   CDS_pept        221723..222553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0148"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="KEGG: ate:Athe_2384 5-keto-4-deoxyuronate isomerase;
FT                   PFAM: KduI/IolB isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45064"
FT                   /db_xref="GOA:E4SCT1"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT1"
FT                   /inference="protein motif:PRIAM:5.3.1.17"
FT                   /protein_id="ADQ45064.1"
FT                   /translation="MEVRFAMHPSQFKALTTEQIRKEFLIENLFEYGKINMVYTHVDRV
FT                   IVGSAVPTVEALVLEDGSQIGAQYFLERREIGIINIGSRGYVIADGQKFELDKKDGLYV
FT                   GMSTKKLEFGSDDPSNPAKFYFVSTPAHKQYPTEKIDIKQTEATHLGSLSESNERTIYK
FT                   YIHPDGVKSCQLVMGMTILEPNNVWNTMPCHLHDRRMEVYFYFDMPEDAFVLHLMGEPN
FT                   ETRHIIVRNEQAVISPSWSIHSGVGTKNYTFIWAMAGENQSYSDVNPVPMKELK"
FT   gene            222580..223341
FT                   /locus_tag="Calkro_0149"
FT   CDS_pept        222580..223341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0149"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="KEGG: ate:Athe_2383 2-deoxy-D-gluconate
FT                   3-dehydrogenase; TIGRFAM: 2-deoxy-D-gluconate
FT                   3-dehydrogenase; PFAM: short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45065"
FT                   /db_xref="GOA:E4SCT2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT2"
FT                   /inference="protein motif:TFAM:TIGR01832"
FT                   /protein_id="ADQ45065.1"
FT                   /translation="MILDKFKLDGKVAIVTGASTGLGQGMAIALAEAGADIVGVDYVPC
FT                   TETKQKIEAIGRRFLEIQANLMTIEPINMIIEKTIQEFGKLNILVNNAGIIRRCDAIDF
FT                   TEKDWDDVLAINLKTVFFFCQAAARQFIKQGTGGKIINIASMLSFQGGIRVPSYTASKS
FT                   GVAGITRALANEWAKYNINVNAIAPGYMATNNTQQLREDPQRSAEILSRIPAGRWGTPE
FT                   DLQGAVVFLASDASEYVNGCILNVDGGWLAR"
FT   gene            223372..224010
FT                   /locus_tag="Calkro_0150"
FT   CDS_pept        223372..224010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2382 protein of unknown function
FT                   DUF1121"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45066"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2382"
FT                   /protein_id="ADQ45066.1"
FT                   /translation="MNKYKMWHNELIAKDIVERLNRKKYNAFYAPTLEDAKNKVLELIP
FT                   EGSSIALGGSVTIEELGLIEIFRNGPYKLFDRYKPMTAEERIELFRQSLLADVLVTSTN
FT                   AITKNGELVNVDCSGNRVSAMIFGPKKVIIVAGVNKVVEDLDEAFKRLKKIAPMNSKRN
FT                   NHKTPCIETGYCMDCQIKARMCNYITIINHGMKFEGRINIIIVPFEIGF"
FT   gene            224274..225395
FT                   /locus_tag="Calkro_0151"
FT   CDS_pept        224274..225395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0151"
FT                   /product="glycosyl hydrolase family 88"
FT                   /note="PFAM: glycosyl hydrolase family 88; KEGG:
FT                   ate:Athe_2381 glycosyl hydrolase family 88"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45067"
FT                   /db_xref="GOA:E4SCT4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT4"
FT                   /inference="protein motif:PFAM:PF07470"
FT                   /protein_id="ADQ45067.1"
FT                   /translation="MQKLKQLAKENYSVKMADSVLFKFPDLIDKWQYDYGVVFKGLEYI
FT                   YENTKNEKYFKYIKKNMDYFVKEDGSIKKYSLDEYNIDHINNGKAVLFLYRKTGEEKYK
FT                   KAAQHLREQLKTHPRTVEGGFWHKKIYPHQMWLDGIYMGSPFYAEYATLIGKDEAEEIF
FT                   DDVARQVILCAKHTKDPVTGLHYHGWDESRQQKWANKITGCSPNFWGRALGWFAMAIVD
FT                   VLDFLPQNHQSRDTILAIFRQLIDAVLKYQDPETGVWYQVVNYIGKNGNYPEASASCMF
FT                   VYALAKGIHNGYLSSKYLDALERAYEGIIYRFLEKDHNGHLSLNGVCMVAGLGGNPYRD
FT                   GSYEYYISEPIKTDDLKGVGAFLKASAWVERLF"
FT   gene            225435..226778
FT                   /locus_tag="Calkro_0152"
FT   CDS_pept        225435..226778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0152"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; KEGG:
FT                   ate:Athe_2380 galacturan 1,4-alpha-galacturonidase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45068"
FT                   /db_xref="GOA:E4SCT5"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT5"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /protein_id="ADQ45068.1"
FT                   /translation="MIYNVCDFGAKGNGVDKDTEAFKKAIEVCEKNGGGTVYVPAGIYH
FT                   VGALHLKSNMTLYIESGAVLKFSQDEEDYPLVYTRWEGEEMQVYSPLIYAEDAENVAVV
FT                   GFGTIDGQGEKWWRLHRNKELKYPRPRSICFYRCNNVTIEGIKIINSPSWTVNPIECQN
FT                   VTVHNIKIQNPYDSPNTDGINPESCKGVRISNCYIDVGDDCVTLKSGTEDCKERIPCEN
FT                   ITITNCIMAHGHGGVVIGSEMSGGVRNVVISNCIFEGTDRGIRIKTRRGRGGVVEDIRV
FT                   SNIVMKNVMCPFAFYMYYHCGKGGKEKRVWDKSPYPVDESTPIVRRIYISDVVVREARA
FT                   AAGFLYGLTEMPIEDVVFSNVTVEMAQNPEPELPAMMSYLDPMAKRGFVINTVKNIRFM
FT                   NVTVLEQEGAAFELNNCENVEFYRCRSKDTNDYEKILSLNNVSSLVTD"
FT   gene            226976..229927
FT                   /locus_tag="Calkro_0153"
FT   CDS_pept        226976..229927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0153"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="KEGG: cth:Cthe_2949 pectinesterase; PFAM:
FT                   Fibronectin type III domain protein; SMART: Fibronectin
FT                   type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45069"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT6"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ADQ45069.1"
FT                   /translation="MKKKKLISLVIMLVFLVNSVIGVSTVFMVNAFAGTWPVTWNYTVI
FT                   GDSTYQPGSPVGSFDHQTGKITVSATQAEINRTSTQTATTVDYFPFVYTQVNNTIFTAY
FT                   VYINDPILFTNANSNYPRGGLIVRNGLGIQDSYYAALVEYNSASSTKWDLRAQRRFGST
FT                   AGSSTRSAISFPCVLKIVRSSSTNIAAYYGEVNTNTGVITWYGPIGARSDAGVLNSTLY
FT                   VGVGIAVQGSNGNPATLQTSFVRIKDGVADSNTSPQNLSDIFNLPQKPQLIVESGDSQA
FT                   KLMWSYDRNAISYDILLSEDGSNFNLVASNVTETSEGLLVVQGNAFYTINGLTNGKQYF
FT                   VKVRAKNEYGVTESDPVIVVPEKPTPPAKPTVIQTAYSDGWVSIKWKTVSKATYYVVYI
FT                   GDAPNNYTDWKIVNDNGLPNQTYECKFDNLINKKPYYLRLFAGNNVGLSEGSDEVVIVP
FT                   YPIPAIPTFEVIPGVLELTVKWNKVEDAERYTLYLGKSSKNYTISAIVYDDGSPFYTYT
FT                   FKKLEGLQYYITMNAANNSGTSANAQEVSAMPLLPQHYVTNLVVYDQDNAANWSLRYNL
FT                   QVGSKIFGDRDYAVVSMPTVLEGAYWISTANLSRSYNATPVIASFIVTEDVDIYVAIDS
FT                   RLYTSNQVPVFLSTWDLTDYKIIDNGTNPQVTYLLYKKSFSKGSLVELGYQGVSSGCVF
FT                   YFVLMKKQLFSIDSEDIVYTNKPVYNIKGKIFAGASVTIKKANEIVATYDTADQDREFN
FT                   ISISLQEGENLIEFSAISTDGYISNRLIKIVYDSTSPKITFKQTPVEYENETPSAIIKF
FT                   VCDEDIYINIKVNEQTVLDNVYCPALQDKELLVPLSEGNNTISLTAKDKSGNIAAYQWV
FT                   TVYEYMIKNISFVDDYENQITSLTANAVINVLARAENKLNISKDIAIVIAYYNSANQMI
FT                   GYSISYDTVLPNSSEELLAGIQMPSYINGLKVKAFIWNSLEGMIPLSSVIDLK"
FT   sig_peptide     226976..227077
FT                   /locus_tag="Calkro_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.786 at
FT                   residue 34"
FT   gene            230030..234655
FT                   /locus_tag="Calkro_0154"
FT   CDS_pept        230030..234655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0154"
FT                   /product="Pectinesterase"
FT                   /note="PFAM: Pectinesterase; Pectate lyase/Amb allergen;
FT                   KEGG: bcv:Bcav_3362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45070"
FT                   /db_xref="GOA:E4SCT7"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT7"
FT                   /inference="protein motif:PFAM:PF01095"
FT                   /protein_id="ADQ45070.1"
FT                   /translation="MRKRLLSIFVIVTFLLSLMPFNLITKAENLVPAFPGAEGAGMYTT
FT                   GGRGGDVYEVTNLNDSGPGSLRDGVKLSNVTIVFRVSGTIHLKSELVISGSNITIAGQT
FT                   APGDGITIADYGVRITGSNIIIRYLRFRPGSANINSEPDALTSFGGSKNIIIDHCSFSW
FT                   SVDETLSIYRTENLTVQWCIAAESLTMSGHWKGRHGYGGIWGGYNATWHHNLLMSHTSR
FT                   LPRVNVGSAPIPEAKVEFINNVIYNWGFNNTYGGENTTLSLINNYYKPGPGTQDTVMSR
FT                   IANPTPNGYQSSWYISGNVLEGNSDVTNNNELGITASGTYTKLTEPVDIPGEVTIQDAQ
FT                   TAYQEVLAKAGAVYPKRDAVDARLVNEVKNGLGRFINTEAEVGGYPELQSAQAPQDTDH
FT                   DGMPDNWEISNGLNPNDPSDRNGYKFGNGYTNLENYLNSLVDMNYAPKNPEVTIVNPKY
FT                   NAIVNAKSALKIEARANAFDGANITKVVFYDNGVKIGEDTTAPFSYTIGAVEEGIHYLV
FT                   AVAYDSNGLSTQSTAVRIYAKGSDASLPWKIADIGNPAIKTAASFDNNGVLTIAANGKI
FT                   GGSTDSFGYVYRKVYGDAELVARIDYLEKVDHNAFAGLMIRSSLDPGSPAAFIAKSYVK
FT                   AEKLTQPTAVRFISRQVPNAQMPNTSDVDASSPNTVVNIDISWLKIKKVGTVVEAAYSL
FT                   DGITWSTIGSYNLDLGNEYYIGFAVDSAQVTNQLYNYNVAKFSNISLIATDNFIEIYNH
FT                   ENDWINNGEYKVKGYANMDGKVTVKNLINGDSKSIDVIRQSEFELPVKLESGINTIAVN
FT                   MQSTDASKTRQAVLNVVYDDRQPSISWISKPQPTVLSSAYKIAFSSNEDVYVTLLQDDM
FT                   VVYQDCYIKANIPATFDINFEKGRNKIEVIVKDLGGNVTKEEFDVIYLASFDIMVDKNY
FT                   AGNDGDIVNGVRIFKTVQAAVNSVPTNNTKRTVIFIKSGRYYEKITINSPNISLIGEDP
FT                   MTTILTYDVAAGTPKPDGTGTYGTSGSASVTINSGAINFTAENITFENAFDENQPISSK
FT                   QAVAVRSLADKMVFKNCRFIGNQDTLYADAGRQYFKDCYIEGDVDFIFGAAQAVFENCT
FT                   IFSVDRAGITPKGYVTAASTKKTDNFGFLFLNCKFVSNVTVANSVYLGRPWHPSADLNR
FT                   WVNVVIRESYLGEHINDYGWTAMSSTDSNGNTIWFYPQNERFYEYKNYGPGAKINDFRP
FT                   QLDDVMAQVYTKQNVLDGWDADSFIDTVYDPIKVYIGNPRKDSTTKINYTVNIAADSDC
FT                   ELTVKKGNEVVYTNPSYTANTQITVPVVLSDGTNNILIIASKAGENVAKLITVDFINYA
FT                   PEITVVQAPASKTTKSTVTVKAKISKNGTVTFKRNGESLGSINVEANKEFSYDYSLVEG
FT                   ENTLELVVVDEGGNIRITTFRVVYEIDWGSNAFSVQIVQVKNIAGSILNAIGSNKDIVV
FT                   TVNIKNNTGLTRTGTVVVGVFDSTGKLVVYAGKKISIEAGKTITYRAGLKINYVNGPLV
FT                   KAYVVDALKTKNYLSNIASFK"
FT   gene            234752..236401
FT                   /locus_tag="Calkro_0155"
FT   CDS_pept        234752..236401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0155"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   cth:Cthe_1307 cellulosome anchoring protein, cohesin
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45071"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT8"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45071.1"
FT                   /translation="MKKVKKLISLFCVTSILLLIIPVLAGNFTMNISIDSNKNLVINGK
FT                   TSAKANVTVKVLDPFGNIDYLDQTMTDNDGGYEFKYSLSGKAEGVYTVFIYSKDLSAPI
FT                   SKTITYTTSQTGSSSVNIVLPSTNTSTQQQTQQQTQQQTQQTQQGQTDQQKQPQQVQTT
FT                   TIQPQVQIIGQTAISKIDEKILAQTVASTKANENGEKIVQISIASKSNVFEYEQIIPLK
FT                   VINNQNVVFNISTNIGQIKVPADVVSNSLKVENLSVNIGKVANEDLNNIKQLVGKNVEM
FT                   AIKVQVKVDNKVLTEENMQKPVIVKSQYTPSIGVQTKYLAVMKVTEDGKVEPVASGMYF
FT                   ANSKEIAFRAKDSAKYVVVENYKTFDDIKNVSWAKEQIEVLASKGIVKGIDNNNFAPQK
FT                   QITRADFLLLLVRALELSAPVKDDNFSDVKKGDYYYDAVGTAKALGIVNGVGDGRFNPK
FT                   GLITRQDMIVMADRALKIAGYKYSNSSKSIDAYVDASKVSNYAKESIQKFVSEGFIQGS
FT                   NNSLKPTDNASRAEVAVIIYRLINSYYIQQLK"
FT   sig_peptide     234752..234829
FT                   /locus_tag="Calkro_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            236501..238087
FT                   /locus_tag="Calkro_0156"
FT   CDS_pept        236501..238087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0156"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_0358 ABC-type sugar transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45072"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCT9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45072.1"
FT                   /translation="MKKWKSITALMFASIFLLALFGVYSFNIPKVEASNKITLTYWVPM
FT                   GAEQALHYKSYNELPAYQILQKKTGIKIVFKHPPLSSSAANDQFNLMIASRQMTDIIEW
FT                   GWNGYPGGPQKALIDKVIIPLNDYIPKYAPNLNNLLKKNPDISKMIRTVNGDYYCFPSL
FT                   KELPIDAYYGPQVRKDWLEKLKINPPETVDDWYKMLKAFKTKDPNGNGQADERPFSILR
FT                   GASNPRAAFDYCSFLVGAWGIKTDFFQINGKVRFGPLEPQFRSFMNTLAKWWKEGLIDP
FT                   DILTMDRKVIEANVLQDKIGSYLGLIGGQMGTYLTVKKGTSFDLIGVQYPSLKKGEKVK
FT                   IGQNEYPFTGRGAAISTNCKNIQAACKVLDWAFSKEGYEVMNFGVKGKSYIVKDGRPVY
FT                   TDEILNNPKLGPKEALGKYVPILGAYVQSREYSLQISFMLPQQKEASKNWSKVTNEIAL
FT                   PPLSLFFTPEEASKLANIMNAVNTFYDEMFLKMMTGKYSNYDAFVKTLKRMKIDEAIKI
FT                   YQNAYDRYMKR"
FT   sig_peptide     236501..236578
FT                   /locus_tag="Calkro_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.620 at
FT                   residue 26"
FT   gene            238177..239727
FT                   /locus_tag="Calkro_0157"
FT   CDS_pept        238177..239727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0157"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   csc:Csac_0359 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45073"
FT                   /db_xref="GOA:E4SCU0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU0"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADQ45073.1"
FT                   /translation="MKEENYKNPIIHADYSDPDVIRVGNDYFLVASSFNCVPGLPILHS
FT                   KDLIHWRIINYAVKKLPSPEYDTPQIGKGIWAPAIRYHNGKFYIYFSIPDDGIFCCYTD
FT                   DPFGKWSDIVLVKKAKGWIDPCPFWDDDGKAYLINAFAKSRIGFNSKLCISKLSEDGLS
FT                   VLDEGKIVFDGTNTQPTIEGPKLYKRNGYYYIFAPAGGVKYGWQTILRSKNVYGPYEER
FT                   IVLHQGNTLINGPHQGAWIETEKGEHWFVHFQDKGPYGRIVHLQPMTWFEDDWCIIGVD
FT                   QNQDGIGEPVLEYRKPETEEESSHFYIECSDHFDSEKLSFAWQWHANPRDEWYSIDIQR
FT                   SVLKLFAVCAKDSQQKRSMFYMPNLLLQKIPAEEFEVVTKMKANFNTKGSSSGLIVSGY
FT                   KYSAIGLERREDGNYLIQILGEIVGANANEKIVESKKIDGNEIYLKLKMGKGANSEFLY
FT                   SVNGKEFFKFGLEFIPKEDVWTGSKVGLFCVNRYAEGNVLEEDFAEFDYFIFNFWEVC"
FT   gene            240141..241457
FT                   /locus_tag="Calkro_0158"
FT   CDS_pept        240141..241457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0158"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2376 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45074"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45074.1"
FT                   /translation="MVKNKRLIALLVLVVFTFSLFFTFSTVNCEKVKAASNKVTLRFMW
FT                   WGGEARHKATLAAIQAYMKKYPNVRINAEYGGIEGYMQKLITQLVGRTAPDIIQIDVTW
FT                   IGELSAQGDFFADLKTFKEVNLKPFEEKFLKDWCYSNGKLIGLPTGVNASAIHYNKDFF
FT                   KKFGIPENKTWTWEDILTTAEMVHKKDKNYYLLNFDATVCYYLLKTYVLQKKGGKWIND
FT                   DYTMGFDRKTLIEAFTYIDKLFKVGAIQPFSESAPFQGKPEQNPKWLKGELGMLWNWTS
FT                   TFAANKANIPSLSMTMIPIMKNAKSTAVTVRPSQLLAVNKLSKNPKEAAKFINWFLNDK
FT                   QAALILKDVRGVPASSTAREALEKEKALDPVITQITSEALKRAAPPENALSQNQELEKI
FT                   ATDVIQQLAYKQLTPTQAADKLMALYKQKLAEIKRLQSR"
FT   sig_peptide     240141..240227
FT                   /locus_tag="Calkro_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.653 at
FT                   residue 29"
FT   gene            241583..242479
FT                   /locus_tag="Calkro_0159"
FT   CDS_pept        241583..242479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0159"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2375
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45075"
FT                   /db_xref="GOA:E4SCU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45075.1"
FT                   /translation="MTANLKRKDLVGLLYVLPWLVGFLVFKLYPFIMSFVYSFCDYSML
FT                   KPPKFVGLYNFIYMFTKDELFPKALLNTLKYVIITVPLKISFALFVAIILNMKLKGINL
FT                   FRTVYYLPSIFGGSVAISILWRFLFMKEGIVNKFLGLFGIEGINWLGDPRIAMFSVSLL
FT                   AVWQFGSSMVLFLARLKEIPSELYEAALVDGASRLKMFTKITLPMISPIMFFNLVMQTI
FT                   NAFQEFTGPYIITGGGPVNSTYLLSMLIYDNAFKYFRMGYAAALSWVQFVIILIFTAFI
FT                   FRSSTYWTYYEYDEGRF"
FT   gene            242486..243343
FT                   /locus_tag="Calkro_0160"
FT   CDS_pept        242486..243343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0160"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2374
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45076"
FT                   /db_xref="GOA:E4SCU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45076.1"
FT                   /translation="MYSQNKIVKNTISLFITYAFLILFGLFMIYPLLWVVSAAFKSNDE
FT                   IFKSLSLFPQKIVTDSFIKGWQGTGQYTFGRFFANNFILVIPVVFFTIISSTLVAYGFA
FT                   RFNFPLKRLFFVILISTLMLPDSVNLIPRYILFNAFGWVDSYKPFIIPSMFASTPFFVF
FT                   MMIQFMRGLPREIEEAAIIDGCNSFQILLRITGPLCKTAMISMGIFQFIWTWNDFLGPL
FT                   IYINSVEKYTIALGLRMCVDSAAAIAWNQIMAMTVIAMLPCIIIFFAAQKYFVEGIATS
FT                   GIKG"
FT   gene            243432..244190
FT                   /locus_tag="Calkro_0161"
FT   CDS_pept        243432..244190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0161"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_2373 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45077"
FT                   /db_xref="GOA:E4SCU4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45077.1"
FT                   /translation="MYYKMIIVEDESEIRQGLFTCFPWDKLGFEVVGLFENGKQALDYI
FT                   LQNKVDVVFCDIKMSVMNGIDFARVLFLNNIPVKVVFISGYQDFEFAQKAMKYGVRYYI
FT                   TKPATYDEVIEIFGLIKKELDLQSKNPQTHSEEEKKHDLISIDNPENVIETVKEYINKN
FT                   YKEATLEDAAKLVYMNPYYLSRLFKCKTGKNFSDYLMEVRMKKALLLMKIPIYKLHEIS
FT                   EMVGYKNPKNFTRAFKKYFGKSPSEFVQER"
FT   gene            244197..245981
FT                   /locus_tag="Calkro_0162"
FT   CDS_pept        244197..245981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0162"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; KEGG: ate:Athe_2372 histidine
FT                   kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45078"
FT                   /db_xref="GOA:E4SCU5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU5"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45078.1"
FT                   /translation="MKGKDGLYKSRLFKRNFFQIVIVPIIIILIFGFFSCLIIEQYVKN
FT                   EINKNLETMLIQSENNIELMLGEIDYLFMVFGINKDVTLQIKRILNSTYFSLEDIWQLN
FT                   MFKNVLNSISYSKPFIHSIYVYFKNPEGNFIVTPDGITNFQYFYDNKWFEQYKKHSELM
FT                   WIERRKIQPYNFAEESVDVLTIYKKIISGYSDLDEGVIVLNLYYDQVKKLLNLPSSIPD
FT                   HAMYILDQKGNILVSNQSDDSNILITISKKPVKSFLTKKIASKKYNLTFVSVIPKDYLY
FT                   SIPIKLFKIAIVMLLIFIIIAFSASYYIAKMNYRNIKKIIDTINSATEGRPLKEANITS
FT                   NDEYGYIMYNVIKNFIEKHYLTTRLQALELLALQSQINPHFLFNTLEHIYLKTLALTRY
FT                   PNEVTKMIENLSSILKYSLSNPRSTIFLKDEIKATKAYIDLVKARYKEKFDVIWDYTED
FT                   VLDVKVMKLLFQPLIENSIYHGIKPCEKRCGIKIRIRKLKDTSDWLCIWVIDNGIGMSK
FT                   EKLEEVQGRLSQDFDFSDHIGLLNTNERLKLIYGGNFKLKVWSKLGLGTIVKIILPVNF
FT                   EDRKENEIDAKKTGYLYP"
FT   gene            245950..246831
FT                   /locus_tag="Calkro_0163"
FT   CDS_pept        245950..246831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0163"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   ate:Athe_2371 glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45079"
FT                   /db_xref="GOA:E4SCU6"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU6"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADQ45079.1"
FT                   /translation="MLRRQDIYIRDPFIMPVKEKRVYYMFGTTDKNCWGNEKATGFDYY
FT                   VTYDLENFDGPYPAFRPPQNFWADRNFWAPEVHFYNGKYYMFATFCSPEGKRGTAILVS
FT                   DTVEGPYVEHSIGPVTPKDWMCLDGTLYIDEDSNPWLVFCREWVEVYDGQILAARLSND
FT                   LKRVIDEPVLLFTASSAPWTASIRVKDGRECFVTDGPFLFRTQNGTLLMLWSSFDSERR
FT                   YCVGAAKSLSGNILGPWQHKPEPIFSNDGGHGMLFRTFEGDLMLSIHSPNSRGSERPLF
FT                   IKIDEKNLENEF"
FT   gene            complement(246879..249959)
FT                   /locus_tag="Calkro_0164"
FT   CDS_pept        complement(246879..249959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0164"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; glycoside hydrolase family 42 domain 5 loop
FT                   region; KEGG: ate:Athe_2370 glycoside hydrolase family 2
FT                   TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45080"
FT                   /db_xref="GOA:E4SCU7"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU7"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ADQ45080.1"
FT                   /translation="MLDKSFYQNPKIQHVNMAQPRSSFVPYASVENALLGDWELSEYLR
FT                   LLNGSWYFKLFDMPCKVDQEIIKSDAKFTGFEKIIVPSNFQLFGYDKPIYTNTRYPIPV
FT                   DPPYVPDINPTGVYKKEIFISKEDKEKRIFLVFEGVDCAFYLYVNQEFAGFSKVSHMMH
FT                   EFDITDLLTEGKNIITVAVLKYADSTYLEDQDKWRMSGIFRDVYLLVRPKIYLKDIYLK
FT                   PELNDNLTKGSLVAEIEISNSNEEKSEFYVDVQIYADKELLKSASKLASILPKTTEQFR
FT                   VEFQIEKPLLWSAETPNLYKFIVIIKDTSGKILEVIPQNFGFRKIEIKDGVFYLNNVPI
FT                   KLKGVNRHDMHPRVGFAVTRKMMQEDITLMKQHNINCVRTSHYPNHPYFLELCDKFGIY
FT                   VIDEADLETHGFGAVGDWGLLAKDPMWEDAFLERAKMMVMRDKNHPSIIMWSLGNESGY
FT                   GPNHDKMAQWIRSYDNSRPIHYESARDAEVVDIVSVMYPPVEKLEEEGKKQEKRPFFMC
FT                   EYAHAMGNGPGNLKEYWDVIYKYPRLLGGCVWEWADHGILTKTPDGKEYYAYGGDFGDE
FT                   PNDGNFCIDGLLFPDRTPSPGMIELKKVYEPVMIELLDKKSGIFRVTNRYDFISLNHIE
FT                   VEWELLLGGRVVKEGFVDVSDVLPHSSKEVEIDEVKEVLKSCKEELFITFTAKLKNSMP
FT                   WAKRGFVLTKSQIAINEETSQDAVQKIEKINAILSKQDRFEVCKLSDKLVVFAGNTEVE
FT                   FCRWTGDLVSLKHSDLELIKSSPRFNIWRAPTDNDVHIKNEWIKAGFDKLQRRIVNVSF
FT                   EEHSEYFKVQTTSVYGAYSVKPVFEVTTSYKVFKSGIVETNVYAQALRQLPPLPKIGLQ
FT                   FMMPKEFEYVKYYGRGPHENYPDIKQSATVEIYDMAIKDMYVPYIMPQEYGNRCDVRWA
FT                   FVYNIYGIGLCIRGIPTFNFSAREYTDDVLTKAKHSYELTKADGIVVNVDFKIGGIGSQ
FT                   SCGPGPLEKYLVKDDKFEFCFYMIPVDSNSLDVEKLW"
FT   gene            complement(250141..251583)
FT                   /locus_tag="Calkro_0165"
FT   CDS_pept        complement(250141..251583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45081"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2369"
FT                   /protein_id="ADQ45081.1"
FT                   /translation="MRKKKNRLFTIVSVLLVLVLVIGAYFYVSYVNKKKQEAEEKKSSQ
FT                   TITVTNFDRNKLIKIDIKHDDVHLVLEKVKDKWIVNGINNPLYFDQDKIDDIAFSCAQM
FT                   SAEKIADSNPKDLKKYGLDNPKSVVEATFSDGKKVTFYLGSETPITSTYYLMKKGDPKV
FT                   YVVWTNHAENFTIKPQKLLSVKIPEIDTQNITYVKLVRKGQPTIEIKKVDEKNKEDNEW
FT                   KYYVRLWNLVQPYSQPVGVASDKFSEFIENVPNFSPEDIVGEDVYNPKYGLESPKIELI
FT                   VKDNKNTLHLFVGNSASDSTVYCKMANSKVVFTMSTYKTDFMNTVKPFDLIEKFAYIVN
FT                   IDYVDKIEIFTPNKKHTLILDKKLIKKATSEEESDEYKYNFQADGRKIDEDTFKKFYQE
FT                   IIGLLIDGENDKKPAGTPEVTMKFYLVNKKVDVMQYIPYNDDFYMVVRNGKSDFVIAKE
FT                   QVQKVLKDLEDLVAGKYKPPES"
FT   sig_peptide     complement(251482..251583)
FT                   /locus_tag="Calkro_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.422 at
FT                   residue 34"
FT   gene            complement(251580..253037)
FT                   /locus_tag="Calkro_0166"
FT   CDS_pept        complement(251580..253037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0166"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterised transport system;
FT                   KEGG: ate:Athe_2368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45082"
FT                   /db_xref="GOA:E4SCU9"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCU9"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADQ45082.1"
FT                   /translation="MVKFDIKNILGSFKSRKFKFGGYAAMLTASVIAIVIVLNLLVGQI
FT                   PAKFDLTHNRLYSLSKPTVELLKNLKKDVTIYALFQSGNENPVISEFIQKYADKSSHVK
FT                   IKYIDPYKNPGFVKKYDTSGSGIDEGSLIVESGNKFRVINRYDMVDYSYDEQTGNTNVT
FT                   GLTIEQKLTPAILYVTSEKTPIIYELKGHGEDTFIGLGISSEVEAANFEIKDLNLLTEK
FT                   SVPQDASAVVVISPKTDISDIELKKLKDYINGGGRVLFLMDLLKDELKNFNSIFESLGV
FT                   RLEHGIVMEGDNTKNAGNPVWILPNLESHDITNPIDLNNMYMLLPSAQPIVETKFKKRT
FT                   ITIEKLLTTTSNSWLRKDLNSTSLSKEKGDISGPFTLAVAITDKADSLNAKLRPRDAKV
FT                   VIVGSAMFANSQFSKNIPGNLNFVVNALNWLQDKKDTLQIQPKDLTTFRLNLSTSQAMI
FT                   WAAITVVGIPVLILILGLTIWLRRRHL"
FT   gene            complement(253054..253917)
FT                   /locus_tag="Calkro_0167"
FT   CDS_pept        complement(253054..253917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45083"
FT                   /db_xref="GOA:E4SCV0"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2367"
FT                   /protein_id="ADQ45083.1"
FT                   /translation="MSAVLKKELKIYFSTPTGYIFMGFFLLISGFFFAVSNLFSASPNY
FT                   TSVLGNITFIFLVVVPVLTMRLLSEEARTKTDQLLLTSPLKLTEIVLGKYLAAVGVFVL
FT                   TIAITILYPVILSFYGDVPFGETVGAYIGFFLLGCAFISVGLFISSLTENQFVAAVVTF
FT                   AALLLTWVIDWLESALPTDRTAGFVFVLILVGLVAGWLYMTLRNIIISAISGIIGAGAF
FT                   IAVYILKPDFYDNAIVRFFKWFSLLSRYQKFTNGLLDLSSIVYYLSFIFVFIFLTIRVL
FT                   EKRRWS"
FT   sig_peptide     complement(253795..253917)
FT                   /locus_tag="Calkro_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.752 at
FT                   residue 41"
FT   gene            complement(253914..254867)
FT                   /locus_tag="Calkro_0168"
FT   CDS_pept        complement(253914..254867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0168"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0366 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45084"
FT                   /db_xref="GOA:E4SCV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45084.1"
FT                   /translation="MIKVEHLTKKYGQHYAIHDISFEVQKGEIVGFLGPNGAGKSTTMN
FT                   IITGYLSPTEGTAYVDGFDILEEPEEVKKRIGYLPENPPLYMDMTVQEYLDFVSDIKKV
FT                   DKKEKKRSMDKIMETVGIAHVRNRLIKNLSKGYKQRVGLAQALIGNPPVLILDEPTIGL
FT                   DPKQIIEIRSVIKNLRSEHTIILSSHILPEVSAVCERVLIINKGKIVASDTPENLSKRL
FT                   THGSKLQLRVLGQRQKVYGILEKVPGVKYIEFIGPKEPNTVEVIVESENDIDIRADIFY
FT                   ALSEAKLPILMMRAVDLTLEEIFLQLTTEEKEAEAV"
FT   gene            complement(255051..255614)
FT                   /locus_tag="Calkro_0169"
FT   CDS_pept        complement(255051..255614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0169"
FT                   /product="Nucleopolyhedrovirus P10 family protein"
FT                   /note="PFAM: Nucleopolyhedrovirus P10 family protein; KEGG:
FT                   ate:Athe_2365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45085"
FT                   /db_xref="InterPro:IPR008702"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV2"
FT                   /inference="protein motif:PFAM:PF05531"
FT                   /protein_id="ADQ45085.1"
FT                   /translation="MSDREILELILEKVTVVDQKVDRLEKRLENLEKRVENLEKRVENL
FT                   EKRVESLEKKVESLEKRVESLEKRVENLEKRVESLEKRMDALEARVERLEIQVSENTQI
FT                   LKALEHLAQVNKAEHDNFTHQLARIEGLLTSEINKNNQEHQVIISKVEENSEKITRLEK
FT                   DMVVIESVCGKNMQDIAFLKGIKN"
FT   gene            complement(255685..256692)
FT                   /locus_tag="Calkro_0170"
FT   CDS_pept        complement(255685..256692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0170"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: ate:Athe_2364 sodium/calcium exchanger membrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45086"
FT                   /db_xref="GOA:E4SCV3"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV3"
FT                   /inference="protein motif:PFAM:PF01699"
FT                   /protein_id="ADQ45086.1"
FT                   /translation="MVAGYVLKLIISLFVILLGCTFFTNAVECFGKKLNLADGAVGSIL
FT                   AAVGTALPETIIPIIAILFAKGESSHQVGIGAIAGAPFMLGTLAFFITGLAVIVYTLLK
FT                   KRTLKMNVDLSVFERDLTYFMIVYGIAVATTFIQNHKLIRTIIAIILFVAYLIYVKKTL
FT                   ADESENEETQELEELYFTKLLKLPNNLLWISAQLILSLAIIIFGAHLFVEYVQKVATLI
FT                   GISALVLSIIITPIATELPEKLNSVIWIGKKKDTLAIGNITGAMVFQSSVPVVFGIIFT
FT                   PWNLKGITMVSAILAFSSAVLNLLWVKIRKNVNPFALLFGGVLYLIFIAYVFWR"
FT   gene            complement(256804..259461)
FT                   /locus_tag="Calkro_0171"
FT   CDS_pept        complement(256804..259461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0171"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="KEGG: ate:Athe_2363 calcium-translocating P-type
FT                   ATPase, PMCA-type; TIGRFAM: calcium-translocating P-type
FT                   ATPase, PMCA-type; ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45087"
FT                   /db_xref="GOA:E4SCV4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV4"
FT                   /inference="protein motif:TFAM:TIGR01517"
FT                   /protein_id="ADQ45087.1"
FT                   /translation="MNQNFSDFHSKTVETILENLKTSLNGLSYQEAEERLKVYGKNVIE
FT                   EGKKKSIFALFLEQFKNVMVLVLFAAAIISILLGEAADAAIILAVLLINAVFGVAQELK
FT                   AEKAIDALKKLNMPYAKVYRDGHLMQIKTDEIVVGDIIEIEAGDIVPADLRLIESFNLK
FT                   IDESALTGESVPVEKNANDLLAESTPLAERTNMAFMGTIVTYGRAKGVVVSTGMKTEIG
FT                   KIANFVNLQSAIDTKTPLHEKLEEIGKYLTVGILAIAFIVFVTGLLYKRDVFEMFLTAV
FT                   SLAVAAIPEGLPAVVTIVLAIGVQRMAKRNAIIRRLSSIETLGRVEVICSDKTGTLTQN
FT                   KMNVVKVYCNDSLVENLEHEDIVAKTLLRIMALCNDVKLDLVDKQPQFIGDPTEIALVK
FT                   FAYEKGLNKNAIEKVFKRVYEIPFDSVRKMMTTVHEVKNDEKLLVFSKGAVDVIINKCK
FT                   FIMVNDEILPLDENTHQKILQANKEMTSNALRVLAFAYKEIDKNELENKNTIEDNLIFI
FT                   GLVGMIDPPRKEAYGAVEVCYQAGITPVMITGDHKDTALAIAKELKIIDTSKDELSQVL
FT                   IGTEIEKLDDQQLKEKVKEVRVYARVSPEHKLRIVDAWKSHGKIVAMTGDGVNDAPALK
FT                   AADIGIGMGITGTDVTKNVSDVILADDNFATIVAAVEEGRKIYDNIRKTIQFLLSSNIG
FT                   EVVTLFLATLLNWVVLYPIHILWVNLVTDTFPALALGMEKAESDVMKRKPKKTSENIFA
FT                   GGLGFSILYQGFLKGLITLLVFFIGNKLYGHKTAITMTFMTLSFIQLTHAYNVRSNINS
FT                   LFKMGVFSNKYLNLAFVASFLLQVVVLIVPPLRELFKLSYLNFSQWTIIILASLSIIPI
FT                   VEVVKYFTRHFHKE"
FT   gene            complement(259813..260136)
FT                   /locus_tag="Calkro_0172"
FT   CDS_pept        complement(259813..260136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0172"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ate:Athe_2362 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45088"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADQ45088.1"
FT                   /translation="MPKRNIKEQPTLFGDPGFSSWGIVYYKKGQKNIVEKHMHDCDEYY
FT                   FVLEGKLKVISEDKEYILEKGDMLWTKMGDFHEIVEALEDTTMFWLEGPLMGKKRKGHQ
FT                   YEP"
FT   gene            260505..261599
FT                   /locus_tag="Calkro_0173"
FT   CDS_pept        260505..261599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0173"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   ate:Athe_2361 glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45089"
FT                   /db_xref="GOA:E4SCV6"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV6"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADQ45089.1"
FT                   /translation="MLREGQVRIPSGCAISGFINKKGVRISGTDIINSIAIMKERGNGL
FT                   GGGFAAYGIYPDRKDWYAFHLFFDDIKAKEDTEHFLNQNFEVLESEVIPTRKVSSIQNA
FT                   PIVWRYFVKPLEKRLRDTEKTEEDFVVDSVMFINSQIDGAYVFSSGKNMGAFKGVGYPE
FT                   DIGEFFRIDEYKAYIWTAHSRFPTNTPGWWGGAHPFTLLDWSIVHNGEISSYGTNYRYL
FT                   EMFGYKCTLRTDTEVMAYLFDLLLRKHKLSVEIAAKALAAPFWSVIDRQDEHEREKLRA
FT                   IRAVYASCLVNGPFSIILGFSNGILALNDRIKLRPLVAAQKGDFVYVASEEAAIREICK
FT                   DPEKVWMPKGGEPVYVTLDEGVIV"
FT   gene            261596..263104
FT                   /locus_tag="Calkro_0174"
FT   CDS_pept        261596..263104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0174"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="KEGG: ate:Athe_2360 glutamate synthase (NADPH);
FT                   PFAM: ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45090"
FT                   /db_xref="GOA:E4SCV7"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV7"
FT                   /inference="protein motif:PRIAM:1.4.1.13"
FT                   /protein_id="ADQ45090.1"
FT                   /translation="MISLYENEFEVVRDETKCIRCKVCVRQCANEVHEYDEEEDRVVAD
FT                   SSKCVACHRCVVMCPTKALTIKKTENAFKENANWTPSYINEIYKQAETGGILLTGMGND
FT                   KPIPIYWDRLLINASQVTNPSIDPLREPMELKTFIGRKPDKLEFDENGNLKTKLPPQLE
FT                   LEVPIMFSAMSFGSISLNACESLAAAAVEVGTYWNTGEGGLHQKLYKYKERAIVQCASG
FT                   RFGVDVDYLNAGAAIEIKIGQGAKPGIGGHLPGEKVGEEVSRTRMIPIGSDAISPAPHH
FT                   DIYSIEDLRQLIFALKEATNYTKPVGVKIAAVHNVAAIASGIARAGADFITIDGVRGGT
FT                   GAAPLRIRDNVGIPIELALAAVDSRLREEGIRNQVSIIVAGSIRNSADVVKAIALGADA
FT                   VYIGTAALISLGCHVCQKCHTGKCNWGIATQDPVLVKRLNPEIGARRAANLLKAWSHEI
FT                   KEMLGLMGINALESLRGNRLMLRAVGLTEKEMEILGVKHAGEGV"
FT   gene            263108..263575
FT                   /locus_tag="Calkro_0175"
FT   CDS_pept        263108..263575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0175"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ate:Athe_2359 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45091"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2359"
FT                   /protein_id="ADQ45091.1"
FT                   /translation="MAKKIFPKEDVCVGCHLCEVYCVYAHSKYKKPNIKAHELVKLYIK
FT                   HKDSKPTPKILIEEKSGTWTTFALQCRHCDDAPCTKACITGAMKRLEDGRIICDEEKCV
FT                   GCWSCIMACPHGAVRRGENKKAASKCDLCLELGEPACVKNCPNEALEVKEV"
FT   gene            263597..264865
FT                   /locus_tag="Calkro_0176"
FT   CDS_pept        263597..264865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0176"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ate:Athe_2358 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45092"
FT                   /db_xref="GOA:E4SCV9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCV9"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADQ45092.1"
FT                   /translation="MKYVIIGNSVAACGCIEAIRKVDTQNPIVVISDEKYRVYSRPLIS
FT                   YYLGGKVDESKMYIRDEDYYEKNKVETKLGKKAVAVDFKSREVILDDGEKVKYDKLLIA
FT                   TGGKPFVPPTKGFELKNVFTFIKFDDVKAIDEAIKSGAKKAVVIGAGLSGLKAAEALIK
FT                   RNLDVTVVELANRILGSILDLEASRIVQSELEKHGIVFKLETSVDEIIGDGKVEKVKLK
FT                   NGEVLDCDIVVFAIGVVPNIDFLKGTELKINRGIVVNNKMETNIQDVYAAGDCAEGYDF
FT                   VFEQQRVIPIWPNAYNQGETAGYNMAGVERTFDRGFPMNSIGFFDVHMITAGIVVPNSD
FT                   DIEVLVKHDKEKNAYRKIYLKNGRVVGFMFINSIDRAGMITNMIKEGFNVESIKHRLLD
FT                   EDFGYLDLPKEIRQEKILGGAKA"
FT   gene            264867..265619
FT                   /locus_tag="Calkro_0177"
FT   CDS_pept        264867..265619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0177"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: ate:Athe_2357 glutamate synthase alpha
FT                   subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45093"
FT                   /db_xref="GOA:E4SCW0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCW0"
FT                   /inference="protein motif:PFAM:PF01493"
FT                   /protein_id="ADQ45093.1"
FT                   /translation="MNLHKLTIDAKGIHYKELNEMIENALNEGYKEVDLINVNGQRYIG
FT                   DGLTFPDRKLNIYGTPGNDMAAFMNGLTIEVFANGQDGIGNTMNAGKIIVHGSAGDIIG
FT                   YGMRGGEIFIKGDVGYRVGIHMKEYQDKIPVLVVGGKAGDFLGEYMAGGRIIVLGLTLK
FT                   DGEPITGLYCGTGMHGGIMYLRGEVQTYQLGKEVKVVDMEDEDYKFIDKYITEFVKLFG
FT                   YSKEYIMSKPFYKLIPYNKRPYGKLYAY"
FT   gene            265716..266207
FT                   /locus_tag="Calkro_0178"
FT   CDS_pept        265716..266207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0178"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: ate:Athe_2356 metal-dependent
FT                   phosphohydrolase HD sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45094"
FT                   /db_xref="GOA:E4SCW1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCW1"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADQ45094.1"
FT                   /translation="MDSIDLIALEMIKYFKNDVRRINHALKVFSFARLIGKAEGLDGKK
FT                   QYILEAAALLHDIGIKVCEQKYGSTAGHLQEIEGPEVAKEILSHIDVEKDKIERILFLI
FT                   GNHHSYSKIDDIDFQILVEADFLVNIHEDSMDVETIKSIKHKYFKTKMGLFMLEKMFEV
FT                   "
FT   gene            266305..267873
FT                   /locus_tag="Calkro_0179"
FT   CDS_pept        266305..267873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0179"
FT                   /product="L-lactate permease-like protein"
FT                   /note="KEGG: ate:Athe_2355 L-lactate permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45095"
FT                   /db_xref="GOA:E4SCW2"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCW2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2355"
FT                   /protein_id="ADQ45095.1"
FT                   /translation="MDLFLSVLPILLVLFLLIFAKKTADVAGLVGWVATALIAILYFKT
FT                   SFDVVLKSSIMGFLAALPVSLVVVTSILQLNVMESAGAMRRIIVFVKGLSKDDKVFQAL
FT                   ILNVGFGTFLAATGAVPVTVLPPILIGLGYSTFAAIALSAVGFDALCTYALLGTPLVVF
FT                   SQIANVDLITAARYFLPFVGVVSFTISLAMLFIIGNSKFVKRGFVPAIIVGLTSYAAAE
FT                   LAILVKAPVITGIFAGILIMLVMMVILKLLGKRVYDSSHFTEEDRKVEKTMGIIKATSP
FT                   WILLVVFILITNLITPIREFLYDKLSMPIEVMKGPKIKPIFTRVIWQSYTWILLSTIIS
FT                   IFIFKMNGKQLKSVWEKTKSRIPKPFWSSTVFFLMAYVMMYSGYQKTQNGYELLKRTHN
FT                   IVYVLAEYSAKGFKNIYAFIAPYLGILGGFITGTETSTIAMFAKYTIETSNLLELSPLL
FT                   MVAAVAFGGGLASGISPSKLQNAAAAIDAIGAESKVLRTTLVISLIMAFITGIISFLLR
FT                   GYAIQ"
FT   gene            268011..269450
FT                   /locus_tag="Calkro_0180"
FT   CDS_pept        268011..269450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2764 protein of unknown function
FT                   UPF0236"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45096"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCW3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2764"
FT                   /protein_id="ADQ45096.1"
FT                   /translation="MTENIVSKIEELLKTFEEGLEKIVKREKDLAEYSIELKKQLDLIG
FT                   KEMIKEVCELIDESLKVNEERKKRYEVVRRDKRGLKTIFGDIEYERTYYKDKEGKGYVY
FT                   LVDIVLGIERYQRIDNAVKGAIIERVVDMSYEKAAKEVLGEDRISRQSVMNILKGIDSK
FT                   ELDEIQHSKSVRGEKKVVKELYIEADEDHISLQNGKKEIAKLAYINTGYKEEKGVVIRK
FT                   ELKDLHYFSSVKEDADDFWAKVGKYIEENFEVEKIENIYLLGDGANWIKKGLEWIDGAE
FT                   FVLDKFHLTKEIMKIAGGDRKLFNEILKALREKDRERFEALVKEKMEEVKEDELAKRRI
FT                   KKGRRYILSHWDNIVLEAANVNIKGCSAEGHVSHVLAERMSSRPRGWSEDIAETMVKLL
FT                   SLKYNGFELMNVYLEKIKAKKAERQEVKEIAKGIIKNGKRVRKGTEKWNNIPVIANGKV
FT                   NQLRRALKSLISCSFYNAGMF"
FT   gene            269679..271991
FT                   /locus_tag="Calkro_0181"
FT   CDS_pept        269679..271991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: csc:Csac_0586 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45097"
FT                   /db_xref="GOA:E4SCW4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E4SCW4"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADQ45097.1"
FT                   /translation="MSIEKKVQELLQKMTVEEKVYQLTSVLVQDILENDKFSPEKAKRL
FT                   IPHGIGQITRVAGASNLSPDEAAKTANEIQKFLVENTRLGIPAMIHEESCSGFMAKGAT
FT                   VFPQSIGVACTFDNEIVEELAKVIKTQMKAVGAHQALAPLIDVARDARWGRVEETFGED
FT                   PYLVANMAVSYVKGIQGDDIKDGIVATGKHFVGYAMSEGGMNWAPVHIPERELREVYLY
FT                   PFEVAVKVAGLKSIMPAYHEIDGIPCHANRKLLTDIARGEWGFDGIFVSDYAGVRNILD
FT                   YHKAVKTYAEAAYISLWAGLDIELPKIECFTEEFIKALKEGKFDMAVVDAAVKRVLEMK
FT                   FRLGLFDNPYIKTEGILELFDNKEQRELSRKVAQESMVLLKNDNFLPLSNDVKKIAVIG
FT                   PNADSVRNLLGDYSYPAHIATLEMFFIKEDKGVGNEEEFVRKVINIKSILEAIKDRVQN
FT                   KAEVVYAKGCDVNNQDESGFEEAKKAAQGADVVILVVGDKAGLRLDCTSGESRDRASLK
FT                   LPGVQEKLIEEVSKVNENIVVVLVNGRPVALEGIWQKAKAILEAWFPGEEGAEAVADVL
FT                   FGDYNPGGKLAISFPRDVGQVPVYYGHKPSGGKSCWHGDYVEMSTKPFLPFGYGLSYTT
FT                   FEYKNFAIEKEKISMDESIKISVEVENTGKYAGDEIVQLYTRKEEFLVTRPVKELKAYK
FT                   RVHLKPGEKKKVVFEIFPDQFAYYDYDMNRVISPGTVEVMVGASSEDIKFTGTFEIVGE
FT                   KKDAKEIKNYLSRAWCE"
FT   gene            complement(272045..272248)
FT                   /pseudo
FT                   /locus_tag="Calkro_0182"
FT   gene            272381..273856
FT                   /locus_tag="Calkro_0183"
FT   CDS_pept        272381..273856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0183"
FT                   /product="transposase IS4 family protein"
FT                   /note="manually curated; KEGG: pjd:Pjdr2_2483 transposase
FT                   IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45098"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD34"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_2483"
FT                   /protein_id="ADQ45098.1"
FT                   /translation="MVFKEYNPNQLIMPIDPESFIPQTHLVRIIDKIIDKIDTSHIVQK
FT                   YKGGGTSSYHPLMLLKVLIYAYIQGIYSSRKIAKALEENITFMWLSKLQTPDFRTINRF
FT                   RKEIIFDCIEGIFAEVIELLVKLWYVNFEYYYLDRTKIEANASKYTIVWTKSTRTYKKK
FT                   LREKVKNIFDEIERINEEEDRTLGELDVGLEADYDSKELEQKVEKLTQKLAKASFENKR
FT                   KERRVKKLVKLRLKKYESYEQILNGRNSFSKTDNDATYIEDEGRPYEKWELKAGYNVQI
FT                   GTQNQFVIGFSIHQSSTDTVCLKEHLELVEKIIRHKPKNIVANSDYGSEENYLYLKKCG
FT                   INSYIKYNTFDLEQTRRFKKDIFKVKNWEYIPEEDIYICPAGKRIKYLYSKVSTNERGF
FT                   VSYEKVYQCEEICNGCKYRDRCYNGKRWKKRFSVRLRIEKLKEEVRQRLLSEEGKKIYR
FT                   KRKIEVETVFGIIKNNKGFRRFLLRGLKGVKLK"
FT   gene            274586..274795
FT                   /pseudo
FT                   /locus_tag="Calkro_0184"
FT   gene            275172..275288
FT                   /locus_tag="Calkro_0185"
FT   CDS_pept        275172..275288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45099"
FT                   /db_xref="GOA:E4SD35"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ45099.1"
FT                   /translation="MIIKKQNKNKQGCIKIGVLGACATVGVIAEKNGINMRL"
FT   sig_peptide     275172..275261
FT                   /locus_tag="Calkro_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.680 at
FT                   residue 30"
FT   gene            275452..275559
FT                   /locus_tag="Calkro_0186"
FT   CDS_pept        275452..275559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45100"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ45100.1"
FT                   /translation="MLIVKSNKRKAGCIYIGAPLIGCKTIGSDIRGIRI"
FT   gene            275601..275720
FT                   /locus_tag="Calkro_0187"
FT   CDS_pept        275601..275720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45101"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADQ45101.1"
FT                   /translation="MLLAKKKTKKSSCIEIGVNGICKSVGKTIAVVWGIPIKL"
FT   gene            275782..277074
FT                   /locus_tag="Calkro_0188"
FT   CDS_pept        275782..277074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0188"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   csc:Csac_0653 arylsulfatase regulator (Fe-S
FT                   oxidoreductase)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45102"
FT                   /db_xref="GOA:E4SD38"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD38"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADQ45102.1"
FT                   /translation="MEVFKISENSLIYFVDDIPFIGNFELGSVIAFNEEGYNFLKRILK
FT                   KDTISFDEFTQEEKNWFSTLLECEILKSLNSSSTLITNNEIDAIYLHFTNNCNIYCKGC
FT                   YSFNKYRNKEDFDLSVDVFVDSIKQLKNYGLKRVIISGGEPTLRDDLEVLLREIKNISI
FT                   EYVCLITNGIYFPEKLINVVKECVNEVSVSIDGYNENISYIRPAWIYNRVIDTIRVLKE
FT                   NEINVSMIVTLHRQNVGVMNEYKLLSEKLGVPFSYSILVCNNNNRDECKEFEFDDNSLY
FT                   KIKWDQDIENTKIENFEFETRLSCEAGKRLLSIAANGDVYPCHMLHDEFFKFGNIKDMA
FT                   IPEILMSASRLLFKFITVDFIKECNACKFRYLCGGGCRANAFYKNSDVLSKDPYCSMYY
FT                   NFYNTILSLLRQQNLEHANTSKEELNEEQAT"
FT   gene            277055..277732
FT                   /locus_tag="Calkro_0189"
FT   CDS_pept        277055..277732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0189"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   csc:Csac_0654 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45103"
FT                   /db_xref="GOA:E4SD39"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD39"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADQ45103.1"
FT                   /translation="MKNKLPDVKKVRQLYPIYLHLYIEICGLIFIPFVLYIGWLMILTI
FT                   VASKPFTEEMNYSSLKDLMFQYSIPFSIFFGIFPMFYVLFFKRLKLKEINVLPNKNKWY
FT                   IFSVVLLIIMSACVILYVKQKLSTELFLILIIHNFFVAFTEELLARGIILSLLLKSMRP
FT                   IASIILNGIIFAFVFHSAADFTINLLLRLPLGILLAFLSYWTRSIHPSILLHWMYNVGV
FT                   EFL"
FT   gene            278864..279088
FT                   /locus_tag="Calkro_0190"
FT   CDS_pept        278864..279088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tan:TA20725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45104"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD40"
FT                   /inference="similar to AA sequence:KEGG:TA20725"
FT                   /protein_id="ADQ45104.1"
FT                   /translation="MHLPSLNLGHRASPFKAQRAIFTLTFAFKFKRLVELFTDGDTIFR
FT                   IGSEEGESELNRGSKAKGIPRAHVYYSKF"
FT   gene            complement(279071..279737)
FT                   /pseudo
FT                   /locus_tag="Calkro_0191"
FT   gene            279909..281612
FT                   /locus_tag="Calkro_0192"
FT   CDS_pept        279909..281612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0192"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0655 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45105"
FT                   /db_xref="GOA:E4SD41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD41"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45105.1"
FT                   /translation="MKQDMMWLISKLKRFWKLGLLCIICQILYIALIEIAPIVSMILIE
FT                   ALIHKFQSRVIYRSLIFFTLVWILQPIMWYTVSVLTINLSENIKESLRNSCFESFISSS
FT                   TINFIQNNSMGTMVTRISEDVEEIGNFTQNLILNFTKNLLIATISMIVMLSIAPLLTVI
FT                   FFIVFGILSLFILKKSNQLSGLQNDLQQVIDRMNTFLPNIIRNIIPIKVCNAQSLINEQ
FT                   FQITNKEIKMKTIKLLKNLTLMSMYAATVAVLVIVIIYAGGSIYILSGKGTVGILVALT
FT                   MYFQNFVGAVNELFDGGIELRRISPLIMRLNELLNDKNTANSEIRMFDEELNTSILLNC
FT                   DKYNLQVKDVWFKYNDSDYILKGVNLYAEEDTVVAIIGESGAGKTTLLKLLLGIYLPEH
FT                   GEITLCGNNINQISNNKLWKLVSYIPQEVDLIYGLSIKENITLEKAIELKREVVELCQW
FT                   LKIEKKILSLPLGYDTLYTEEVNFSGGEKQRIVIARELLKGAKIFIFDEPTAWLDEENE
FT                   KRFFEIIQELKKGRIIIMVSHKKITLEYADIVYVLENGVLKPTIPVNKNL"
FT   gene            281632..282075
FT                   /locus_tag="Calkro_0193"
FT   CDS_pept        281632..282075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45106"
FT                   /db_xref="GOA:E4SD42"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD42"
FT                   /inference="similar to AA sequence:KEGG:Csac_0657"
FT                   /protein_id="ADQ45106.1"
FT                   /translation="MKRSVYIFAFLAIVYEIFVGTLLTLKRENISLSEYWGWGLSVIAM
FT                   VAILGLLNGIFGGEKLSNILAINIFAVIIINLISAMFTPLILTEDVKQKLLKEATQKNI
FT                   ELSLGNNMGNIISGIMLYSVIVALMTFAGFKISAILRKKLKRN"
FT   gene            282142..283743
FT                   /locus_tag="Calkro_0194"
FT   CDS_pept        282142..283743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0194"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   csc:Csac_0658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45107"
FT                   /db_xref="GOA:E4SD43"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD43"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADQ45107.1"
FT                   /translation="MRIKKGMSLFVFLIVCVVTLMVVYVFTNSIKKQQQAEKIQNKNVI
FT                   KVVKKDLYEEITLRGIVTSEEKPIFSSTTAKVKSVFIRDGDYIKKGDLIAFMDDTSVRL
FT                   ELKKKEREKQSLYRDLENLYARLGECSVYSPFEGQVAEIYVKERDIISKGSPICKVVKT
FT                   DVVYLTVAFPRWLFNNINQGDPIEVVVPEYGQEIKGYIRAKSSIFYTDENGFPAFDVEV
FT                   ILKEKGIPVKVKAYCIFRYNGQKVRSLNEGIITPEEDIIKSPTDGVVKNIYISKFSLLN
FT                   KNQLIVELSNDEILEQIKNKKAQIEQITEEINEYRKKLSMFVIKAPLEGIVSDINIVEG
FT                   KLLNEGEKIFVIWNPSNLIFESKISELELDRIKKGQKVTLQFKIPGRIGVNETVNGTVK
FT                   LIGSRPLEESLDANISFYSIKIGFKSNRIKRGMHATAQMKVFLKQNALCVPVEALREEN
FT                   GKYYVWVKQQKPKNISENTGKDKIIDEFGSKESYYEGAEKREVVIGESNKWYAEILSGL
FT                   KEGEEVVLPRIYEEVK"
FT   gene            283768..284964
FT                   /locus_tag="Calkro_0195"
FT   CDS_pept        283768..284964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0195"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   csc:Csac_0659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45108"
FT                   /db_xref="GOA:E4SD44"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD44"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADQ45108.1"
FT                   /translation="MKYAKFFEAFKIAAKSLIHNKTRTFLSILGVIIGTCAIIVSVGLV
FT                   QSVSISVSKQLEESGLDSLILVLNYDIDMSEMYSYLNSKQNLVVGITPKKTYYTEVLSY
FT                   DGKKYKCEVLLLKPSSYILENLKLVEGRFLSGLDEEKLNKVAIVFKDQAEKLFNNKEEV
FT                   LFKKLLIGGEEFEVIGTVTKQKRMTDVSIGTSYYDINIIIPYKVGESLFNLEKSSQMFF
FT                   IKSINSKYNSNIKKLLEEYLRNNGLNKEDYSIIDGREFVQSITTISYLLSGLLSGVASV
FT                   SLIVSGIGIMNIILVSVTERTKEIGIRKAVGAKSSDIRLQFLIESFLISTLGCFVGIAF
FT                   GLIIVYGVIPEVMMVEAHISPIWIIISMAICYLIGLFASWAPAERAARLDPIIALRYE"
FT   gene            284994..285680
FT                   /locus_tag="Calkro_0196"
FT   CDS_pept        284994..285680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0196"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_0660 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45109"
FT                   /db_xref="GOA:E4SD45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD45"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45109.1"
FT                   /translation="MIELYNISKIYKMGDNEVYALNGVTLKIQKNEFVAILGPSGSGKS
FT                   TLMNIIGCLDTPTSGSYILDGNEVSKLSDNQLAEIRNSKIGFVFQQFNLIPQLTALENV
FT                   ELPLIYQGVSASKRHKLAKEALEKVGLGDRLHHRPRQLSGGQQQRVAIARALVTSPSII
FT                   LADEPTGNLDSKSGSEIMQIFKQLHSQGSTIVLITHDNNIASQAKRIVRIHDGQIVEDT
FT                   CLTYIF"
FT   gene            285707..288865
FT                   /locus_tag="Calkro_0197"
FT   CDS_pept        285707..288865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0197"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   ate:Athe_2295 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45110"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD46"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45110.1"
FT                   /translation="MKLKVLISFLIVAWVVNLLSLTPFAAYKDIPSNANYKLDVERLNK
FT                   LGILVYKDNFKPNQPITRAELAQALVKISNAEDDAISQKKYTLFSDIKPNTNLCGFVTW
FT                   AVSKKYLTPMADGNFHPGEPATFSQVVTALVRVLGYSDTDIGGVWPQNYIDKAKQLGLC
FT                   EGLNFSADSKVSRWAFAKMLSYLLDTQPKGSTAKFHEAVGLYSSILVLDTSKTSSKLLS
FT                   GEVLTDSGVLVNTTKTSLDSGIKYMVKVQDGKITKVFGQETDSYQVAITKVNGKTVYFS
FT                   EGGKKKSINLPASATYFISGAKQSYDAIENVLKPNQKISFVYSFDRNKIEYVVINDLYL
FT                   QNIYGNYDEVLILANSNTTSSLSTNQIQTDKGIFYLASGIKPNSIQIGTKYGVYIKDDT
FT                   ITKVAQKIWDVKKYTIKSIDSNVIEVDQNGKSQSMTLLSKPAYYYQGIKRSYDSISNIL
FT                   KEDQILYVSKDIDAGKVMAYIIQDPYSTKYGTYSEVIVLQDALLNSALENNQVLTDKGI
FT                   YNLADTNTKLEIGSKYAVYIKDDRITLVVKKLNSTDVYEVTDVVSSTNVKLKSQKGQEN
FT                   VIMPQKPVYYYNGSKINYSNLKSVLKSGQKVYFGYSKDGKTCEYIAIQDPYLSDYGTYT
FT                   EVVVLANAVVSDKLSSNEVLTDKGIYAIKPAAGKLTVGAKYGVYINGDTITKVVKKLNS
FT                   VDIAEISQVIGDTNVTLKKGNTTTTTSLPQKPVYYYNGNKVDYSNLKNVIKAGQKIYFG
FT                   YNAAGNSYEYAIIQDPYYDSYGKYIETVVLGTYSTTKGLDVNEILTDQGILTLPENQST
FT                   NLELGAKYGLYIDQDNQITLVFKRLNSTDDMTVVSAISNKVTVDKGGTQVDMILPQNIT
FT                   YYYNGSKIDYSTALSKIQMLSSLVFGISTKKKGYDYCVVFDPVYSKPYIAGDQTYQTLK
FT                   VGDLDISGSRKFIKDGDVVDYSYIQKYNVVYEVKDIWGRNSYILIVDNKVECYLKSFVP
FT                   TRFTPKSIVVSVYDSATEKLVEKTYEISENCDSSWILSDTFKTSQRVYLLLGYDGKVVA
FT                   ISKP"
FT   gene            complement(289133..289450)
FT                   /pseudo
FT                   /locus_tag="Calkro_0198"
FT   gene            289903..290268
FT                   /locus_tag="Calkro_0199"
FT   CDS_pept        289903..290268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0199"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ate:Athe_2352 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45111"
FT                   /db_xref="GOA:E4SD47"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD47"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ45111.1"
FT                   /translation="MVEFNPNVPIYLQVLEYLKKQIVSGKIRPGEKLPSVREMAQRFNI
FT                   NPNTAQRVFQELEREGLAKTERGIGNFVTSDTKLIQDLKEKMAEKIIEDFILAMKEIGY
FT                   DKEEILNLLNKKLNGEE"
FT   gene            290275..290967
FT                   /locus_tag="Calkro_0200"
FT   CDS_pept        290275..290967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0200"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2351 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45112"
FT                   /db_xref="GOA:E4SD48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD48"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45112.1"
FT                   /translation="MLLEVKNLCKRYNKKIVLDDISFSVDKGKIVGLLGENGAGKTTLL
FT                   KIIAGFSKPTSGQVLINNTRVGVETRRYVAFLPDSIMFPKWMKVKDALKFFVDFFDDFD
FT                   LSRAKDMLEFLNISENGKIHDFSRGTIEKFSIALLLSRNTNLYLLDEPLAFVDPISRDV
FT                   VINMILDNLSEDKTVIVSTNIISEIEHVFDEIIILKDGKIALIDSPENLREKSGVSVNQ
FT                   FFKEGGRR"
FT   gene            290964..291671
FT                   /locus_tag="Calkro_0201"
FT   CDS_pept        290964..291671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45113"
FT                   /db_xref="GOA:E4SD49"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD49"
FT                   /inference="similar to AA sequence:KEGG:Athe_2350"
FT                   /protein_id="ADQ45113.1"
FT                   /translation="MITKFLKHQYRSGTLFYIFYTLGASLVGIWAYYSRNVEVTPKDTP
FT                   KIAIILWLLWFVSLVVAEIYHIFRWNIILTSSERFLLFSSYKLKPEIFLFGEILYFILD
FT                   LFLFTIWINLLGAIVGGLEKYISFHFLLIKKLYVSDFYLLIHAPLSFFIIYLWALTLPT
FT                   YWSTFRRFSKLDYAIISLFVLAIYLNVRLYEFIEKSITSVTMRLIVLLLTDFSIFIALI
FT                   VFNLKALKKGLDT"
FT   gene            291852..292772
FT                   /locus_tag="Calkro_0202"
FT   CDS_pept        291852..292772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0202"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2348 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45114"
FT                   /db_xref="GOA:E4SD50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD50"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45114.1"
FT                   /translation="MKKALEVISVYKKFGRKEVIKGVSFDIEKGRIVGFVGPNGAGKTT
FT                   TIKMITGLIKPDSGQVKIFGYDIVHEREMALKFIGSIIENPELYEYLTGYENLAQLARI
FT                   SNIPKSKIIEVAKLVGIDYALKEKTKKYSLGMKQRLALAMAILTDPKLLVLDEPTNGLD
FT                   PSGIIELRSLLKSLANDKNVTIFISSHNLFEIQEICDKVVFIKEGKIETIENIDSSFIE
FT                   NVKFVLVLNEDRNTNDVVVKTTKVISCFEGVKILGVKENSIELELDRSKKVAFMNFLFQ
FT                   NGVNIKDFYEKVESLEDKYIKIYQN"
FT   gene            292784..293959
FT                   /locus_tag="Calkro_0203"
FT   CDS_pept        292784..293959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45115"
FT                   /db_xref="GOA:E4SD51"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD51"
FT                   /inference="similar to AA sequence:KEGG:Athe_2347"
FT                   /protein_id="ADQ45115.1"
FT                   /translation="MLALVKNELIKLFYRKKIFIAILIIIASAIVGVWGSIAYIKSVQP
FT                   EEEIRSLQKTISQLQKEKSKIKDEVKKQKIDMQIYQLEQQLAQWKSVLESDSNNWRENL
FT                   KKEIKELKIKMNQALDLSFSDSKENYRKEIIENEYYLSHNLKPLKRTDLNNFSVMILFL
FT                   GMIIFMMPLIVFVLSSDIMSNEFSQKTIRILASQPIPRNSIVLSKFLTALIVSEGLILI
FT                   SEVLVYIVTGIIYGFTNLKYPTVIGTIYKEVGKAVVPVYGSSYIITLGKFLILALLLQA
FT                   LIIAACCALSVFISTLCKSNSLANILSFIVVYGIYFLVSPISQVVPAFKYLKMILLYSY
FT                   LDPTKIITNDISVELSISFISPWFSILVIAVYLTIPIATALLNFKNKDILA"
FT   gene            294132..294836
FT                   /locus_tag="Calkro_0204"
FT   CDS_pept        294132..294836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0204"
FT                   /product="TraX family protein"
FT                   /note="KEGG: ate:Athe_2346 TraX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45116"
FT                   /db_xref="GOA:E4SD52"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD52"
FT                   /inference="similar to AA sequence:KEGG:Athe_2346"
FT                   /protein_id="ADQ45116.1"
FT                   /translation="MEKLVLKLKSIPFFSAYSKDLTKSKSNLLKLIACITMFIDHTGFL
FT                   FFPQKPLLRIIGRIAFPIFAYQVAVGFWHTSDHKRYLKRLLIFAIISQYPFYLMTGDVE
FT                   LNVIATFFFAALCLYFFKNSWYILIIIPLGISYFVPMDYGLYGVLAVLTFYYFYKKPIL
FT                   QLVGFSVLTIIFSNLNGWQIQLYSVLSVVLILLVRIIPVNFEFKLNKYFFYWFYPVHML
FT                   FLVFVGKLLGYS"
FT   gene            complement(294887..296104)
FT                   /locus_tag="Calkro_0205"
FT   CDS_pept        complement(294887..296104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0205"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: csc:Csac_2480 IS605 family transposase OrfB;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: transposase
FT                   IS605 OrfB; transposase IS891/IS1136/IS1341 family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45117"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD53"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADQ45117.1"
FT                   /translation="MYKTQKNHIRCNKQTYRLLRILCRVSKNLYNYALYHIRQHYFNTQ
FT                   QYLRYESVYHIVKENKNYRLLPSQVAQQTLLCVDEAFKSFFKLLVAKKEGKTDKKVSIP
FT                   KYLPKDGMFLLSFPKDQFKVEKDKVRLSLGRNFYREFGVRHLYFDLPANILGKRIKEVR
FT                   ILPKFHGRWFEIEYVYEEVTQSYKLDRNKYLSIDLGLDNFAAVVDTIGTAFIIEGGYIK
FT                   SVNRWYNKERARLQSIYSKQGIKYGSKLAKISLKRQHVVDNFLDQAVSLIIKHCLNNQI
FT                   GTIVIGKMKYIKQEINLGKVNNQNFVGIPYEKFKKKLEAKCEYYGIGYKEVDESYTSQT
FT                   CGRCGVVRKSNRKYRGLYVCKNCGYVVNADINGAMNILGKVAGESAAKQIASSGRVNRP
FT                   VRIRVV"
FT   gene            296286..296720
FT                   /locus_tag="Calkro_0206"
FT   CDS_pept        296286..296720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0206"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ate:Athe_2345 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45118"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD54"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADQ45118.1"
FT                   /translation="MREINMEEIKKVVVDILKREISPWLIILFGSLVKGNFRKDSDIDI
FT                   AYLSDKEISNVERFWVSQEIADSLNRDIDLIDLKKASTVLKAQIVGTGEVIYCEDEKRK
FT                   NLFFMRALKEYALLNEERDVVLKSFFGMSIYSKGEKNDNR"
FT   gene            296707..297129
FT                   /locus_tag="Calkro_0207"
FT   CDS_pept        296707..297129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0207"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   ate:Athe_2344 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45119"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD55"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADQ45119.1"
FT                   /translation="MIIDDIIANKIQVIERCLKRIDEEYEHNPKNLLNYTKQDSIILNL
FT                   QRAIEAAIDIAMHLCAVFKFGVPQSSREAFDLLEQNKVVSKELAKRLKAMVGFRNIAVH
FT                   DYQAINLEILKNIIEKNLSDFLEFKGAVLNFLQKRS"
FT   gene            297139..298125
FT                   /locus_tag="Calkro_0208"
FT   CDS_pept        297139..298125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0208"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: ate:Athe_2343 TIM-barrel protein, nifR3
FT                   family; TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45120"
FT                   /db_xref="GOA:E4SD56"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD56"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADQ45120.1"
FT                   /translation="MLDIRGKIFLAPMAGFTDKVFRRLCSRFGADVTVTEMVSSKALVL
FT                   GSAKTKELISFSDEEKIRGVQIFGNDPEVMAQSVKILQDEFEYHFIDINMGCPVPKLVR
FT                   SGEGCALMKNPSLAAKIVEEVAKVSRKPVSVKIRKGFDDENINAPEFAYILQESGASFV
FT                   TVHGRTRAQLYSGKADWEIIRKVKEKLKIPVIANGDIVDFESAKKAYEVTRADSIMIGR
FT                   AALGNPWVFLQIKEGFEKGYVETKVLPHMKIRVAIEFFTQLCSEKGDKMAVLEARKHLS
FT                   FFVKGIENAAKIRDKINRINNATELLEFLKELASSLEKKESFVDNIL"
FT   gene            298167..301199
FT                   /locus_tag="Calkro_0209"
FT   CDS_pept        298167..301199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0209"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   ate:Athe_2342 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45121"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD57"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45121.1"
FT                   /translation="MIKNKMRIITLYRLINWVVLILFFLMLISANIQAAQEYVASSSYS
FT                   KATKNIQIVNLPQNAITRDSFLFLSALGFFNTVARPKINPSDTLSKEEALSVILSSVGK
FT                   QQDAFVRAEKLELKRPSGQKLVKPYNYLYLGYIQLAYDMKILSKKEYQDAMTQVQPSEK
FT                   EHEKMTKQLIKKNDDTIAKAVYEGRPYSYDDLIFVRSAPATRQEVCLWVVKAFKIPIIY
FT                   ENLAKTYPDYDRIDSKFLSSINTLLKNGVLIGRSDGYLHPDDYITYEELAFILGSLKPN
FT                   ILSANGLKEVRLEVKDIRKFNSDKMVLVCEDDNRNDVNITVNPGKQDFGVITDGNFLAS
FT                   SYLQRGDYVAFYVNSKNEVVLASILQRPGQENIKGVISRIDAKKMIFSVKLPDGNVYNL
FT                   SLSPKATIYDSNSGKSLDFSELNVGNLVQVKVQKDRADAITLLSLDSPEIERVQGIISR
FT                   ITKDRIVLSQNGQLTEYLLSPDTVYIDKGDFSRVLSKNDFYEGMKVLAGTVCGYLQYLS
FT                   TTYDEKSEDIVSGILHEVDSNLGYLEIYNQQGEKKSYRFSKKLGLKVKKDGQNSSLDSL
FT                   LPGDVVFLYFNGDFVRTVTASSNLQQKVAKIENVVRNLTSGLPQKIIVNIDGRIYGPYE
FT                   INSDVEVIKNGIPAALKDIMPGQYVKLTGSFFGNSAYIRRIEISGNEYVKNIYIAKGTV
FT                   NGNVLYLSDIQILRNNAFEPLYTWLSFQIPSDLKFILDGSSLAPLSKLQNLPVVVVTKE
FT                   RFSQEVLDTIVAISRGSFTKIQGEVSMTSSNSVVISGNRYSIGNKTYTVANGLLIPASF
FT                   KVGDEIIGIASQGSLILAKQQEGISKPIFVRGQVQDISELEYITVKDYVYLDGQRGWQY
FT                   VPSKLTLFYDTQTVLCDVYGLSSPKEILNLKNKSVYIIHNGKYANVIIDTSFGGYIVTG
FT                   VVGKDMKILNAQYNDMMTQTWNRIDKSFVLDTTQTILLDANGNLRSEALQFGDRVLLLV
FT                   PQNSFDLSKSSMSPAVVLVNY"
FT   sig_peptide     298167..298271
FT                   /locus_tag="Calkro_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.651 at
FT                   residue 35"
FT   gene            301234..302688
FT                   /locus_tag="Calkro_0210"
FT   CDS_pept        301234..302688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0210"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   ate:Athe_2341 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45122"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD58"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45122.1"
FT                   /translation="MLKRFLITVVLVLSIAFIISWQVVFCEEGYLGYEGGISAYKDPDP
FT                   KKTKIEYHEYTFITGKPILLFGTVDAKIKRAANNETLSYNYDLRDSSGKISVKRTVSLK
FT                   GTLTKLQNGSITKEYTVGGYKETITVDSATYNLQSYSFSKSTAVDANPAVSFFQGQWTL
FT                   EKIYDKGLKITIEGKNYGYDGYWGSGEFQKITQRIETSSWFANINYNIALVQKTILEFQ
FT                   QNNLPSSIPGTYVLKSKVEGNFIAMYDLPTFTKTGEVLTIRQRGKVEKNVEKNPVIKMA
FT                   IAPTLPKVKGYEYEDAVNTCFAFGGFDSALDFNPTEYITRAQFAKLLMDSLNIYSNYYN
FT                   PRTVQKKSIYKDVPLNHKYYGYIYAVTKAGLMRGKSAEYFKPEDYMTRAEAAVVISKVL
FT                   GFDKKVTQPITQTDYLDDESIPVWAKDAVKVLKDEKIMVGTEDNNFLPQQKLTKGTAAN
FT                   LIYNLINFLRDTLAKRYLDMSLFSSD"
FT   gene            302763..304181
FT                   /locus_tag="Calkro_0211"
FT   CDS_pept        302763..304181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0211"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: ate:Athe_2340
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; Peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45123"
FT                   /db_xref="GOA:E4SD59"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD59"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADQ45123.1"
FT                   /translation="MRINKKILIKILAVVVALSIFVAVPVYSQFFIISNDFPTDKQMDY
FT                   IKKVLQIAKVYHIEKYSYDELIDMMFTGLFKSLDKYSEYMKPQQAQDFTQSVNGEFSGI
FT                   GVQIEKQEDYIVIVGVFDGTPAKEAGLKVGDKIIAADGKSLVGKTTDDAVKLIRGQEGT
FT                   TVVIDILRDGKTYRFSIVRRKIKIPVVEYKVLDNNIGYIKLTQFTQGCSNDIKKALDEF
FT                   DKKGIKNIIFDIRNNPGGLLDEVVKICEYFVPEGPIVTIEYNGFKDEYKSKNKEAKYRL
FT                   AVLTNESSASASEIFAQAIKDRKVGVVIGTKTYGKGTVQNLIGLPETDTKKGYVAKVTV
FT                   AKYKSPSGYYVEGKGVIPDIEVQDDSLSQFGPDKILSLSATKKYKKGDMDLEVLAAQQR
FT                   LFYLGYLSSWTAKMDDNTVAAIKKFQKDNKLYPYGVLDVTTQKKLNEKFSEFLKSKYVD
FT                   KQLQRAIQYFKMGK"
FT   sig_peptide     302763..302849
FT                   /locus_tag="Calkro_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.946 at
FT                   residue 29"
FT   gene            304362..305381
FT                   /locus_tag="Calkro_0212"
FT   CDS_pept        304362..305381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0212"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: ate:Athe_2339 rod shape-determining protein
FT                   MreB; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45124"
FT                   /db_xref="GOA:E4SD60"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD60"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADQ45124.1"
FT                   /translation="MAFGTDIGIDLGTATVLVYVKGKGIVLREPSVVAIEQTRKQILAV
FT                   GEEARRMIGRTPGNIVAVRPLRDGVISDYEVTEAMLKYFLGKVLGKRVFFKPRVVVCVP
FT                   SGVTEVEKRAVLDATYEAGAKQTFLIEEPIAAAIGAGLDISRPVGCMVIDIGGGTTDIA
FT                   VISLGGAVVSESIKVAGDKFDEAIIRYIRKKHSVAIGERTAEELKINIGCAYKKPRVES
FT                   MEVRGRSLLTGLPKTITVTSDEMLLALEEPVSAIIEAVHRVLENTPPELAADITSTGIV
FT                   MTGGGSLLWGLDKLISEKTGIPTRIADDPVSCVALGTGKALESLDVLEASLIKDPRVR"
FT   gene            305402..306169
FT                   /locus_tag="Calkro_0213"
FT   CDS_pept        305402..306169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0213"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="KEGG: ate:Athe_2338 flagellar basal body rod
FT                   protein; TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45125"
FT                   /db_xref="GOA:E4SD61"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD61"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADQ45125.1"
FT                   /translation="MIRGIYTSASGMILNQKLMDLTANNVANVSTTGFKRDVAQIESFR
FT                   NMLVYRIYDKVTSPDNAIGYMSLGADVSRIVSDFSQGLYIKTDEPLNLAIKGDGFFTIE
FT                   VPENQGAQQIFYTRNGAFTLNSRGELVTLNGFYVLGQNGRIVLQNGGQVRIDEQGNVYQ
FT                   NGRIVDRLRVVDFQDKSLLRKVGNNLYEADATVQQIPFSGKVLQGYLEGSNVNSVQEMV
FT                   NMINVLRAYEANQKAFVIQDETLQKAVNEIARK"
FT   gene            306230..307033
FT                   /locus_tag="Calkro_0214"
FT   CDS_pept        306230..307033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0214"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="KEGG: ate:Athe_2337 flagellar basal-body rod protein
FT                   FlgG; TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   fagellar hook-basal body protein; PFAM: protein of unknown
FT                   function DUF1078 domain protein; flagellar basal body rod
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45126"
FT                   /db_xref="GOA:E4SD62"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD62"
FT                   /inference="protein motif:TFAM:TIGR02488"
FT                   /protein_id="ADQ45126.1"
FT                   /translation="MMRALYSAALGMKAQQTNVDIISNNLANVNTTAFKKDKAEFKDLL
FT                   YETLSRADVVAGDGKPVSLQIGHGVTISAITKSFAEGNLERTENPLDLAIQGEGFFVVS
FT                   TPNGPRYTRDGSFKVSNVEGQIKLVTSDGYPVLAEGDTEIILPETAISSITIDETGRIT
FT                   YKDAEGQVQDSGLKIKIVRFINPQGLLAEGKNLYNVSAASGDPVSEEEMEGQKSRILQG
FT                   FLEMSNVQVVDEMVKLIIAQRAYEINSKAIQTADDMLSMANNLKR"
FT   gene            307058..307408
FT                   /locus_tag="Calkro_0215"
FT   CDS_pept        307058..307408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0215"
FT                   /product="Flagellar protein FlgJ-like protein"
FT                   /note="PFAM: Flagellar protein FlgJ-like; KEGG:
FT                   ate:Athe_2336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45127"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD63"
FT                   /inference="protein motif:PFAM:PF10135"
FT                   /protein_id="ADQ45127.1"
FT                   /translation="MSEVSNIKIQADYQQGIGNSVIDKLEKAYSEKDKQKLKEACEEFE
FT                   SIMLSTIFKQMQKSIPKGGLFKEGIADDIFNDMFVDEVSKNASKQGGIGLSKLLYDSMI
FT                   KRLENEYKFKKE"
FT   gene            307606..308421
FT                   /locus_tag="Calkro_0216"
FT   CDS_pept        307606..308421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0216"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; KEGG: ate:Athe_2335 xylose isomerase domain protein
FT                   TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45128"
FT                   /db_xref="GOA:E4SD64"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD64"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADQ45128.1"
FT                   /translation="MYKFIFSAFGDEISSSLDEQIEVLKKHGIEYLEFRSANGKNIADY
FT                   TENEAKEILEKLKDSGIKVSAIGSPIGKVDVNCDFERYLELFKHILHLAHILETKYVRI
FT                   FSFYVPEGEEEKYTDVVIERLLKFTEIARKENLVLLHENEKEIYGSNAERCFKILSEIN
FT                   SPNLRATFDPANFVQCKVEVYPHAFELLKDYIEYVHIKDAKFSDGSVTVAGEGDGRIKD
FT                   VIEALKRIHFCGFLSIEPHLNNNLPGGGPENFARAYRAIKKIIDGEGEI"
FT   gene            308425..308799
FT                   /locus_tag="Calkro_0217"
FT   CDS_pept        308425..308799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0217"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   ate:Athe_2334 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45129"
FT                   /db_xref="GOA:E4SD65"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD65"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ45129.1"
FT                   /translation="MSKLKFGIVGCGVISKTHAIAISALSSDAELVAVCDVIEDRARKL
FT                   AQDFGVKKIYTDYEKMLLDSDIDVISICTPSGMHADMAALAADAKKHVIVEKPMDITLS
FT                   KADKIIEAQNRNNVVISIIS"
FT   gene            complement(308875..310578)
FT                   /locus_tag="Calkro_0218"
FT   CDS_pept        complement(308875..310578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0218"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   csc:Csac_2511 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45130"
FT                   /db_xref="GOA:E4SAZ8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E4SAZ8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADQ45130.1"
FT                   /translation="MFVKITNAGGYQYVRLVENYRENGKVKQRVLFNFGRLDLLKNDPA
FT                   FRNIVKKLSDIVERTTTDNTEAVTIESEEDVSDAVIKNWGYIVFRKLWEELEIDKFLKE
FT                   RATRGRKIKFDVDKVSFLMTIQRLIEPMSKLRTYHEKNRYFGFEEDIDLNQLYRCLDFL
FT                   DSIKEDLETYLYQRNRDLFKMVVDIVFYDVTTIYFESCRADELKNFGFSKDNKINEVQV
FT                   VLGLLVDKEGRPIGYELFPGNTIDSKTMVKILRKLKEKFSIDKIVIVADKGLNSRLNLK
FT                   MIKEAGYDYIVASRLKNASKEVLDEVFEQEGYKRLDGKSCLNAEEIYGDEFKYKVLERT
FT                   NVIKDEEGKEFKIEERLIITYSSKRAKKDKEDRERLVSKAKELLENKGSITSLEKKGAR
FT                   RYLKKKSKTEEYELDEEAIKRDEKFDGYYAIQTSKKDMDVEEVLGAYHDLWKIEQSFRV
FT                   MKSCLEVRPIYHFTESRIKGHFVICFLAFLLQRTLEYILRKKGKEISSERIMEAIDSMN
FT                   FIEIEIKGKKYLIKQRTEGGAIDILNVMKIKGPKNFMTYEEGLGFIGINK"
FT   gene            310812..311912
FT                   /locus_tag="Calkro_0219"
FT   CDS_pept        310812..311912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0219"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: ate:Athe_2334 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45131"
FT                   /db_xref="GOA:E4SD67"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD67"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ45131.1"
FT                   /translation="MSKLKFGIVGCGVISKTHAIAISALSSDAELVAVCDVIEDRARKL
FT                   AQDFGVKKIYTDYEKMLLDSDIDVISICTPSGMHADMAALAADAKKHVIVEKPMDITLS
FT                   KADKIIEAQNRNNVVISIISQHRYSDCMQLLKRLMNEGKFGKIVLATSYTKWYRSQEYY
FT                   DSGNWRGTWSLDGGGALMNQSIHYIDMIQWIVGKVEEVYAYCTTRAHKRIEVEDCAVAC
FT                   VKFENGAIGEIVGTTSAYPGFETRLEIFGEHGSAIAVNTQLESLYFKDGSEKEYLENYK
FT                   KEDRGPVGASSAAIKEEGHVRQYRDVINAIKTGTKPLIPAEEGRHPVEIILAIYLSSLT
FT                   GRPVKLPLESDEEVLKEIEKIKGKGF"
FT   gene            complement(312004..313143)
FT                   /locus_tag="Calkro_0220"
FT   CDS_pept        complement(312004..313143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0220"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: csc:Csac_1334
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45132"
FT                   /db_xref="GOA:E4SD68"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD68"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADQ45132.1"
FT                   /translation="MKYRKFPNIDFEVSALGFGCMRLPILGDDASQINQPLAIEMIRYA
FT                   IDNGVNYIDTAYGYHGGNSEVVVGKALKEGYRNKVKLATKLPVWKLTKIEDADMILDEQ
FT                   LKRLDTDYIDFYLLHALNKQRWDMLKSMDIFSWIEKVKSKGKIKHIGFSFHDSLDTFKT
FT                   IIDEYDGWEFCQVQYNYLNRNYQAGEEGLKYAHAKGLGVIIMEPLLGGKLARKPPEQVQ
FT                   IVWEKTKVKRTPAQWGLLWLWNQKEVTTVLSGMSSMQQVIENIKTADEGYVGCLSEDEL
FT                   KLIDEVTQKYLELKPIDCTGCKYCLPCPNGVDIPRNFNLYNDAKVYNMYEETKKAYLKP
FT                   EKVEQKASNCVECSLCEEKCPQNLPIRKLLKEVAQFFEG"
FT   gene            complement(313241..314008)
FT                   /locus_tag="Calkro_0221"
FT   CDS_pept        complement(313241..314008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0221"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; KEGG: ate:Athe_2333 xylose isomerase domain protein
FT                   TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45133"
FT                   /db_xref="GOA:E4SD69"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD69"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADQ45133.1"
FT                   /translation="MNKDKIAAQLYTVREFLKTEEEIYHSLKKISEIGFKAIQISGIGK
FT                   IHPKRLKEICDEFGLKICATHIPFERLKEEIESVISEHKIYECLHIAIPSAPSKYRSQE
FT                   GAIAFAAECNEIGKKLKDEGITLSYHNHSFEFKKYDGKTWFELFIESSNPEYLMIEIDT
FT                   YWVQFAGANPEKWIRSLEGRIPLIHLKDMGMIEDFRQGMFEVGFGNLDWDGIIASCNEA
FT                   GVEWYIIEQDVCQRLPFESLKMSFDFLVKNYSD"
FT   gene            complement(314065..314949)
FT                   /locus_tag="Calkro_0222"
FT   CDS_pept        complement(314065..314949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0222"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2332
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45134"
FT                   /db_xref="GOA:E4SD70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD70"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45134.1"
FT                   /translation="MKIRKSAGEIIFDTFNYIFLGLLCFTMLYPMLYVIFASFSNPIKL
FT                   MAYRGPLLRPLDFSVEAYKLLLSYPMIWIGYRNTLVYVVVGTAINILLTTMGGYVLSRK
FT                   NLKLKNPIMFFIAFTMYFSGGMIPTYLLVQSLGMIDTIWAMIIPGAISTTNLIIMRTGF
FT                   HAVPDSLEESARIDGAGDWTILFRIMIPLAMPMIAVMILFYAVGHWNAFFSAIIYLRSR
FT                   ELYPLQLVLREILIMNSTENMTTGISDASDRFAVTELIKYAAIVVSTVPILCIYPFLQK
FT                   YFVKGVMIGAIKE"
FT   gene            complement(314971..315924)
FT                   /locus_tag="Calkro_0223"
FT   CDS_pept        complement(314971..315924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0223"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2331
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45135"
FT                   /db_xref="GOA:E4SD71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD71"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45135.1"
FT                   /translation="MEKATIKSYQPSRWQELKKDLIRNKSLYLMIIPVVAYYFIFHYIP
FT                   MYGLQIAFKDFTPAKGIWGSPWVGLEKFKEFFVYDSFYVWRIIRNTILINVYDLIFGFP
FT                   APILFALLLNEIKNSIYKRTLQTVSYMPHFISTVVIVGMIMDFFARDGLINNILKSLGV
FT                   LSEPISFMTEPGWFRPLYVGSGIWQNLGWGSIVYLAAISNIDPQLYEAALIDGAGRFRQ
FT                   ALYVTIPGILPTIVIMFLLRVGHMMNVGFEKVFLMYNPLTYETADVISTYVYRKGLLEM
FT                   DYSYGAAVGLFNSVINFLLVIFSNKIAKKLTETSLW"
FT   gene            complement(316042..317643)
FT                   /locus_tag="Calkro_0224"
FT   CDS_pept        complement(316042..317643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0224"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2330 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45136"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD72"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45136.1"
FT                   /translation="MDWFKSSKKVLSIIVVIAFALSLVIPAFVSSTSTAYAKSIPTLTY
FT                   FVRLDPKVATSYNSYSSIAAYQLLQKKLGVKLVFKHPPVGGETDQFNLMIASRQLTDII
FT                   EWNWIDNYPGGPVKALLDKVIIRLNDYMPKYAPNLSKYLQQHPDIKKLIVTDDGDIYGF
FT                   PALRGTNPKIACVYYGPQIRNDWLKKLGLKEPETVDDWYKVLKAFVTKDPNGNGKKDER
FT                   GFSILRNASNPRYAFDYSSFLVGAWGIKTDFFQVNGKVKYGPLEPQYKQFIATLQKWWK
FT                   EGLIDPDILTMNQKVIKANVQNDVIGAWIGLLSGDMGFFLNLKKDIIATKFPVLKKGEQ
FT                   PLLGQAEFLFSRTSAAITTACKDIPTAMKVLDWGYSKEGYEAFNYGVLGKSYIKKDGKV
FT                   YYTDEILKNPQGLSAAEALAKYARASISGPFVQADEYYLQIQMMHPQQKEAVMQKWSDV
FT                   KNDRILPPLSFTDEESKRLANIMNTVNTYYDEMFLRLMTGKATNVDSFVKTLKQMKIDE
FT                   AIKIYQAAYDRWKKRK"
FT   sig_peptide     complement(317530..317643)
FT                   /locus_tag="Calkro_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.897 at
FT                   residue 38"
FT   gene            317949..320270
FT                   /locus_tag="Calkro_0225"
FT   CDS_pept        317949..320270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0225"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: ate:Athe_2329 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45137"
FT                   /db_xref="GOA:E4SD73"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD73"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADQ45137.1"
FT                   /translation="MFKKILWRFVFSYLVIFIIPLLIGIGSYFSIKDIMMSSLYRYNKT
FT                   ALTQLEDKVENEIVKSVESLADWINLNPYYFIFLPEAKEALDSSDRLLNIRNLCREIYS
FT                   QTYKNSYIIDAFIYIPSENLIVGPSYTTTPYNYYTYINRPLDMSYEKWLEFLSGEYKMK
FT                   YIPSFKIKADYKNLSTIVFANTLSRWIIDGKNANVFVIIDQSKIVSTMKEIVSYPKGIL
FT                   WILDRDNNQVLKVSAEKQNILLPKLNFSIYNDFTIKELTLNGEKWIIYYIISPIYGWKY
FT                   ISMVPVDSFFEEIRKIRNLSLFLLGFMSIIGSILIFFFSMQNYRPLSEIKRLLQAGSEA
FT                   KSSEHEKNEFDFIRDLVVQTLSKEEELKKQIMRFSPIIKNNLLYQLLLGSALPENIGEL
FT                   ELKTLEMQKQDAKFLVCLIEIDDCSGFIKEESDSEYSLVTLVVTNVMDELLETNGFKHW
FT                   DVLFSRTRLSVIVEINDNVEDSIKELSEIFENMIEFLEKNFSIYMSVGISGMVMGIINL
FT                   KFAYEQAEKVLSLKFVKPNMKIFKFSELSQDITSEKEFLPKDIENKIINVVKEGKVEGV
FT                   YEVFENIKNHITAANSPHMAKMILIYLYGLYYQLLNSIPNKVGEKQKPEPEKVMRLIIE
FT                   EKNPKKVLQTIQEDYKILAENVIVNKQKIGNDLISNILDYIHQQYSSSEISLSTIADKF
FT                   NITPQYLSAIFKEKTGQNISDYIQNLRMHRAKELLLSTDYSVSQIAKMIGYTEVSGFTK
FT                   AFKKFEGVSPNKFRELNKSQ"
FT   gene            complement(320348..322633)
FT                   /locus_tag="Calkro_0226"
FT   CDS_pept        complement(320348..322633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0226"
FT                   /product="Transketolase domain-containing protein"
FT                   /note="PFAM: Transketolase domain-containing protein;
FT                   Transketolase central region; KEGG: ate:Athe_2328
FT                   transketolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45138"
FT                   /db_xref="GOA:E4SD74"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD74"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ADQ45138.1"
FT                   /translation="MEREFQLWEKIKDITYQYLDFTLNYRQSGHPGGSHSKAHMLISLL
FT                   FGKKMLYDIRKPEYRFNDRLILSAGHTIPIIYSIFSVIGDAFDEMYRQTKDEKYLIAED
FT                   RLVRYYDLLTFRHRGGLPGHAESSGKTLLLKFNTGPSAHGLPASVGQALALKKAGLQNV
FT                   KVFLVEGEGALTAGATHESQNGAWAYGLGNLFWLLDWNDFGIDDRPFSSVVYGTPEEWF
FT                   SAHGWKVHGTMNGHSWQDVYFTIKRAVEEADENIPNLMWFKTKKGYEYGVYDNKSHGVP
FT                   HKKNSEIFWETRKPFMEKYSVEFVGFGKPAPSDPDEEKKQWEENLKIINKVLTKDEELL
FT                   KYITDTLIEIAEALPKEAPSTFVLNQNPYKDPAIYDYKNYPEWLFAKPGENVPNRAALA
FT                   KWGMYINGVVGRKYGRPLVIATSADLTESTNLHGFGLGKDDFGGFGVYDREKNINGAVL
FT                   PSAITEFLNAGVCAGLATVNLSENPYEDFNGFWAITSTYGSFMYLKYGAIRLFSQMAQD
FT                   SPIKFGKVIWVAGHSGPETAEDSRTHFGIFEPGVLQLLPKGKIINLYPWEHNEVPVLLG
FT                   AALATDINNIALHLTRPPIEIPDRNALGIPSHFEAAKGAYIINDFDPNRRKDGTIIVRG
FT                   TSTTYNLIKLLPQLRKDFNLKIIAAPSFELFMMQEDEYRNKVLPLEDWIDSMVITNESK
FT                   KLMHDWIFSKVSEEYSLSSDWDDSWRTGGTVDEVLKEAHLDCDSIYSGIERFVKDREKR
FT                   IAMLKNIL"
FT   gene            322972..323922
FT                   /locus_tag="Calkro_0227"
FT   CDS_pept        322972..323922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0227"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: ate:Athe_2327
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45139"
FT                   /db_xref="GOA:E4SD75"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD75"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADQ45139.1"
FT                   /translation="MLHTFVNAIQGVLVILFVLMLGYFLAKYRWFDSKVSDLFAKVVVN
FT                   VSLPLYMIVNLTSTFTKNELEHSARGLLIPFLSILLSYSMAVIIARVANVKVHRRGLFA
FT                   AIFSLSNSIFVGLPMSLALFGDVATPYTLLYYMANTTIWWTLGVYGIIKDNREEKQNVL
FT                   SIDTLKRIFNPPLIGFLIGVGLVLLQIKLPKFIFDSFKMVGGLTTPLSIFCVGITMYEM
FT                   GFKNFRLDKDSILVFAGRFLVTPFITWLLSHFIPVPKLMRDVFIIMSAMPVMVNSAIIS
FT                   RVYNGDYEFATAMITYSTVFSVVIMPFLMVLIKII"
FT   gene            complement(323915..325147)
FT                   /locus_tag="Calkro_0228"
FT   CDS_pept        complement(323915..325147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0228"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ate:Athe_2326 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45140"
FT                   /db_xref="GOA:E4SD76"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD76"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADQ45140.1"
FT                   /translation="MQYVLFSGPFRALRHKNYRYYWFGQAISVIGSWMQNMAMQWLALS
FT                   ITNSALLLSIVTACEQVPVMFISLFAGAILDKMQKRRIILLTQSLLLFFAFILFLITYT
FT                   HTVRYWHLVVLAILRGLVTTFDNPARQSYMITLVGKEDLPNAVGLNSMIFNLARIIGPA
FT                   VASLVISTAGIEMCFLANAISFVPVIIGVFLIDAKEPQKEENGKSVFAEVVEGLKYVYM
FT                   NKVLLRTISLVLIMGTFILNFNVLIPVYAKLALGRNETGFGFLMSSMGIGSLMGAFLTA
FT                   TRRKEKINLNLLFKFILSVSIVYIFLGLNKSYAVACVLFVFVGLLAISFNTSANALLQL
FT                   SSSDDFRARVLSIYFLCNAGTTPIGNLFTGTISQKISPWAGFYIPGLATIALTTMVLIT
FT                   TFKKKNLEKTK"
FT   gene            325472..326494
FT                   /locus_tag="Calkro_0229"
FT   CDS_pept        325472..326494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0229"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ate:Athe_2325 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45141"
FT                   /db_xref="GOA:E4SD77"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037459"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD77"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADQ45141.1"
FT                   /translation="MEFKFNFEPVMKSDFINVSRSSIYKSDKKYGFESFRFRVDLPNKN
FT                   YDVKIVLKNLEVDVAKANVMVFPRRIMLKDLKIKYGEVLQEEFTVNVKDERIVFEIETD
FT                   GAEVCSIEVKEAQNPIVIYLAGDSTVCDQENLPYAGWGQAFGCFFKKGVSISNHAYSGR
FT                   SSKSFIEEGRLEQILQTIKEGDYLFIQFGHNDQKDDKRYTEANTTYKIMLKVYIDEARK
FT                   RGAVPVLVTPVARRHFDENGKIAGSGLHFDYPKAMRELAEEENVFLIDLLQMSSQLYEK
FT                   LGVEESKKLFVYAKPGEYPQFPEGIEDNTHFNMYGACEIARLVVEGIKKVDLKLREYLR
FT                   "
FT   gene            326636..327985
FT                   /locus_tag="Calkro_0230"
FT   CDS_pept        326636..327985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0230"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: ate:Athe_2324 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45142"
FT                   /db_xref="GOA:E4SD78"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD78"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADQ45142.1"
FT                   /translation="MGKLFGTDGVRGVANKELTCELAFDLGRAGAYVLTEMHKKPKILI
FT                   GKDTRISCDMLEAALCAGLTSVGADVYLAGVVTTPAIAHLVKFHGFDAGIMISASHNPY
FT                   EFNGIKLFNSQGFKLSDQIEEKIEDIILNKKWDEVPHAQFDAIGRVSRVDLKKDYQEYL
FT                   KSTLNGASFKGLKIVIDCANGAAYKIAPEVFEELGAEVVVINNQPDGTNINKECGSTHL
FT                   KMLQQEVVKNRADFGIAYDGDADRTLFVDEEGNIVDGDKIMLILAQNLKQQGRLSRNTL
FT                   VVTVMSNMGLFVAAKELGIELEVTKVGDRYVLEKMLEGGYSIGGEQSGHIILLDFATTG
FT                   DGILTSLQLTKLIRESGKKLSDLAKIMKVYPQVLVNAKVENGKKDLYSKDPVILEAIKK
FT                   VEEKLNGKGRVLIRPSGTEPLIRVMIEGEDYEEIKKDAEALASLIESRLS"
FT   gene            328301..330136
FT                   /locus_tag="Calkro_0231"
FT   CDS_pept        328301..330136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0231"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: ate:Athe_2323
FT                   glucosamine--fructose-6-phosphate aminotransferase;
FT                   TIGRFAM: glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: glutamine amidotransferase class-II;
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45143"
FT                   /db_xref="GOA:E4SD79"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD79"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADQ45143.1"
FT                   /translation="MCGIVGYVGTKNCVPILLSGLKRLEYRGYDSAGVAVIDIDKSKID
FT                   IVKTKGRLTVLEEKLNQNPIEGFVGIGHTRWATHGEPSDENSHPHVSQNGKIAIVHNGI
FT                   IENYLKLKEFLIKKGYTFASDTDTEVVAHLIEYYYDGDILDAFIKTLEKIQGSYALGVL
FT                   CLDRPDMILAARKDSPLIVGLGQDENFIASDIPAILEYTRDTYILEENEIAIVTMDKVE
FT                   IVNTEKESVKKEVFHVTWDVSSAEKGGYEHFMIKEIMEQPKAIRDTLTGRLPDSGFEVN
FT                   LDGIKITKEDLQKLNKIFIVACGTAYHAGIVGKHVIEKLTRIPVEVDIASEFRYRDPIV
FT                   DENTLTIVISQSGETIDTLVAMREAKARGSRTLGIVNVVGSSIAREVDDCLYTWAGPEI
FT                   AVASTKAYTTQLICLYLIALDFATKLGTISYEEFANIRDEIKRLPEKVEYVLTHKENIQ
FT                   KYASEHFNAKDIFYLGRGLDFAVAMEGSLKLKEISYIHSEAYAAGELKHGTIALIEDGT
FT                   FVIALATQEKLFEKMVSNIKEVKSRGAVVLSVAQEGNTEIENVSDHVLYIPRTLDILAP
FT                   VLTVVPLQLFAYYTAVQRGCDVDKPRNLAKSVTVE"
FT   gene            complement(330215..330544)
FT                   /locus_tag="Calkro_0232"
FT   CDS_pept        complement(330215..330544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0232"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   csc:Csac_0607 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45144"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD80"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADQ45144.1"
FT                   /translation="MKNSNDNMPLCPVEITLTLIGSKWKILILRELMDGTKRFNQLLKS
FT                   INGISQKVLTQQLRSMEKDGLVIRKVYPEVPPKVEYTLTELGLSLKPILDAMYEWGERY
FT                   KKIKG"
FT   gene            330674..331228
FT                   /locus_tag="Calkro_0233"
FT   CDS_pept        330674..331228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0233"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   csc:Csac_0608 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45145"
FT                   /db_xref="GOA:E4SD81"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD81"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADQ45145.1"
FT                   /translation="MKIIGIVGSPRKGGNTEILVEKILSGAKEAGLDVEIFKLNELNIH
FT                   PCQGCNFCQENGRCKQQDDMQKIYDAMYSADALVVGSPIYMSYITAQTKIFLDRLYALL
FT                   KIGEGPRIPAGKRCVLVYTQGGGTDGQKVMEELSMFFKDALGMDIKAIIGANNLNPIGA
FT                   VNERKDVLERAFEVGKEIVKG"
FT   gene            331524..331967
FT                   /locus_tag="Calkro_0234"
FT   CDS_pept        331524..331967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45146"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD82"
FT                   /inference="similar to AA sequence:KEGG:Athe_2320"
FT                   /protein_id="ADQ45146.1"
FT                   /translation="MLHKLNKIVYVENYESDYVYAHPSLIDDLDEILSESGKETDFGKQ
FT                   FRKKIIFLENLKKNCIQQKSFERLSKHCYLYSLRVMGVHNIRILFAFFALQGKEIVILL
FT                   NAFPEKSKSTKNNPKSYSYAIEKAEERIEELKSVYEDLQLITS"
FT   gene            332060..332434
FT                   /locus_tag="Calkro_0235"
FT   CDS_pept        332060..332434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0235"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ate:Athe_2319 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45147"
FT                   /db_xref="GOA:E4SD83"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD83"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADQ45147.1"
FT                   /translation="MLDNKRLISAYKIVEKYTNEEDKKYFELDDILVDIAVKIIQYRIK
FT                   NNLSQKELAQKLGISQAMVSKLESGDYNPTVKMLYEIAKKLGFELEIEFREKTEYEENW
FT                   VESSEELLDEVINNEVGEAA"
FT   gene            332431..332871
FT                   /locus_tag="Calkro_0236"
FT   CDS_pept        332431..332871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45148"
FT                   /db_xref="GOA:E4SD84"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD84"
FT                   /inference="similar to AA sequence:KEGG:Athe_2318"
FT                   /protein_id="ADQ45148.1"
FT                   /translation="MIEIGNLKADFQLVSTRVVKFELETKKEESDEIEVELKCDYDIEE
FT                   IEENNEIYIGAVQFKAAFEGKKKNKKLFKIHIVYEGCFAGKKEKLGLEDFKNMLELNGI
FT                   ITLTHLTRSYIMSCTALAGFNPPLRLPLINVHKLREMKHKTM"
FT   gene            complement(332864..333097)
FT                   /locus_tag="Calkro_0237"
FT   CDS_pept        complement(332864..333097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45149"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD85"
FT                   /inference="similar to AA sequence:KEGG:Csac_0616"
FT                   /protein_id="ADQ45149.1"
FT                   /translation="MRKIFVEVYAHFSKEGEITPISFVWFDGKTYEIDKIIEKRNAASL
FT                   KSGGQGIRYKILVRSKMLYLFYDENRWFVEFT"
FT   gene            complement(333143..334378)
FT                   /locus_tag="Calkro_0238"
FT   CDS_pept        complement(333143..334378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0238"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: csc:Csac_0617 DNA-directed DNA polymerase;
FT                   PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45150"
FT                   /db_xref="GOA:E4SD86"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD86"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADQ45150.1"
FT                   /translation="MGRVILHCDLNNFYASVECLYQPELRNKPVAVCGESELRHGIVLA
FT                   KNQIAKAFGIQTGDVIWQALKKCPNLVILKPNFPLYIRFSKLAQQIYSEYTDLIEPFGI
FT                   DECWLDVTESTQILGSGRKIAYEIKERIKRELGLTVSIGVSFNKVFAKLGSDYKKPDAV
FT                   TVITKENFKQIVWPLPAKDLLYVGSATEKKLSSRAIYTIGDIAKSSPEYLRRILGKWGE
FT                   VLWIFANGLDTTPVTPPLFEDNIKGIGNSITLPRDLTCYEDAEYVIRMLSESVAQRLRQ
FT                   QYLKCFTIQVWIRDSSLFAITRQEKLQTPTFLAREIAQKAFEIFKKNWSFKNSIRSFGV
FT                   RALDLVCANSFYQLEFDSLKKFKLEQLEKTVDQIRKRFGQSAVLPAILLTKSNLPCEIP
FT                   LHNKIHPVAFFK"
FT   gene            334847..336127
FT                   /locus_tag="Calkro_0239"
FT   CDS_pept        334847..336127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0239"
FT                   /product="transposase IS605 OrfB"
FT                   /note="PFAM: transposase IS605 OrfB; transposase
FT                   IS891/IS1136/IS1341 family; KEGG: ate:Athe_2430 transposase
FT                   IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45151"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD87"
FT                   /inference="protein motif:PFAM:PF07282"
FT                   /protein_id="ADQ45151.1"
FT                   /translation="MTKVEKIKQTRQQTKERRKNQIPVMYQLKINLNSASEETKEKLFK
FT                   LFLEAKWLYNYIVADIENRLDSNAEKLKEVEIKVGENFEKRKIENLSSQMKQALRERIK
FT                   QNLYSLHVQKENGYRTGKLQFKHCVNSIPLKQYGNTFKFGNQQKTIVKIQGIKKPLRVL
FT                   GGHQIPEDSEIAKAELVRRPSGIYLFVTCYIDRDKHTKVWEQRKNKKGVVKPRVWQIFD
FT                   VAAGIDFKPTGLVLSNRLKLEWRIKETKRLKELQKQLARQQKGSKRWYKTKEKIAREYE
FT                   KLTNIKYDIINKTCSFLYRYRKICFQEDNIKSWKDGYFSKSVHYSAVGTIKRRLSDSLR
FT                   VSTAVVKSNVPTTKTCSSCGSQQKISLSDRIFRCAVCGLEIDRDLNATINMLKEVGLDR
FT                   SELKPVEWETAARIFRGNPYILVSHTT"
FT   gene            336197..336439
FT                   /locus_tag="Calkro_0240"
FT   CDS_pept        336197..336439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_1848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45152"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD88"
FT                   /inference="similar to AA sequence:KEGG:Tmath_1848"
FT                   /protein_id="ADQ45152.1"
FT                   /translation="MRNGPWAASKVTIIKGNSYNQASDFQQCIVKGYRDRKTGMEVMFF
FT                   YLSKDENGLWKVISVGTGPLIKSMVRTNNIRLNPK"
FT   gene            336791..338254
FT                   /locus_tag="Calkro_0241"
FT   CDS_pept        336791..338254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0241"
FT                   /product="transposase"
FT                   /note="manually curated; TIGRFAM: transposase ;
FT                   transposase, IS605 OrfB family; KEGG: ate:Athe_1928
FT                   transposase; PFAM: transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45153"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD89"
FT                   /inference="protein motif:TFAM:TIGR01765"
FT                   /protein_id="ADQ45153.1"
FT                   /translation="MVTVQAKLIFESREDKQKVLDLMRRWSSCMRYAYKRLLEGHKRNE
FT                   LKRQLQGIFNLNSRYIDDAIMKAKSILTSCKERGENPEKVIFGGRQLFEKLKRRHINGK
FT                   ANRKLQLKWQEKRKGSLYSRGDRSKKGNLNTRIEIDGNFTKLRINVGEREYVYATIQAG
FT                   WKMKGKTYMDRNLLLQAISSSSGPYSVELKLKNGVVYAYFTVEEVFPKPAITKANGVIG
FT                   IDTNAYPKNVAWAETDEYGQFLGYGRIPLEKLESGSSSKREYYRWQYAHMIVQMAKEKK
FT                   KAIVIENLSIQDRGRRGDFSGRKSRRIRHYFGYRSLLEKVKLLAKREGVEVIEVDPAYT
FT                   SVIGMLKYAPQLMVSKDIAAAYVIARRGLGLRERIPHNYMLLLSSLDTNSLEELKEYVK
FT                   KVVKNPNVRRKQLKEIDRVIVILQSSGSEPGRLSVPLDGTSAGSRGKKHNPWRVLRVAV
FT                   VTPLSPDRVLRDMSVLKSLLISGQVGRPT"
FT   gene            338409..339071
FT                   /locus_tag="Calkro_0242"
FT   CDS_pept        338409..339071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45154"
FT                   /db_xref="GOA:E4SD90"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD90"
FT                   /inference="similar to AA sequence:KEGG:Csac_0527"
FT                   /protein_id="ADQ45154.1"
FT                   /translation="MEYLKPSNLLNLVISPTKVFQKIKEKSDFLVLVLIISLISALSVL
FT                   CIPKIPDEVLLEHVKKTVEDPNLQETALKSLKVTMSPVFLAATTFVKDIISFFIVSFIL
FT                   LIIVRLAGGEIDYKKALTIVAVANLVMIPYYIFYAIYARVINLNMLDVQMDFKYFIRTY
FT                   LHVFSIWRYVLIGVGVFTVCELNKAKTAIVTAVYTIITLIMPIISLFSQNIMKFGAK"
FT   gene            339091..340737
FT                   /locus_tag="Calkro_0243"
FT   CDS_pept        339091..340737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0243"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: ate:Athe_2611 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45155"
FT                   /db_xref="GOA:E4SD91"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD91"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADQ45155.1"
FT                   /translation="MQNSAKGLKNWQKVVIIVLLILVGFILTLVLTMPSGSKKNASSKP
FT                   KTAKVQKISLKQSLLVSGTVQSRNTKNVISKVNGTLEKIFVKNGQYVKKGDLIAKIDDS
FT                   QAVFKIETLKRQLLDLELQRENFQRQLQNFILKSPQDGFIQNLVAEEGLLVSQGMQLMT
FT                   IVDDSKMKLSVQLPAWCYGKVKQGQKTEVVVSDLMDRVDGVVAGLGSRIYKNQDGAMVF
FT                   DAKVAVSNKNGSLTEGMRASVSLKLSNGEKVTSLSEGILEVFSKKSIVSPVSGRIEKVF
FT                   VENGQKVKTGSLLLKFATDDIEMQIKQLDLKIEDVKSQIEAAEDDLKNYKILSPIGGKI
FT                   TDLNFQDGDIVTAGQLICSVYDPKHLVISAQVEELDILKIKPGQKVNIKLDAVGSTKSN
FT                   SIEGYVTEISEKAQADSSSISKFVVKIEFENNNSIKIGMHAEAEIILKSKENALVVPVE
FT                   AVHKENGKYYVYVYTQQKAKTSEKNKDQKTSQKKDEYGLDSSYYKDAEKRQVKLGMTTD
FT                   KYVEILEGLTEGEEVVLPKFDSEKQGQSLFY"
FT   gene            340759..341946
FT                   /locus_tag="Calkro_0244"
FT   CDS_pept        340759..341946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0244"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   csc:Csac_0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45156"
FT                   /db_xref="GOA:E4SD92"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD92"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADQ45156.1"
FT                   /translation="MEKFLLACKMAIQSIFLNRVRSFLTLLGVVIGVGAVVAAVGLAEG
FT                   TTAGITKEIEKLGTNIVYVIINPASRSEDISVDEFLEFARKNSDVILGVSPFVQYPAQA
FT                   LFRGKKEECQVIGATAEYMMIQNLALSKGRFVSPVDSDFRQKVAVVGSRIQKKLFDNKN
FT                   PVGNEINVNGQVFKVVGVLKEKQGSRDNTIDDSVIVPLFALNSMFAGDYALIKNFLVRT
FT                   VSSEKNGEVKKRVKAYLSGIIKKEENYSVYDMSELMSALSRITYLLMIILGGIATISLV
FT                   VGGIGIMNIMLVSVTERTREIGIRKAIGAKRSDIRVQFLIESMVITGVGGIIGILLGFL
FT                   VIAVGISKIPGVEPVYSLKWAFVAFGISVLTGIIFGMLPAEKAARLNPIEALRYE"
FT   sig_peptide     340759..340875
FT                   /locus_tag="Calkro_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.604) with cleavage site probability 0.479 at
FT                   residue 39"
FT   gene            complement(342061..343311)
FT                   /locus_tag="Calkro_0245"
FT   CDS_pept        complement(342061..343311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0245"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: ate:Athe_2609 SufBD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45157"
FT                   /db_xref="GOA:E4SD93"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD93"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ADQ45157.1"
FT                   /translation="MSSRHYIDEKILELAKSALNKKAAYGQDIDLSQFEEAEEKEQISE
FT                   LSKLPEEIQKTILNAGIEVSEEGRSGSFLQLDHSVVYRRLQQRYHGQIEILDINEALEK
FT                   YPEVREKYLWKAVKPDKDKYTAFSAMHPAHGYFIRVFKGQKVEKPIQACLLLQENARIQ
FT                   NVHNIVILEEGAEVQIINGCATAPKVKEGLHIGISEFYLEKGSKLTFTMVHNWAEDFYV
FT                   RPRGVTVVEDDAVFVSNYVLLKPVKSIQSFPVAVLKGKNAVASFNSLLYGLKDSEIDMG
FT                   SHIILEGENSSGQAISRAIVKDSAKIYSRGILEARHNVSKAHLDCRGILLSDNGLMYAV
FT                   PELLSDGAPQSHLSHEAAIGPIAEEEVEYLMSRGLSKDEAISLITQGFMDVKILGLPKQ
FT                   LENYVQELILQTQEENM"
FT   gene            complement(343290..344030)
FT                   /locus_tag="Calkro_0246"
FT   CDS_pept        complement(343290..344030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0246"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2608 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45158"
FT                   /db_xref="GOA:E4SD94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD94"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45158.1"
FT                   /translation="MLEIVDLHVEVGSKEILKGVSLTIPDGETHILFGPNGSGKTTLMM
FT                   SIMGLPKYKITYGKIIFNGIDITYMPTHERAKLGIGMMFQKPPAIRGVELQKLAEIIKS
FT                   IRNTDADIQEYARILNLEEHLSREVNYGFSGGEMKRSELLQLLCQKPSLVLLDEPESGV
FT                   DLDNITLLGNLIKKLLKGEKIKKRHTSGLIVTHTGYILDYVSADKGHILMDGKLVCSGS
FT                   AEDLFEEIRQNGFGRCENCLQDTI"
FT   gene            344202..344528
FT                   /locus_tag="Calkro_0247"
FT   CDS_pept        344202..344528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0247"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   ate:Athe_2607 protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45159"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD95"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADQ45159.1"
FT                   /translation="MKLVLAIVSEVDRNKLNLALIENGIPATIIYSTGGFLNRGTVTFM
FT                   IGAEDDRLDEVIELIKKNVSERKEVSKSTLPPALQSLFFVSKQKIEQGGAVIFVLDIEN
FT                   FLKV"
FT   gene            344587..345459
FT                   /locus_tag="Calkro_0248"
FT   CDS_pept        344587..345459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0248"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ate:Athe_2606 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45160"
FT                   /db_xref="GOA:E4SD96"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD96"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADQ45160.1"
FT                   /translation="MIYDCAVIGAGPAGLSAAINLAQTNRSVVVFATKQEDSSIYRAPE
FT                   VNNYLGFHGVTGKELLQSFYDHAKKMGIEIIYKKVINFYKSGDIFTINANNEFFEAYSV
FT                   ILAIGTPKKTLLENESEFVGRGISYCAVCDGMLYRGRDIAVIGESEEAEEEAEYLSELA
FT                   QKVYYIPLYKKNKFHFKDNVEIVLARPKGVYGEDFVNALELEDRILNVDGVFIIRKTMP
FT                   ADQLIYGLEFTEDGHIKVDSKMQTSIEGLFAAGDVVGRPYQVAKAVGEGQIAGLSASTY
FT                   VKMVKEKQK"
FT   gene            complement(345504..345851)
FT                   /locus_tag="Calkro_0249"
FT   CDS_pept        complement(345504..345851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45161"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD97"
FT                   /inference="similar to AA sequence:KEGG:Athe_2605"
FT                   /protein_id="ADQ45161.1"
FT                   /translation="MYRIFCESYQNFCKSFENSSAQDEFRYKIAKVFELIVDLNKFKQE
FT                   RERNSDLYKNLCDLLWFMQQNTHKYPKFKAFLWTLESREIVPIYFGTTPQNTLEEQAKL
FT                   ANMFLSLLYWE"
FT   gene            complement(345972..346190)
FT                   /locus_tag="Calkro_0250"
FT   CDS_pept        complement(345972..346190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0250"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: ate:Athe_2603 regulatory protein, FmdB family;
FT                   TIGRFAM: regulatory protein, FmdB family; PFAM: Putative
FT                   regulatory protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45162"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD98"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADQ45162.1"
FT                   /translation="MPFYDLRCKDCGEEFNVRASIKERENKEIECPNCHSHELEAVFKS
FT                   VNIISSSRSDSGGYSCSSGCCGGSCGF"
FT   gene            346436..348079
FT                   /locus_tag="Calkro_0251"
FT   CDS_pept        346436..348079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0251"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; 5TM
FT                   Receptors of the LytS-YhcK type transmembrane region;
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   chy:CHY_2219 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45163"
FT                   /db_xref="GOA:E4SD99"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E4SD99"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45163.1"
FT                   /translation="MHEVFFNLAERLGVIVTLAFFLSRTKLFGNILNQQLNIIQKVGLI
FT                   IGGGLFGILGTYWGIPIKGAIANSRVIGPAIVGIIGGPYIGLLAGFIAGFHRALLGGFT
FT                   AVACGISTTVEGLIAGLVAKKFSDKKFKWYFGILTGMSIEMLQMIIILTLAKPFKNALD
FT                   LVEVIGIPMIVINGIGIGIFLLILENVIEEKKKIGAVFAAKALHIANETLPILREGLTV
FT                   ETAKKVAEIILNKTDADAVAITDRNSVLSYAGCGNHKEIIIKAIEDQEMLRTLEKGDIC
FT                   TISEKENNKGDSKDNNLTTAIICPLFIKNNLIGTLQLFYNRFVQLNEFTTTFVKGLSQL
FT                   ISTQLEIAALEKQTKLLAKAELKALQAQINPHFLFNSLNCIVALCRIDPEKARELIIKL
FT                   SEYFRRNLREWDPLIPLSEELENVNLYLTFEKARFSDKLHIEFDINNETTTIKVPPFSV
FT                   ETLVENAIKHGLLPKKGGTLQIKASKNGHKVVIEVADNGIGINGNAKDGVGLTNLKERL
FT                   KNLFGEEGELVITPNEKGGTIARLIIPITH"
FT   gene            348095..348844
FT                   /locus_tag="Calkro_0252"
FT   CDS_pept        348095..348844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0252"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="KEGG: chy:CHY_2218 DNA-binding response regulator;
FT                   PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45164"
FT                   /db_xref="GOA:E4SDA0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45164.1"
FT                   /translation="MIRAIIVDDEELARKELDFLLKETKEVEVVAELDSAEELFEVVER
FT                   TKPDVVFLDIEMYGLSGLDAAFELLKMPQPPIIVFATAYDQYAVKAFELNALDYLLKPF
FT                   SFERVKLCIERIKRALENRGLYTKKLLENLRTFTNKKVLIHTEDKILLLNKEEIYIAEA
FT                   QGRYARIKLKNKWIASRHSLSDLEKILAEQFMKVHKSYIVNVEHIKEIIPLFGGSIILR
FT                   MADDNATEVPVGRTFLKGFKEKFGLKI"
FT   gene            348990..350780
FT                   /locus_tag="Calkro_0253"
FT   CDS_pept        348990..350780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0253"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   chy:CHY_2217 carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45165"
FT                   /db_xref="GOA:E4SDA1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA1"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ADQ45165.1"
FT                   /translation="MSALELIIAAALILVLAYRFYGSFLAAKVLVLDSSRETPAKRHYD
FT                   GKDYVPMNKWIAFGHHFAAIAGAGPLVGPVLAAQFGYLPGTLWILIGAVLAGAVHDMVI
FT                   LLASVRHDGKSLFEIAKKEVGPVAGVATAIAIFFLIILTMAGLGLVVVNALFKNPWGVF
FT                   TIGMTIPIAIFIGIYMHKLRPGRIAEASLIGVALILLAVLVGPYIKNSPLGSYLMLSDK
FT                   TLEILLPLYGFLAAALPVWLLLAPRDYLSSYMKIGTILLLAIGIIIVNPRINMPAVTQF
FT                   INGGGPIINGKVWPFICITIACGAISGFHALISSGTTPKLIANEKDIKLVGFGGMLTEA
FT                   FVALMALIAATTLMPGDYFAINTKPEIFQKLNMQIVHLPQLSKLVGEELAGRPGGAVTL
FT                   AVGMADIFSRIGGLRHLMAYWYQFAIMFEALFILTTIDAGTRVARYIAQDLLGMIYSPI
FT                   KENKSVGLTVLLSAAVSFAWGYLIYGGDIKTIWPVFGVANQTIGALALAIGTTMILQRS
FT                   KKKIYALTTFLPMTFLFITVLDAGITNVFNVYLPQKQMVPAVLVITLMILAIIIMVSSV
FT                   IKWISILSKTRKAELALENE"
FT   gene            350900..351916
FT                   /locus_tag="Calkro_0254"
FT   CDS_pept        350900..351916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0254"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: adg:Adeg_1075 FMN-dependent
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45166"
FT                   /db_xref="GOA:E4SDA2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA2"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ADQ45166.1"
FT                   /translation="MTVKEIREKAREMLKGYCRVCPICDGKACRGEVPGMGGIGTGSSF
FT                   VANVEALSKIRLNLRTIHDAKEPDICVEMFGKKLAMPILAAPITGSSYNMGGKISEEDF
FT                   IQMVISGSKEAGTIGMCGDGGDPVFYESGLKAIRNENGHGIAIIKPRSNDQIIKRIKEA
FT                   EDAGALAVGIDIDGAGLITMALMGQPIGPKTKEELKALISSSSLPFILKGIMTEDEAEI
FT                   ALEVGASAIVVSNHGGRILDHTPGVAEVLPRIAEKVKGKILIFADGGVRSGVDVLKYLA
FT                   LGADAVLVGRPIIHAAFGGGKEGVKLILEKMAQELKQAMILTGCKDIKSIDVKVIYK"
FT   gene            352078..352797
FT                   /locus_tag="Calkro_0255"
FT   CDS_pept        352078..352797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0255"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: ate:Athe_2602 iron
FT                   permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45167"
FT                   /db_xref="GOA:E4SDA3"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA3"
FT                   /inference="protein motif:PFAM:PF03239"
FT                   /protein_id="ADQ45167.1"
FT                   /translation="MVQGFVIAFREVFEIILVVAVMIGVIQKLNQKDLLKSMNIGLVLG
FT                   IVLSALLGIIVFAFYESLEESFEGIEIALKALLVILITWFLFLAIKYQKRDLKQQTYEK
FT                   VVNFQKYSYGIFVLSLVNVLREGAELVIFSLASFFKDKSLTLFYGIGLGIFAAVLLGYF
FT                   VFKLSNRINIRLFFIATTLILAIVSSEVLRDLVEEILKEGLKTQNEVIPIALSFVYILV
FT                   FLVLMIRSNIISRQKTE"
FT   gene            352888..354363
FT                   /locus_tag="Calkro_0256"
FT   CDS_pept        352888..354363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0256"
FT                   /product="stage IV sporulation protein A"
FT                   /note="KEGG: ate:Athe_2601 stage IV sporulation protein A;
FT                   TIGRFAM: stage IV sporulation protein A; PFAM: Sporulation
FT                   stage IV protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45168"
FT                   /db_xref="GOA:E4SDA4"
FT                   /db_xref="InterPro:IPR014201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA4"
FT                   /inference="protein motif:TFAM:TIGR02836"
FT                   /protein_id="ADQ45168.1"
FT                   /translation="MDTDIYREIAKRTNGDIYIGVVGPVRTGKSTFIKRFMDLFVIPNI
FT                   EDEYKKERTKDELPQSAQGKTIMTTEPKFVPNEAVEILLSSGARLKVRLVDCVGYLVEG
FT                   AMGHLEENHPRMVTTPWFEKPIPFEEAAEIGTKKVIQDHSTIGIVITTDGTITEIPREN
FT                   YIKAEERVIEELKLLNKPFVIVLNTVKPYSPDTQELKKDLEEKYKMPVLVVNCLQMQIE
FT                   DVKRILETVLFEFPVVEVKINLPRWFDELEDESWLKKEIYEKIKEYAEKLDKIRDITDQ
FT                   LEVLKQHPQIDRCDVVGINLGDGKSELSIYFKEGLLFRIIEESTGFEIKGDHHLLKLLS
FT                   ELAQVKKDYDKLKDALEEAGEKGYGIVPPSLDELKLETPEIVKRGNSFGVRLKASAPSL
FT                   HIIRVEVETEVSPIVGTEKQSEELVNFLMREFEDDPKKIWESNIFGKSLHELVKEGLQN
FT                   KLYRMPEDAQSKLKETLQKIINEGSGGLICIIL"
FT   gene            complement(354406..357039)
FT                   /locus_tag="Calkro_0257"
FT   CDS_pept        complement(354406..357039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45169"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2600"
FT                   /protein_id="ADQ45169.1"
FT                   /translation="MKRFLSFISFATILSIVLSAFAKPYTEILRFKTIQQIAPRTYYEK
FT                   YELLTDEGFVDINCIKLDLIDGGFYFDVLKASVANTGDFVYNMVYNQIDKNPVAAINAN
FT                   FFYTNTKTDYNKIWPIGISVSGGKILSSPNNKQNTFPAFVYTNASEILFDYINGLSYKL
FT                   VNLDSGYEFKIAHINKFTGDLTYPILFTGDYVQKTIGNKYKGIVEFIIKDGIIKDIREE
FT                   DQTVALDKDEYLLAATGNYAKNLKTNFKVGDKVEIKIDLSVPLEKIKAAASGNTFLLKD
FT                   GKIPSFTHEIAGRHPRSAIGIDKTGRYLYLVAVDGRNGKSIGLSQGELANFLQSIGVWT
FT                   AINLDGGYSTQLIAKDNDGNLKAFYNTGETRKVFDSIAAFYKYRDDKISTFYIDCPDKV
FT                   FAGEEYPIKVFAKDRFYNTITYDAVYLKVYQDAYEIDIKDGLFIPYKDGVVTISCVYED
FT                   VYQKAFAQKKISVYKPEILTTSKKQLYLLPGESVALRFFIKDKVGHFKEIDPRKVQAEE
FT                   NPAFEFKDGTFIAKSNFRGFVTFTYKDLKCNIPVGIGETLQLLRSFDYLALSWPKGISM
FT                   FLSSKNKTQGKYSNKIYFSVSSTKGKSFKLNFKTPVDLTNISKISFDLCAKNVKVYLGF
FT                   KMLNGMQKEVEISQLKGDNFKSYSLNVESYKTLDYILLIPQKTQGYIWIDNLTGNVVNL
FT                   PPVENINQYVAKFDSNLAKSSVIFLTKSFENLPSDIKKKVESNLGSYLKCYSLEKYNPP
FT                   YDMNEKFNAVFLRTKSGSILDFSYYQWIRIKNLSTEKKSMIVVLDIPFESLRQDEKDIL
FT                   IRLLKSRKSPSMIICTTSDYTRVERYDTFYIGYASTNALLLKSNAKNINLACDVEKGYI
FT                   YLARGY"
FT   sig_peptide     complement(356971..357039)
FT                   /locus_tag="Calkro_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            complement(357085..357792)
FT                   /locus_tag="Calkro_0258"
FT   CDS_pept        complement(357085..357792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0258"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: ate:Athe_2599
FT                   PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45170"
FT                   /db_xref="GOA:E4SDA6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDA6"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADQ45170.1"
FT                   /translation="MQHIFSKVRKAVEDFNMIEEGDKIAVGVSAGKDSLTMLYTLSFLR
FT                   KFYPKKFEVVAITVDMGFEGMDFLPIKEFCDKIDVEFHLVPSQIKQIVFDIRKEENPCS
FT                   LCANLRRGILNSTAKSLGCNKVALGHHLDDVVETFFLSLFFEGRIHCFSPKTYLDRTQI
FT                   TTIRPMIYLKEHDLRSAAKKLELPVITNPCPANGKTNRQRMKEFVKSLKQFHPATKDLV
FT                   FNAIKRNIWGLKN"
FT   gene            357944..358020
FT                   /locus_tag="Calkro_R0003"
FT                   /note="tRNA-Pro1"
FT   tRNA            357944..358020
FT                   /locus_tag="Calkro_R0003"
FT                   /product="tRNA-Pro"
FT   gene            358114..358198
FT                   /locus_tag="Calkro_R0004"
FT                   /note="tRNA-Tyr1"
FT   tRNA            358114..358198
FT                   /locus_tag="Calkro_R0004"
FT                   /product="tRNA-Tyr"
FT   gene            358216..358291
FT                   /locus_tag="Calkro_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            358216..358291
FT                   /locus_tag="Calkro_R0005"
FT                   /product="tRNA-Thr"
FT   gene            358320..358395
FT                   /locus_tag="Calkro_R0006"
FT                   /note="tRNA-Lys2"
FT   tRNA            358320..358395
FT                   /locus_tag="Calkro_R0006"
FT                   /product="tRNA-Lys"
FT   gene            358403..358479
FT                   /locus_tag="Calkro_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            358403..358479
FT                   /locus_tag="Calkro_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(358884..360071)
FT                   /locus_tag="Calkro_0259"
FT   CDS_pept        complement(358884..360071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0259"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: fno:Fnod_1562 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45171"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDH8"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ADQ45171.1"
FT                   /translation="MLNYNYITELLKSKDIILHQVVESEKEVELHISQTQKPHECPKCG
FT                   SITSKIHDYRVQRVKDVPIMGKRTYLVLRKRRYVCKECGKKFFEHINFLGKRQRMTNRL
FT                   AAYIISQLSSLSSMKEVARQTNVSVTTVMRLFDKVSPTKKIEDFSSEAICIDEFKGNVG
FT                   GAKYQCIIVDPVKKQIVEILKDRRQDVLIEYFKRLKDRDKVKYFVCDMWRQFVETAKIY
FT                   FKNAKIVIDKFHFTRYVYWALENVRKRVQKELEDNLRKYFKRSRKLLLKSYEELTAEQR
FT                   EELEVMFWYSRDLRKAHRLKEEFRKVLESSNSTQAKVELKKWIEAAERSGLSEFCRCIK
FT                   VFRNWFSEIVNSFDVPYTNSVTEGFNNKIKVLKRNAFGYRNFERFRKRILYSCSS"
FT   gene            360304..360513
FT                   /locus_tag="Calkro_0260"
FT   CDS_pept        360304..360513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0260"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: ate:Athe_1017 YcfA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45172"
FT                   /db_xref="GOA:E4SDH9"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDH9"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ADQ45172.1"
FT                   /translation="MKAYSSREIIKILMADGWYLEAVRGDHYQFKHPVKKGKVTVPHPK
FT                   KNLPIRTVKSILKQAGIKIEDIGE"
FT   gene            360521..360937
FT                   /locus_tag="Calkro_0261"
FT   CDS_pept        360521..360937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0261"
FT                   /product="Uncharacterized protein family UPF0150"
FT                   /note="PFAM: Uncharacterised protein family UPF0150; KEGG:
FT                   ate:Athe_1016 protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45173"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI0"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ADQ45173.1"
FT                   /translation="MNRDIYVFPAIFTFDDDGITIEFPDLPGCISCAETLDEAVKNAKE
FT                   VLGLYLWSMEKDNEPIPEPTPVNNLKLEQNQIPILIEVWMPLVRHEMDNKAVKKTLTIP
FT                   QWLNILAEKNNINFSQVLQEALKEKLGINEYHHS"
FT   gene            complement(361334..362344)
FT                   /locus_tag="Calkro_0262"
FT   CDS_pept        complement(361334..362344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0262"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="KEGG: ate:Athe_2595 DNA repair photolyase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45174"
FT                   /db_xref="GOA:E4SDI1"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2595"
FT                   /protein_id="ADQ45174.1"
FT                   /translation="MTSSKKSFLAKHFSHVYIEKAVLSHPVTIKILEKLQRSKIVKIDN
FT                   YKEVFCRSGQNYFLQEKSKKLILAKKSGEFLYPGPQICHNFGYDNFFYTSNILNCIYSC
FT                   EYCFLKGMYSSANIVIFVNIEDYFKEIDTVLKNKTLYLSVSYETDLLALENIVPFSSAW
FT                   IEYATSKQNLTIEIRTKSTNFQTIENLKPKDNVILAWTLSPEEIIEKFENGTPSLYSRI
FT                   SAIKKATEKGWNVRLCFDPILYIPDWKSIYEKFLRQVFEELNPDKIVDISVGLFRIPKD
FT                   YLKSMKKVFANEITSFPYEESQNICTYPKKLKEEMINTILLILGNFISSSKIFVI"
FT   gene            complement(362313..363152)
FT                   /locus_tag="Calkro_0263"
FT   CDS_pept        complement(362313..363152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45175"
FT                   /db_xref="GOA:E4SDI2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2594"
FT                   /protein_id="ADQ45175.1"
FT                   /translation="MIYIVTAFHAEAKALIEYFALKKLYVPSKFQIFSGNDILLIESKE
FT                   GIIKSSIATTFALTKFGAGSKDMALNIGICGAVENTFSKGDVILCNKIINHHSKKAFYP
FT                   DILISHSMKEATLESFMHPVKKDSLPVEIEGDIVDMEGAGFFEASSIFLPLHNIHCIKI
FT                   VYDFLDFEKINSSEIENLIKQSIPHIENLISSLLKLNFESCNNTPEINNIPLIVNKLKH
FT                   SLHLTAYMTNELEGLLKDYIIRHKKLPNSIFEFFEVQINSKKEGKNYFDKLKKILLS"
FT   gene            complement(363450..364994)
FT                   /locus_tag="Calkro_0264"
FT   CDS_pept        complement(363450..364994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0264"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: csc:Csac_0408 alpha amylase, catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45176"
FT                   /db_xref="GOA:E4SDI3"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI3"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADQ45176.1"
FT                   /translation="MKRILRYILIFAIVFLIGLSSFLAGLSNSQSPVQTKKDGLIFYEV
FT                   FVRSFYDSNGDGIGDINGLAEKLPYIKSLGVNAIWLMPIFESPSYHGYDVTNYYKVNPD
FT                   YGTNEDFVNFIKKAHKMGIKVIIDMMINHTSSKHPWFIEASSNKNSKYRNYYIWATPNT
FT                   NLDEPSELGTRQWYKKGDSYYNAIFWSEMPDLNFDNKAVREEMKKIAKFWLEKGVDGFR
FT                   LDAAKHIYPLSREKDTLVWWEEYAKFCRSIKKDVYLVAEVWDSLQRIAQYAKIFDSCFN
FT                   FIIAQNIIEGVIYENTQTLQNNLSSIYNLYKNVNPQFVDAPFLTNHDMNRAYTEIGSNS
FT                   KMKLAAALLLTLPGNPFIYYGEEIGMKGQKPDEYIREPFKWYETWKKGQTNWEMSLYNS
FT                   GPDVASVEKQEKDKNSLLNFYRDMISFRKKNLPLLKGDFQLIKTSFDILSFARVYNNQK
FT                   MVVIFNFTGKELSKTINLPSNINITGKTVKGSGKILSLKNGKLSFSIKPYSFIIIN"
FT   sig_peptide     complement(364905..364994)
FT                   /locus_tag="Calkro_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.901 at
FT                   residue 30"
FT   gene            complement(365112..365333)
FT                   /locus_tag="Calkro_0265"
FT   CDS_pept        complement(365112..365333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45177"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI4"
FT                   /inference="similar to AA sequence:KEGG:Csac_0409"
FT                   /protein_id="ADQ45177.1"
FT                   /translation="MKEALLILLAMSGCLLAHIFMHKAMMGRGCHGHAHHHSNETQKAS
FT                   DFKDHQFHHHHHSEELVALDKPKSEENK"
FT   sig_peptide     complement(365280..365333)
FT                   /locus_tag="Calkro_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.956 at
FT                   residue 18"
FT   gene            complement(365357..366404)
FT                   /pseudo
FT                   /locus_tag="Calkro_0266"
FT   gene            complement(366440..367171)
FT                   /locus_tag="Calkro_0267"
FT   CDS_pept        complement(366440..367171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0267"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: csc:Csac_0411 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45178"
FT                   /db_xref="GOA:E4SDI5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI5"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADQ45178.1"
FT                   /translation="MAYLLPSAAGLASFFSPCIIPMISVYFSLITGVSIRDLKDIELHK
FT                   KMRKFILINTFIFVSAFTLVFTIAGALGGSIGRWLSGYTTIMNKIGGAITIIMGLNLIG
FT                   LLNLNFSFLNKYSADNIKTSSRYFTTFLIGLFFAIVCSHCIGPILYSILIYTTTTKSAF
FT                   VGMTIMLLFSLGLAIPYLLVGYYLPHAINAIKRAKKFQNAICAVAGATLIFLGIVMFLN
FT                   KLQDLTAILSRLLPYKLPFGM"
FT   gene            complement(367185..367790)
FT                   /locus_tag="Calkro_0268"
FT   CDS_pept        complement(367185..367790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45179"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI6"
FT                   /inference="similar to AA sequence:KEGG:Csac_0412"
FT                   /protein_id="ADQ45179.1"
FT                   /translation="MRKTVSLKMFFYPKSECKRGNVLMTKKTKRIIVTAVLFAFVVSSL
FT                   YAQVIISQQKKQSNTQTKTIYRQDSKQSTSSKNNSPDPLIINSEGLITIGVRYLNPIKD
FT                   DKDYLVFEVFFDNHQVDLSTLNLSGKILFTTSEGIKVKKATWRIEGSGHHVMAYIKIPK
FT                   KINGKNLITPKTKYIQLELQNIGGVKSRIYRWDKKFLN"
FT   sig_peptide     complement(367647..367790)
FT                   /locus_tag="Calkro_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.964 at
FT                   residue 48"
FT   gene            368027..368650
FT                   /locus_tag="Calkro_0269"
FT   CDS_pept        368027..368650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0269"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: csc:Csac_0414
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45180"
FT                   /db_xref="GOA:E4SDI7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADQ45180.1"
FT                   /translation="MRDKTEIIRKRYDRAAKYYDAVESMMEKKWFSQWRKLLFSFVKGP
FT                   KVLEVGVGTGKNMPYYNQDWEMVAIDFSPKMLERAKERAAKLNLQVDLRLMDVQHLELS
FT                   DNSFDTVVTACVFCSVPDPILGLKEIRRVLKGDGVLVMLEHVRSKKEPIGKIMDMLNPL
FT                   VVGIYGANINRNTVENVKKAGFEIVEEKNLLSDIVKLIIAKPIK"
FT   gene            complement(368760..369305)
FT                   /locus_tag="Calkro_0270"
FT   CDS_pept        complement(368760..369305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45181"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI8"
FT                   /inference="similar to AA sequence:KEGG:Csac_0417"
FT                   /protein_id="ADQ45181.1"
FT                   /translation="MKILKSILGIGLVLALVLTFTFVFAKGLQPGSTQKTKNAAAGWQQ
FT                   NTGCGYGFMLHTNMQELVAKALGLSVDELVQKIQNGQTINDILKEKKLTVDDLKKKLYD
FT                   LRAAEIDKLLKDGKITKEQAEFLKKHFQANIQYCIDNILDWSNNGFGGMMGFGHGGGMM
FT                   GIGHGNMMGAGFSGMMGY"
FT   sig_peptide     complement(369228..369305)
FT                   /locus_tag="Calkro_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            369466..370131
FT                   /locus_tag="Calkro_0271"
FT   CDS_pept        369466..370131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0271"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: csc:Csac_0418 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45182"
FT                   /db_xref="GOA:E4SDI9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDI9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45182.1"
FT                   /translation="MANILVVEDQQDLNQIITRFLKNDGFNVINSYTAKDALNKLNDAD
FT                   LVILDIMLPDMEGYEVLKEASKKGIPTIILTSKSEEFDKLKGFELGAEDYITKPFSMLE
FT                   LIARVKVVLRRNRNFEESIKLLGGKVEIFPQRFKVIVDGEDVNLTHKEFELLLFLAKNK
FT                   DLVKSRDEILEKVWGFDFIGETRTVDVHIKQLREKLKDYKFLIKTVWGVGYKLSEEKE"
FT   gene            370153..371424
FT                   /locus_tag="Calkro_0272"
FT   CDS_pept        370153..371424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0272"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: csc:Csac_0419 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: histidine kinase A
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45183"
FT                   /db_xref="GOA:E4SDJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ0"
FT                   /inference="protein motif:PFAM:PF00512"
FT                   /protein_id="ADQ45183.1"
FT                   /translation="MKLFTKIALNFIGIIVFLVLSIYISNMLYLKYFLEDMIIDDLKKL
FT                   SQDALENKLEGDLSAMKILILQGNTIVLEEGGLDLPYHMIMPVFNSTGVYEFSHPHLKV
FT                   EYIAYVLKRGDFTSIAITTKPYYGYALNIISKNLIKISIIFILIGLLVSLLISRHISKR
FT                   IIKISVATQKIAKGEDFELKDNSTDEVGDLARSINSLKNSLRLLERVRREFVANFVHDL
FT                   KTPIAVIKGYCESTKYLDINDKEKIKQNMDGIEKQCDYMQNLISNMVELSKISAGIIEK
FT                   KIEEVDVNLVIKQSCEQLKKLAEIEDVEIIIKSLNSPKIKTDLNSFRRIINNLLQNAIE
FT                   NTKDKKVYIETEREYVDIYNKTDLKEEELIFLFERYKSSRKGFGLGLSIVKELCKILDI
FT                   KLETFIEDGYIHFRTKLENTKSSS"
FT   gene            complement(371486..372688)
FT                   /locus_tag="Calkro_0273"
FT   CDS_pept        complement(371486..372688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0273"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ate:Athe_2588 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45184"
FT                   /db_xref="GOA:E4SDJ1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADQ45184.1"
FT                   /translation="MRELIKVAIKSIFSNKLRTFLTMLGIIIGIASVITIVSLGEGGKT
FT                   AILGEFEKIGVNIFSVRPRTDVEITESDRLTVKDVEMIRKRVSSVKYAAPVAQKFGLVK
FT                   SGKRTKRALFIATDFDYGNVSNLKIVYGRFLNERDILLGRNVVLIDRESAKELFGYEDC
FT                   VGQTIKVGSSTSFDTAKIIGVIDSSSYRALGGAAADQFPVIAAMPITYAQKIFDDVTIS
FT                   QIYVMTYNSDQLDEATSQVVRLLELRHHNKDKYKTENFVNFMEQFERILGIFTTVMSAI
FT                   AAISLVVGGIGVMNIMLVAVTERTREIGIRKAIGATQRDILVQFLIEALLISLIGGSIG
FT                   TLLGYLLANLVGPFIQITPVVSLKTILIAFAFSSAVGIFFGIYPAKRAAQLDPIVALRY
FT                   E"
FT   gene            complement(372719..373411)
FT                   /locus_tag="Calkro_0274"
FT   CDS_pept        complement(372719..373411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0274"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2587 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45185"
FT                   /db_xref="GOA:E4SDJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45185.1"
FT                   /translation="MIELKDIKKVYSLGKVELEVLKGISLKVEKGEYVAIVGPSGSGKS
FT                   TLMNIIGLLDKPTSGSYLLDGLEVSTLNDMQLASLRNKNIGFVFQSFNLLSKLNALENV
FT                   ELPMIYAKIPPKERRQRALSALERVGLSDRIYHRPNELSGGQQQRVAIARAIVMNPSFL
FT                   LADEPTGNLDTASSIEIMKIFHELNKAGTTIIMVTHEQDIANHAKRIIRIRDGMIIDDA
FT                   PVKNRITY"
FT   gene            complement(373414..374580)
FT                   /locus_tag="Calkro_0275"
FT   CDS_pept        complement(373414..374580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0275"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: ate:Athe_2586 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45186"
FT                   /db_xref="GOA:E4SDJ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADQ45186.1"
FT                   /translation="MKRSSKGILITILVVALIALSVYGISQRNQQMLNTVEVKTANVEK
FT                   GDIVWLFSTNGDVESKSKQDYFILTPTKVLKVFVDVGDKVKKGDKLLELETQDLSIQYK
FT                   IAQKQLEMAKLQLESLKKLKEKWSSQNQSSLQNSTAPIQSYSLNTFTSSQMQVASPGYS
FT                   LDDQIKLQEKQVEIAQLNLQSIKQNMDKQQRYIKSQINGVVTAINAREGNVFSSVQLPA
FT                   VTVEDPEDLQIVLNVNQYDAINISEGQKALIRFGEKTFDGAVKMVSPAATKVITQTGAE
FT                   NVVKVYVDILNNDGTIKPGFNVDVDIKLGEKKNVLKVPSEAILTDKKGQSFVYIVENGV
FT                   AKQRKVEVGLSSDLETEIKSGVAAGEKVILNPNSSIQNGTKVKEKGGS"
FT   sig_peptide     complement(374506..374580)
FT                   /locus_tag="Calkro_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.732 at
FT                   residue 25"
FT   gene            374786..375892
FT                   /locus_tag="Calkro_0276"
FT   CDS_pept        374786..375892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0276"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   ate:Athe_2585 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45187"
FT                   /db_xref="GOA:E4SDJ4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ4"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ45187.1"
FT                   /translation="MEKVKVAVLGCGNIAPVYLKNLKRFGIFDVVACADVDADKAKNIA
FT                   TEFSISQAVEPDKVYDLDVDIIVNLTPPQHHYEINKRVLESGKHLYSEKPLCSTLKEAK
FT                   EILELAEKKNLKVGCAPDTFLGANIQTAKKLIEDGWIGRPFAANCFILYGGPEKWHPNP
FT                   HFIFKKYLGPLFDVGPYCLTALAFLLGSVKKVSGMGMVTYKERLITSEPHRGEKIEVEM
FT                   PTYVTANLLFDTGVIGNVTVSYDVPDTNLRGIEIYGTEGTLIVPDPNFFDHGRVYLKRH
FT                   DDKEFTKMPTINPFNYDNLRGLGILDMALSIKLSTPLRASGRLSYHVLETLWAIYTSTQ
FT                   EGRFVDVESTAPRTPLLDMELLREVLCL"
FT   gene            376045..376614
FT                   /locus_tag="Calkro_0277"
FT   CDS_pept        376045..376614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0277"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ate:Athe_2584 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45188"
FT                   /db_xref="GOA:E4SDJ5"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ5"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADQ45188.1"
FT                   /translation="MNAFWLGAIVSSILYQLLFGNVEKITEILFSAPQKAADIFLTILL
FT                   SIMLWSGFLRVVQDSNLVEILKKLLKPIFEALFKTKNERALNFILLNVVANMLGLGNAA
FT                   TPAGILAMQELSKEAKNSTASDDMILFVLINTCSIQLIPTTAILLRTKFSSSAPAAITF
FT                   PTLFVSMASLFIGIILCKVLSKVCKK"
FT   gene            376611..377129
FT                   /locus_tag="Calkro_0278"
FT   CDS_pept        376611..377129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0278"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ate:Athe_2583 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45189"
FT                   /db_xref="GOA:E4SDJ6"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ6"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADQ45189.1"
FT                   /translation="MKNISDYLIACFLLLIILFAASKRIDVFKSFVEGVKDGLRISIKI
FT                   FPNVFALIVAVELFTKTGVLDILQKLLSPVLSFFGIYKEALGLIIIKPFSGSSSFAVLK
FT                   DIFEKYGVDSDIGIYSSIICASTETLFYVITTYLAATNVKKTRYLIPVAIAVDFLVLII
FT                   AAMIVRKSI"
FT   sig_peptide     376611..376673
FT                   /locus_tag="Calkro_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.307 at
FT                   residue 21"
FT   gene            complement(377188..377829)
FT                   /locus_tag="Calkro_0279"
FT   CDS_pept        complement(377188..377829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0279"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   KEGG: ate:Athe_2582 methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45190"
FT                   /db_xref="GOA:E4SDJ7"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ7"
FT                   /inference="protein motif:PFAM:PF02310"
FT                   /protein_id="ADQ45190.1"
FT                   /translation="MEILNEISQLVQKGNAKLAPEKVKEALSSGISAETILNDALVQAM
FT                   SVVGEKFKNNEIYVPEVLIAARAMKAALEVLKPILTETGVKPIGKVVIGTVKGDLHDIG
FT                   KNLVAMMMTGAGLEVIDLGVDVAPEKFCEAVKNHSPQIVAMSALLTTTMPNMKTTIEKL
FT                   QEQGLRDKVKVIVGGAPVTESFAKSIGADGYAPDAASAAELAKKFVKGVA"
FT   gene            complement(377849..380839)
FT                   /locus_tag="Calkro_0280"
FT   CDS_pept        complement(377849..380839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45191"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR033400"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2581"
FT                   /protein_id="ADQ45191.1"
FT                   /translation="MLDLEKLKNPDNFYRCAPFWSWNDNLKEEELLRQITEMHQKGYGG
FT                   FFMHSRVGLVTEYLSEEWLNLVKKCIEHAKKLNMLAWLYDEDKWPSGFAGGAVAFKNPS
FT                   YRHKFLVLLKEDQVEHDDEVLSSFVHGGVKYIVAKRTMKLGDMWFNGSCYVDLLSKDAT
FT                   MEFINLTHERYKQACQEYFGDAMPGIFTDEPTYLRVHYKDIPTLPWTEKLPERFLQKKG
FT                   YDIKDHFEELFFNVGNYHKVRFDFFDIALEMFIENFTIPYAKWCEENGIMMTGHYMAED
FT                   TMRGQIEWIGAAMPHYEYMQLPGVDKLARHLEQVVTMKQVSSVAEQLGKKGVLCETFGT
FT                   TGQHVSFLHRKWISDWQAVLGITYINPHLSLYSMRGERKRDYPPNLFYQQPWWEDEKFF
FT                   ADYLARISYIAGLGKRDVDVLVLHPISSAWAEYSKFDDSVDKLDILLDKTVKELIANKI
FT                   DFHFGDEIILSKYAQVENGKIKVGSYSYKVVVLPPLTNLRKTTLKLLQNFVNTGGKVVA
FT                   LKDFMFSRFELCMIDGSKCDIPLKEKFINATDLNELVSILKEEVSTYIEVIDKKTSQNA
FT                   KKIILQSRKLNDGSRIIFLANTDLQREAEITIKIPTDKNVFVADLVDFGVFKIPTLRRE
FT                   KGCAVIDATMYPASSLCLLVSDKELSQNTKNLISGVIFDNSFEYKTGSCEFDIALKNYN
FT                   TLILDRIKYEVDGKVIFEDCYCAQVWHKHFYNLPEGTPFKATYYFKVEKVPSKLFVAIE
FT                   CAENLDMILVNNQPVKFERKTESFSPEQNFLDVNVGKIDITSFVKEGKNEIVLSGRKSN
FT                   NITAPGCHERVKNSKNHRPTEVEAIYLVGSFSLICVDETKFILTEPKKPCHFDITKDGY
FT                   PFYVGSLSLKSSFEITKESSKRFYIKLNNVNASIAKVFVNGKKACTLFSQPFLADITDH
FT                   VNDGKNELEIVLTNTLFNLIEANHKADVFEELYRRPQSFIDFENFTSRYMLLPFGLGSY
FT                   SILTSDV"
FT   gene            complement(380868..381509)
FT                   /locus_tag="Calkro_0281"
FT   CDS_pept        complement(380868..381509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0281"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ate:Athe_2580 class II aldolase/adducin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45192"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDJ9"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADQ45192.1"
FT                   /translation="MQDIRSIKSQICRIGRIMYERGYISGPDGNISVRVDKDKIITTPS
FT                   GVSKGFLSEDMLVLIDMEGKILEKTNYKPSSEIKMHLKVYQEREDVNACVHAHSPYATT
FT                   FAVLRKPLDKPILAESVFIFGGYIPVAPFATPSTVEVPESIAPFIKDYDAVLLSNHGVL
FT                   TYDKDLEMAFYKLEIVEFWAKILFLSSQIGTPQVLSPEEIQKVLDLRKDN"
FT   gene            381746..383479
FT                   /locus_tag="Calkro_0282"
FT   CDS_pept        381746..383479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0282"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: ate:Athe_2579 alpha amylase catalytic region;
FT                   PFAM: alpha amylase catalytic region; glycoside hydrolase
FT                   family 13 domain protein Ig domain protein region domain
FT                   protein; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45193"
FT                   /db_xref="GOA:E4SDK0"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK0"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADQ45193.1"
FT                   /translation="MQVIHNQVHDIFALSKDKFYVRLWVQKGFARSVSLIFSDRYDLDV
FT                   QKVKMDFYMNVGSFEVYTAQVQNKTPRFAYKFLIELLDGSFKVFNQFGLVDTEENLYFD
FT                   AFQFPYANEADIFEKPSFTKGLVVYEIFPDRFKRGKKQVHSKKLFDWDYCSWDVPGSEV
FT                   FLGGDFAGIKEKIEYFKTLGINAIYLTPIFKSNSSHRYNVDDYFDVDPLLGTKEDFKDL
FT                   VVSLHKNGIRVILDMVFNHTGIGFFAFQDVIKNGENSKYYSWYNIRSLPVDIQKGNYET
FT                   FATNVNSMPRINTSNKEVQDFFLKVLKYWLLEFDIDGFRFDVANELDKNFIRRIRRELK
FT                   AIKKDILLIGEVMHRSENFLMGDMFDGVMNYFSWEVFVRYLMGKYNAEDASRILADYRL
FT                   KFNPILFSCQLNLIGSHDTERVLTRLNKNKELAMLAAVYNLTYQGIPMIYYGDEIGMEG
FT                   GHDPDCRRGMIWEEVKHDKEIFNLYRRLIDLKKVSSALNSDNVKEFSIGDVLCFERKSE
FT                   SEVVYILFNPRKALQKVKLWSEFIVDKEIEFFSMDKKIKNQSCYIELDLSPESFEIVIV
FT                   K"
FT   gene            383587..384495
FT                   /locus_tag="Calkro_0283"
FT   CDS_pept        383587..384495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0283"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2578
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45194"
FT                   /db_xref="GOA:E4SDK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45194.1"
FT                   /translation="MKKREPIGYVYLAPALISMAVLSFFPIAMTVYYAFTNFNLNHMED
FT                   YKFVGVKNFVDIITGPFREVFAPTFAWTFTFALVTVLINFSVGLLLAVLLNNKFMKETN
FT                   IYRSILIIPWAIPGTIASLAWQGLLNEEYGAINMLLKTIHLNPLPWMTDPFWAKISIFI
FT                   VNLWLSYPFMMNASLGALQSIPPELYEVAEIDGAGWFTKLFKITIPMIVPTALPILISS
FT                   FAYAFNNFNVVYLVTGGGPARLDTQFAGHTDLLVSTTYKLTMQFYRYDLASAMSIIIFF
FT                   IVGTISLINMKLTRAFEGGER"
FT   gene            384495..385364
FT                   /locus_tag="Calkro_0284"
FT   CDS_pept        384495..385364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0284"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2577
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45195"
FT                   /db_xref="GOA:E4SDK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45195.1"
FT                   /translation="MIGREYMTKQDAIVLWISRVIIWVAIILSLLPTWFIIVASLSKGG
FT                   AFFQSSFFPKEITFENYIELFRRKSSPSQTLPDFVMWVKNSLIVCFGVAFLQIFMTAPA
FT                   AYAFSRINFVGRKNGLKTLLILQMFPTFMAMPAIYGLLAKFNLLDNLFALILVLAGGSA
FT                   FNIWLLKGNMDQIPYEIDEAAIIDGAGHFLIFRKIILPLTAPMLAVMFIWSFNGVFNEF
FT                   LLSSLVLQSPENATVPIGLRNFINNQFSANWPMFSAASILASLPIVIIYMALQKQIQSG
FT                   LAAGAIKG"
FT   gene            385428..387050
FT                   /locus_tag="Calkro_0285"
FT   CDS_pept        385428..387050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0285"
FT                   /product="alpha-glucan phosphorylase"
FT                   /note="KEGG: ate:Athe_2576 alpha-glucan phosphorylase;
FT                   TIGRFAM: alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45196"
FT                   /db_xref="GOA:E4SDK3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK3"
FT                   /inference="protein motif:TFAM:TIGR02094"
FT                   /protein_id="ADQ45196.1"
FT                   /translation="MKKLPTVAYFSMEFGLDSNFKIYAGGLGILAGDYLKAAKDLGYPV
FT                   VGVGILWKQGYNKQIVTEEYGVIDAFPIYRYNFLKDTGVKVKVRIRNRDVYCKVWKVDN
FT                   FGNSDLYLLDTDLPENSDRWITGQLYGWFGEERVAQEMVLGIGGVRALKELGIKVDVYH
FT                   FNEGHAVFAGLELVRYYMEEKGLSFEQALSKAREKIVFTTHTPVEAGNETHPLKLLMYM
FT                   GANLNLTEEQLVYIGGAPFNMTVAALRLARISNAVSDLHRVTANAMWAQVDRRSRIIGI
FT                   TNGVHVGTWADRRILESRHNPEKLWQTHTQIKRELLDFVEKRTGVKLREDILTIGFARR
FT                   AAPYKRSDLIFRDKEAADKMFKNDLQIIFAGKSHPLDDTGKEIVNNIIAMSKKYPGKVV
FT                   FLEDYDMEIGKMLTRGCDIWLNNPRRPLEACGTSGMKAAMNGVLNVSTLDGWWPEACQH
FT                   GINGWQIGDGFESKDEKEQDSHDLKSLVNVMQNEVIPTYYKNKDKWVKMMQNSIESTLD
FT                   KFSAERMVKEYYEKMYIPKSHED"
FT   gene            387057..388079
FT                   /locus_tag="Calkro_0286"
FT   CDS_pept        387057..388079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0286"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2575 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45197"
FT                   /db_xref="GOA:E4SDK4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK4"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ45197.1"
FT                   /translation="MATIKEIAKEANVSPSTVSRVLAGSSKISPETTKRVLEAIKKLGY
FT                   VPNANAKGLVIKKSFTVGVFVPREPENAFLNSFFDQVITSICNLVNSFEYDILLAISNP
FT                   EKEKELLKRLVESKKVDGFVLLSSREKDPAIEYLKSIDFKFVVIGRPIGYENSVNWVDN
FT                   DNIKAGFEATEYLIRLGHRKIAFMGGPSDLVVTSDRFSGYKKALEKYGIQPKNSYIKFA
FT                   NYYKKSYRENAYEILSQEDRPTAIVCMDDLIAIEIFKVAESLNLKVGKELSVISFNNSI
FT                   VSEICQPPLTTVDINIFHLGRLAAEVLMMDLSESAKTYRRIIVPHQIVERESCGKAQTL
FT                   "
FT   gene            388219..389424
FT                   /locus_tag="Calkro_0287"
FT   CDS_pept        388219..389424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0287"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2574 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45198"
FT                   /db_xref="GOA:E4SDK5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45198.1"
FT                   /translation="MKNLKRILTVVLIIAFAAMVLIPLSGAFATSKKQLVVWSHLTQDE
FT                   VKALQPIADKWGKANGYTVKVITDQGSFQSFQTAAMSGKGPDIMFGIPHDNLGAFWKAK
FT                   LLEAVPANLIDKKNFVSTALDACSFEGKLYALPIAMETYALFYNTSKVKEAPKTMSQLI
FT                   TLAKKYGFMYDVNNFYFSFAFIAQNGGYVFKNKGGSLDPNDIGLATNGAIKGLSLIRDF
FT                   VQTYKFMPKDIRGDIAKGNFQNGKIAFYISGPWDVQDFIKAKVPFAVAPLPKTDDGKPT
FT                   PSFVGVQAAFVSAKSKNKDAAFKLAKYLVENSALTLFKVGHRIPVLNSVLASNEVKSDK
FT                   IMSAFAEQAKVGIPMPNIPEMSAVWTPAGNALSLITTGKATPKQAAEAMVKQIKQGIAQ
FT                   MQ"
FT   sig_peptide     388219..388308
FT                   /locus_tag="Calkro_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.910 at
FT                   residue 30"
FT   gene            389641..391794
FT                   /locus_tag="Calkro_0288"
FT   CDS_pept        389641..391794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0288"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   bfs:BF2901 putative uroporphirinogen biosynthesis-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45199"
FT                   /db_xref="GOA:E4SDK6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK6"
FT                   /inference="protein motif:PFAM:PF01208"
FT                   /protein_id="ADQ45199.1"
FT                   /translation="MKLNMQKWQERLINKGKNTKKAFPILSYPILKSMDGFDVKDLAQN
FT                   GHVHFNVLKEICQNFDMVAIATAMDLSVEAEEFGCAVRFSSEEVPSVIGPLIKKLDEAE
FT                   ELQIPEIGSKRTRNVIEVIKRLQTLNIEKPILGTMIGPFSLAVRLFDITELMISLMLEP
FT                   EKVHLLLEKCSEYLRRYAHALKVAGANGLLIAEPAAGLLSPQQCSEFSSHYIKEIVKSV
FT                   QDESFSVFLHNCGNTQNLVESMLETECMGFHFGNCVDLCEIIKRVPQSKLVFGNLDPVG
FT                   VFRNDSVEGVYHKTQELLFKLKEYSNFVISSGCDIPYHTPIENIKAFFEAVEDFNKDLL
FT                   KGEKLMERTIKNKFPSGKLTNRERFRRVMHYQNVDRIPNFEFGYWNETLPTWHSQGLPP
FT                   EIDNEEKAYKFFGIDSYKYVPIKNGLLPQFEQKVLEETQEYMIIIDAEGIKCQIFKNRA
FT                   STIPHYLEYPIKNKDDWERFKERLNPEDPARYPENWDEIVLELQKRDYPVCIHCGSLLG
FT                   KLRDWMGFENIALAFYDMPDLVDEMIEYMTDFSIKLMEKALKDVEVDFALGWEDIAFNK
FT                   GPIISPQMFKEFLMPRYKKIADFLHKHGVDIIGTDCDGNVMPIVELWLEAGFNLMFPVE
FT                   VHAGTDPVMLKKLYGDSIRLMGGVDKTKLQGSKEDILKELKRLEKVVEQGGFIPHVDHR
FT                   CPPDVPYENYLYYLENKKAMLGY"
FT   gene            391839..394217
FT                   /locus_tag="Calkro_0289"
FT   CDS_pept        391839..394217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0289"
FT                   /product="glycoside hydrolase family 35"
FT                   /note="PFAM: glycoside hydrolase family 35; KEGG:
FT                   scb:SCAB_20461 putative glycosyl hydrolase (family 35)"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45200"
FT                   /db_xref="GOA:E4SDK7"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK7"
FT                   /inference="protein motif:PFAM:PF01301"
FT                   /protein_id="ADQ45200.1"
FT                   /translation="MQIVVNVDMACPQKNISLLNFGGKNSSMEIFVTNKYLLKNKIPWL
FT                   PTMGEFHFSRYPEDLWEKEILKIKFGGIQIIATYLFWIYHEEIEGEFVWSGNKNIRKFV
FT                   ELCKKHDMFVFLRIGPWAHGECRNGGFPDWLLQKGCNLRTDDPLYLEYVERWYREIAKQ
FT                   VDGLYFDQDGPIISIQLENELYDNKEHIVTLKKIANKVGLRAPIYTVTGWGPKGGAKFP
FT                   EGEVIPVFGGYPEAPWEQHTKELPPNPNFFFTHLRNDAGIGNDLISSSNDALSDDPAIY
FT                   NYPFWTCELGGGVQKTYHRRPYIDPDDVGAIALVKLGSGCTLLGYYMYHGGRHAIGKLS
FT                   TLQESKDTRYPNDYPVISYDFQAPLGEFGEVRRHYHILRIIHMFVEDFGDILAPMEMYL
FT                   PKLVPANRFDITTPRVAVRSNGKSGFVFFNNYQRNPKLSDIEKLQVKIQLPEKALTVPF
FT                   QSFTLEKDAYFFLPFNFDVGNFKIVYATAQPLCKLYNEKNNELICVFRKCKGLEVEYVF
FT                   EGDITENIVSHKEFSEICNIDGSSYTKISNVQLGVEKSISLKHKESDKNLRIITLDQMQ
FT                   AEKMWKLKISGRERILICPTHNIFVEDDTVHVFGENPEGYFYLYPAYEDDKIEFDENLR
FT                   AEMIAENFYRISFWFEEIKTDVKWYEEEFVKNEFDRFLYADVDRKDNVKQFKFRSMIWG
FT                   KKEDLDDLLLEIEYVGDVIQAFVNDKLVNDDFYDGFNRFHLSLKELYFPEEIIIKISAI
FT                   SKFHNIYLQKVPDYKENDRVAVIKSAKLIPVYKREIKIY"
FT   gene            394233..395168
FT                   /locus_tag="Calkro_0290"
FT   CDS_pept        394233..395168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45201"
FT                   /db_xref="GOA:E4SDK8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK8"
FT                   /inference="similar to AA sequence:KEGG:Csac_0437"
FT                   /protein_id="ADQ45201.1"
FT                   /translation="MPRPPAPLFRDPIYDGAADPTIIYNHLEKSWWILYTNRRANQKLP
FT                   GKAFMHGTDIGIAESKDGGRTWLYRGTIDLQYGRGRNTFWAPEVIFYEGEYHMYVSFVP
FT                   GVPQDWNADRYILYYKSKNLWDWEFICKLKLSSNKVIDACVFQMPDGTFRMWYKDEADH
FT                   SYIYVAESTNLKDWKVLGPALTDRPQEGPNVFYWKGKYWMITDPWCGLGVYSSEDANVW
FT                   HRQENILDKPGKREDDGQIGHHADVLVIDDETAYIFYFTHPEGMEGTEEFWKDNRYWRT
FT                   SLQVAKLEYVDDRVVCYRDKEFDFYLPDLF"
FT   gene            395454..396985
FT                   /locus_tag="Calkro_R0008"
FT   rRNA            395454..396985
FT                   /locus_tag="Calkro_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            397138..400107
FT                   /locus_tag="Calkro_R0009"
FT   rRNA            397138..400107
FT                   /locus_tag="Calkro_R0009"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            400181..400297
FT                   /locus_tag="Calkro_R0010"
FT   rRNA            400181..400297
FT                   /locus_tag="Calkro_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 99.86"
FT   gene            complement(400343..401290)
FT                   /locus_tag="Calkro_0291"
FT   CDS_pept        complement(400343..401290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0291"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: ate:Athe_2560 ATPase associated
FT                   with various cellular activities AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45202"
FT                   /db_xref="GOA:E4SDK9"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDK9"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADQ45202.1"
FT                   /translation="MEIASVAKKIIQNISKVIVGKEAQIELVITSLFAGGHVLLEDVPG
FT                   TGKTMLSKALAKSINCSFKRIQFTPDLLPSDLTGIYYFNMKTQEFEFRPGPIFTNILLA
FT                   DEINRATPRTQSSLLECMEERQVTIDGITHKLEDPFFVIATQNPIEIQGTYPLPEAQLD
FT                   RFLIKLSLGYTNKEETIKMLTRFREKNPLDSIEPVVAKDEVIKIQEKIKEVYVNEDILS
FT                   YIYEICQSTREHEMVQLPASNRSFIALMRASQSLAAVRGYDFVLPDFVKYLAPFVLSHR
FT                   ILLKNQYIIKNAKSSDVINEILEKVPVPSENFAF"
FT   gene            401557..402012
FT                   /locus_tag="Calkro_0292"
FT   CDS_pept        401557..402012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45203"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL0"
FT                   /inference="similar to AA sequence:KEGG:Athe_2559"
FT                   /protein_id="ADQ45203.1"
FT                   /translation="MANEILGTDVVVQIGIIVKDIEKTAKDFAQFFGVEVPQIIETEEY
FT                   EKTHTEYRGKPTNARAKLAFFRNFKNVEIELIEPDENPSTWREFLENHGEGIHHIGVFV
FT                   KNMDEKIENFKKEGIEVLQKGDYTGGRYAYMESTNKLKFILELLENF"
FT   gene            402046..402690
FT                   /locus_tag="Calkro_0293"
FT   CDS_pept        402046..402690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45204"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL1"
FT                   /inference="similar to AA sequence:KEGG:Csac_0293"
FT                   /protein_id="ADQ45204.1"
FT                   /translation="MKKILALLGDFYHSHDNLLKALQQATSTALDNCEIIDASIENFEE
FT                   FLSQNPDAIVISAENRVNPQDEIVKCWMTEKVEKRIKEYVEGGGRLFVWHSGLASYPEE
FT                   GEFFKLVKGYFKFHPDKHKLVRYHSLHEATLDGKKFDFEIIDEHYFVFCDKENINIYLY
FT                   SESEDGSSIAGWWHNFGKGKVVALTPAHREDGLLDNNFQELLKAVLTFLFK"
FT   gene            402866..403498
FT                   /locus_tag="Calkro_0294"
FT   CDS_pept        402866..403498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2557 N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45205"
FT                   /db_xref="GOA:E4SDL2"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2557"
FT                   /protein_id="ADQ45205.1"
FT                   /translation="MDITRFKEDLKAHLEEKIVPFWQSLKDDEFGGYYGYMGFNLNINR
FT                   EAQKGCILNSRILWFFSACYNILKNASWLLDEAAKYLKDEKLKEEVEKLTLEVAKVTLK
FT                   EAFDGQSLINEKVEDKIDRSKIWWVEAETVVGFFNAYQKSKEEKFLDATIKTWEFIKEY
FT                   LVDKRKNSEWLWKVSEDLKALDMPIVEPWKCPYHNGRMCLEIIKRVD"
FT   gene            403602..404609
FT                   /locus_tag="Calkro_0295"
FT   CDS_pept        403602..404609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0295"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2556 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45206"
FT                   /db_xref="GOA:E4SDL3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL3"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ45206.1"
FT                   /translation="MDKRVTMKDIAEKLGVSKVTVSKALKDSPDISASLKEKIIKTAQE
FT                   MGYIYNAKGRMLRENLTYSIGVISSEKYYGKDDYFYIDLYKHLSNSLEKLGFTTTFNII
FT                   SQSDENELSVPNALLEQKVDGVVILGQMNLDYIQKILSYDYPTVFLDFYCDKFNVDCVI
FT                   TDNFYATYEITNMLIEQGHTKIGFVGNIYATSSIQDRFLGFYKALLENKIDLNKDWIIK
FT                   DRDDNNNFIDIVLPKNLPTAFVCNCDKTAYLTIEKLKSSGYKVPDDVSVVGFDDSLHAV
FT                   LSEPKITTVRVNLEEMGRRTAKMMVEKIKQGEKHYGKMLIKGKVIIRESAKALK"
FT   gene            404682..405668
FT                   /locus_tag="Calkro_0296"
FT   CDS_pept        404682..405668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0296"
FT                   /product="glycosidase related protein"
FT                   /note="PFAM: glycosidase related protein; KEGG:
FT                   ate:Athe_2555 glycosidase PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45207"
FT                   /db_xref="GOA:E4SDL4"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL4"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADQ45207.1"
FT                   /translation="MDIKIIGQSLPNMPWEERPKDCKDIVWRSKYNPIIKRNQAKDANS
FT                   IFNSAVVPFKDAFAGVFRVDDRARRMNIRRGFSKDGYNWEIDDEPINFIQQTRDPLVSE
FT                   YKYDPRVTFIEDRYYITWCNGYHGPTIGVGYTFDFEKFYQIENAFLPYNRNGVLFPRKI
FT                   NGKYAMLSRPSDTGHTAFGDIFYSESPDMIHWGCHRHVMSAGYTPWQSLKIGAGPTPIE
FT                   TSEGWLLIYHGVLLSCNGYVYSFGAALLDLEKPWIVKARSKSYLLSPQEYYECVGDVPN
FT                   VAFPCATLCDASTGRLAIYYGGADTVVNLAFAYVQDIIELLKRESQE"
FT   gene            405924..407570
FT                   /locus_tag="Calkro_0297"
FT   CDS_pept        405924..407570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0297"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2554 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45208"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45208.1"
FT                   /translation="MFKRRVALLVAIAFLMTIIVPGFFSAPTKAVAASKNPIVFKIYWG
FT                   DSNAEPVDVWKTPIGKKVEQITGVRLQFEFIVGSDEETKAGIMLASGDLPDLINAHNVV
FT                   NKFIEAGALVPLDNYIAKYGKNIKKWYDAKALKKIKYPKDGHIYYLTPFREESDPLYSF
FT                   AGFWLPIYVLKENKWPVVRDIDTYFKIVKDAVKKHPTYNGKPTIGFTALTDSWRIYVLM
FT                   QQPLRLEGYPNDGGWLIDEKTGVVKDSYTMPYAKTYYKILNQMWNEGLLDKEMFSQNYD
FT                   QYLAKISSGRVIGFYDERWQIQSAIDSLEKQGLYDRIPIAMPVLKKGVKRDRYNVVTMG
FT                   TGAGISITKKCKDPVAAFKFLDRMAGEDILKLINWGIQGQDYYVKNGKMYKDAKQIQNY
FT                   MNPDYRKKQGIGGNIWFAFPRPPFDWTYSDKSGKISWDYSDQALEQRYKPYEKEVLKAY
FT                   KIKSFKDLFSPTWNSPYGYGWDIKLPDDLQAIQNQADDLQRRYVTKAIMAKPGEYDKIW
FT                   NEYLNKMKNIPIKKVIDFRQKEIQRRLKEWN"
FT   sig_peptide     405924..406022
FT                   /locus_tag="Calkro_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.889 at
FT                   residue 33"
FT   gene            407682..408608
FT                   /locus_tag="Calkro_0298"
FT   CDS_pept        407682..408608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0298"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: csc:Csac_0298
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45209"
FT                   /db_xref="GOA:E4SDL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45209.1"
FT                   /translation="MQSSKKGIFSTIYNQRQLIVLTFPFLIMVLIFNYFPLWGWLLAFK
FT                   DYKPYLGFQNSEWVGFKNFADLFSDVYFFQALRNTLVISCLKLIFNFLSSITFAILLNE
FT                   IKNMLFKRTVQTISYLPHFVSWVVAANIVYTVLSPDYGIINDLLVKFHIIKEPINFLGE
FT                   PQYFWFIAPATEVWKEMGWNAIIYLAAMTNIDPQLYEAASIDGAGRLKRIWYITLPGIL
FT                   PTVKILLIMNVGWILNAGFEQMYLLQRPSTLDYSDILETYILRYGIGSGRWSYATAAGI
FT                   FNSVVSLILVTTANKVASKIGEGERVF"
FT   gene            408638..409540
FT                   /locus_tag="Calkro_0299"
FT   CDS_pept        408638..409540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0299"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2552
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45210"
FT                   /db_xref="GOA:E4SDL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45210.1"
FT                   /translation="MQTSAKYRTTEDLVIDIVVYTVMIIVMIATLYPFWNILAISLNDA
FT                   LDTIRGGIYLWPRKFTLNNYRVILSNPDIYHATLISVLRAVIGSITNVLSCLMVAYAIS
FT                   RKDYIFRKFISRVIVFTMYFSGGLIPTYLLMKNLHLVGTFWVYILPGMVSAFNIIVIRS
FT                   YIDGLPQSLIESAKIDGASEYRILFQIIMPLCLPVLATVTLWVAVGQWNAWFDTFLYNS
FT                   GKPELSTLQFELQKILQSVQSASTNPDFSASLTSSGRTVTPTAIRATMTIVATLPILFV
FT                   YPFLQRYFIHGLTIGSIKE"
FT   gene            409589..411391
FT                   /locus_tag="Calkro_0300"
FT   CDS_pept        409589..411391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0300"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ate:Athe_2551 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45211"
FT                   /db_xref="GOA:E4SDL8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL8"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADQ45211.1"
FT                   /translation="MKRFMRRSVKIVNDIPLFKKIFSIFFIFVFIPLLVLSSQFISQID
FT                   FYINDKLHSQLENASSITISNFKKAIELAINLAYTIYSDPRIIETVNTRYMSVEEFYDA
FT                   YEKNIKPILQNARILYPQISQITIYCDNPTILNADGLAFLTDEYKKFLQKGEKEGKNLY
FT                   VLSGLENEKPYVSIVLNLNFYEQYVPKYQQSTIKKFLRIDLNRVYLNSILSTFKDGHIF
FT                   IADKKGTVYFSDLLYYNQVGRLSELLKEEKNQTIVFEKLLSTELPYFENWRYIVTTNNS
FT                   GISKRLFEHQRNYLAIVVLCFTLAFFALFLIVNSVVSRLSVLARHIKKARKQQFESINI
FT                   EAGKDEIGQVIEEFNIMTQKIKELLEKEIKYELRQKELALEKKQAEINALQSQINPHFL
FT                   FNTLETIRMRSMLKKEFETANAIKLLAKLLKRSIRWENDLITIEEEISAIYDYLEIQKY
FT                   RFGEKLKFEIEVEEDVKSTKIPKMTIQPLVENACVHGVENSKGEGRIVVKVLKEGDMIA
FT                   IHVEDNGIGLEDDKITELLRSVKGLSSDKVSSVGLKNVFRRLELFYNKDFSFEILRSQL
FT                   GGLKVVIKIPNKRDFEYAVQSVDS"
FT   gene            411366..412874
FT                   /locus_tag="Calkro_0301"
FT   CDS_pept        411366..412874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0301"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: ate:Athe_2550 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45212"
FT                   /db_xref="GOA:E4SDL9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDL9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45212.1"
FT                   /translation="MLYKVLIVEDEVFMREGLKNLIDWKELGFEIVGEAEDGISAFEFL
FT                   KKMQVDVLISDIKVPLLSGLDLIERVKREIKNLPEVIIISGYADFEYAKKAIQHGVVNY
FT                   ILKPIEEEELVDTLIKVKSKLKKRELIKKGESLLALERSFKETIESNNIKIENGVYVGI
FT                   VYFIEMSSWLSLYFDEGIENILSRINGCFEQLKKERLMYEFSEIDGKYYVVTTSEEDIK
FT                   KAYQSIKEMVDFATEIVFAFSRRITKWAQFFDAIYEAAYSLNFALFYNQTGITFYSSSL
FT                   PSSKELLYSKEYDKNLILAIEEENSQNLQKIIKEMLEDIKKGRYKLDFLKTYLSFVVVS
FT                   ISSYFSRMGLNLEDEIEYFSGLRLEFSNVEDIEKSMLKFCEGILNKFRQWKTSLSNGIM
FT                   SELEKYIKENYNKNLTLKSVAQKFYLNPVYLGQLFKKHYGMYFNSYLQKIRVEEAKRLL
FT                   MSTNMKIYEISQAVGYNDTDYFIQCFTKFCNMTPNQFRKKYRKV"
FT   gene            complement(412945..415218)
FT                   /locus_tag="Calkro_0302"
FT   CDS_pept        complement(412945..415218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0302"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase; KEGG: csc:Csac_0302
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45213"
FT                   /db_xref="GOA:E4SDM0"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM0"
FT                   /inference="protein motif:TFAM:TIGR01371"
FT                   /protein_id="ADQ45213.1"
FT                   /translation="MISVVGFPRIGQNRELKRWVENYLDKKISKEELIQNSKNLKKTHW
FT                   QLQKEYGVDLIPSNDFSFYDTFLDHAMLVGSIPEEFKKVFSDELDLYFALAKGYQDKNI
FT                   DLKALPMKKWFFTNYHYLVPEITENTKFELSSTKPFDEFDEALSIGIKTKPVLVGALTF
FT                   LKLSKKSNVDIYDKSFWEKLLDVYIQILKRFEELGAEFVQIDEPILVTDLSTKDIELFE
FT                   SFYRSLLSHKGKLKVLLQTYFGDVRDCFEKIISLDFDAIGLDFVDGKFNLELIKKFGFP
FT                   HEKLLVAGVVNGRNVFKNNYQNTLELLNILSSFVVKKNIVLSTSCSLLFVPYSLKFETN
FT                   LDSNKKKFLAFAEEKLKELSELKLLFSQENFTANNIYIKNVQLFEELEKNKLSDVSTAV
FT                   NNLKEDDFERKPCFEERIKLQKEVLNLPQLPTTTIGSFPQTQDVRSARSKLKKGEITFE
FT                   EYESFIKSKIERVIKLQEEIGLDVLVHGEYERNDMVEFFGENLEGFLITQNGWVQSYGT
FT                   RCVKPPIIFSDIKRKRPITVEYIKYAQSLTKKPVKGILTGPVTILNWSFVREDIPLKNV
FT                   AFQLALAIKEEVLELEKEGVKIIQIDEAALIEKLPLRRCQHSEYLSWAIKAFRLSCSKV
FT                   KPETQIHTHMCYSNFDELLDEIAKMDVDVITFEAAKSDFTLLDSIKKSNLKSEVGPGVF
FT                   DVHSPRIVSKEEMKKLILKMIEKVGKDRLWINPDCGLKTRKEEEVLPTLQNMVLAVWEV
FT                   RNNL"
FT   misc_binding    complement(415474..415698)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 127.52"
FT   gene            complement(415978..416922)
FT                   /pseudo
FT                   /locus_tag="Calkro_0303"
FT   gene            complement(417026..417487)
FT                   /pseudo
FT                   /locus_tag="Calkro_0304"
FT   gene            complement(417557..418562)
FT                   /pseudo
FT                   /locus_tag="Calkro_0305"
FT   gene            418975..419568
FT                   /locus_tag="Calkro_0306"
FT   CDS_pept        418975..419568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0306"
FT                   /product="Methyltransferase type 11"
FT                   /note="KEGG: csc:Csac_0172 methyltransferase type 11;
FT                   manually curated; PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45214"
FT                   /db_xref="GOA:E4SDM1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADQ45214.1"
FT                   /translation="MNTKEYFNSLADKWDVLIKHDIDKIEFLLGLLKIKKGSYILDVGC
FT                   GTGVLTEHLLKRVGSEGKVFGVDFSEKMIDIAKSKFNDFPNVEFIVEDVNLLTFKNYFD
FT                   YIICYSVFPHFEDKKKVLKQLHKMLKNGGILLIAHSQSRKAINQLHKSLPAPVNNHFLP
FT                   NTYFIKMIAKEYFFNIETIDNGEIFAIVLKKKNL"
FT   gene            419923..420204
FT                   /locus_tag="Calkro_0307"
FT   CDS_pept        419923..420204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_1593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45215"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM2"
FT                   /inference="similar to AA sequence:KEGG:Athe_1593"
FT                   /protein_id="ADQ45215.1"
FT                   /translation="MVKILNFKYNGVNLKEVYLKEICTKKEKEDKILKEIVRKNVKKIK
FT                   KHIEKIRNNVPILARGKVDLMFRVLKGLSTGDFLKCSRVLIKNFPTNS"
FT   gene            420462..420782
FT                   /locus_tag="Calkro_0308"
FT   CDS_pept        420462..420782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45216"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM3"
FT                   /inference="similar to AA sequence:KEGG:Csac_1406"
FT                   /protein_id="ADQ45216.1"
FT                   /translation="MEIVIDEIRKLAKERKIKWQNHMIQRMRERNITRTDVLECIQEGE
FT                   IIEQYDKDYPYPSCLILGRTKKGNVLHVVCAVGEGWLWLITTYYPSKDEWCDDFKTRRK
FT                   KE"
FT   gene            420779..421009
FT                   /locus_tag="Calkro_0309"
FT   CDS_pept        420779..421009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45217"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM4"
FT                   /inference="similar to AA sequence:KEGG:Csac_1407"
FT                   /protein_id="ADQ45217.1"
FT                   /translation="MKCSLCGASMIEGKVKHIVDTEKQTIIIKDVPALVCHQCGASFLD
FT                   DEVAEKLEKIVDELLKSKTEIVIANYSEIAA"
FT   gene            421272..422687
FT                   /locus_tag="Calkro_0310"
FT   CDS_pept        421272..422687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0310"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; KEGG: ate:Athe_2443 HNH
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45218"
FT                   /db_xref="GOA:E4SDM5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM5"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADQ45218.1"
FT                   /translation="MVIFTVDKHGRPGHPTRRFDMVRKLVKQGRAKIIGGGTSGKPPVV
FT                   MFLDREFDYTKTIERRLFVVLDPGYHHIGFAVCELRWGVLIVYCIGVLETRIPEIKDLM
FT                   TKRRGYRRNRRYHSRCRKKRMSKRQSRVLTKFKAPRNVRTKDRTNATLRHGIETHLNLY
FT                   KKLLKFFPFPVEQFVFVMEDNIFDVRTMTWGKTDGTGYQKSPRVPAEKKCILCGTEDNL
FT                   QKHHLIQRKCGGTDVQENVVYLCRDCHEDVHAGRVYIPVDGVKQWRALGTVNAIIGRLR
FT                   EIPWLKFVPASDVVQMRKRLGLEKGHANDALATAAVFCNCTETDRTHMIELNMVKFRRH
FT                   NRARIHAVRDRLYKVDGKIVAKNRRKRTDQKEPSFADISPLPPEIQRKLKVYPGTKILN
FT                   PLRKEMPTIAGEVWVHEPTGKRFVTTGVVSQKYLYSPQLEKIVGKTYVKPEECKRILRN
FT                   EGIVVMYNSLYHS"
FT   gene            422805..423005
FT                   /locus_tag="Calkro_0311"
FT   CDS_pept        422805..423005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0311"
FT                   /product="Uncharacterized protein family UPF0150"
FT                   /note="PFAM: Uncharacterised protein family UPF0150; KEGG:
FT                   ate:Athe_2006 protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45219"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM6"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ADQ45219.1"
FT                   /translation="MLFTVVVSKEDNWYIAKCIENSVASQGKTIEEAIANLKEALELYY
FT                   EGEEIQRPQMPPLITTIEVAV"
FT   gene            423006..423202
FT                   /pseudo
FT                   /locus_tag="Calkro_0312"
FT   gene            423896..425512
FT                   /locus_tag="Calkro_0313"
FT   CDS_pept        423896..425512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45220"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2669"
FT                   /protein_id="ADQ45220.1"
FT                   /translation="MKKLLSFAIILSLLLSLAFPVAQARTITQKVQAAINKIDYITAGE
FT                   FVTSLLLGANVKPNGIADYWGKAQTMGLIPGEVKKDKPLTRAQASYIVWKLINAVPELK
FT                   DKNIPVKTEILTPWDLTLRGRGYLYDYMTDLDFVLYWSDLLIIDYYYADGRVKTKYVWD
FT                   VLKGYVMRDDYAKFLQDFAKKCPDKLKFAPKTEGGYIKYDKEFKSYYYQLSFDPKSYYP
FT                   ILIRTKDSGGREWNIAYDPRANKYLEEYIKNHPRKFALDHTRFAQMADDYTKIPQAYRE
FT                   PMLRLADLGIITPEMSPLYVSKIRFNPAKMLTRAEAVAMISRVFDESKREVYDEFKWQL
FT                   RSYVDMKTGIKYYWDEYKRIYRPMMSIYNKNEYDRLESSDTPKFGEPILTFRMDEMKLL
FT                   ARIKQAIKNVSDPLIGDSFVRYSFAGLEFIMPWVFDSSIIPWEDKPFYRKPWYYKMDFN
FT                   YLLVPLAYKKEAIADAKHYTNPKTKLPADGIVKWYGDVCIWYVNLNGEDNVGYWCTTNP
FT                   TYKGYFEKAKVLYAKPDPNIK"
FT   sig_peptide     423896..423970
FT                   /locus_tag="Calkro_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            425531..426787
FT                   /locus_tag="Calkro_0314"
FT   CDS_pept        425531..426787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0314"
FT                   /product="PKD domain-containing protein"
FT                   /note="KEGG: ate:Athe_2668 PKD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45221"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2668"
FT                   /protein_id="ADQ45221.1"
FT                   /translation="MQRRKKSLLKALSFLVVFSILLSLFPVFPPVVKTMADNFSDKRDE
FT                   VYEGGSNFSEYKGVTRDKCAESYGVFKEIKIPSTSSAADNLTSYAKQKCQSGVYGYGIE
FT                   IKDNKTYYIIPLNVEATIDRGYAIYGIPEDVADNFTKAQPGFKQVSNGYFYATLGADEY
FT                   YHLSSPGNGVRGYFRYWGFSQTGAVQSDKDFPPDRDYVPVTSSTKILYKPWQNSTAKQI
FT                   CAVADSYNPSNVSPNAITQVWSALSRFKDMKGQTLADAINITQTQYGSKISSASMLADY
FT                   AMISNATPYAGAQVVLVLQEADGWIHYRTYDGIPPRAKPQVTTDSMSYKVTSQSYLVKN
FT                   SDGTLKYDPAVNYDPVLYIDITGKMTDYWYTNRNKLYYKAFNYTRDDVTKYAARITSVK
FT                   INGQSVRDLSRIMCFQFIT"
FT   sig_peptide     425531..425641
FT                   /locus_tag="Calkro_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.748 at
FT                   residue 37"
FT   gene            complement(426788..427998)
FT                   /pseudo
FT                   /locus_tag="Calkro_0315"
FT   gene            428082..428696
FT                   /pseudo
FT                   /locus_tag="Calkro_0316"
FT   gene            complement(428891..428983)
FT                   /locus_tag="Calkro_R0011"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(428891..428983)
FT                   /locus_tag="Calkro_R0011"
FT                   /product="tRNA-Ser"
FT   gene            429344..429616
FT                   /locus_tag="Calkro_0317"
FT   CDS_pept        429344..429616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0317"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="KEGG: csc:Csac_0337 hypothetical protein; manually
FT                   curated; PFAM: protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45222"
FT                   /db_xref="GOA:E4SDM9"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDM9"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADQ45222.1"
FT                   /translation="MVDKLHLQQLKKDIEALKGEKVLIRANKGRKKMIEVEGILENTYS
FT                   NIFVVKFPVDRECKQFRCVTYTYSDLITNTVEIILCRTNTKVSVM"
FT   gene            429810..431345
FT                   /locus_tag="Calkro_0318"
FT   CDS_pept        429810..431345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0318"
FT                   /product="Peptidoglycan-binding lysin domain"
FT                   /note="KEGG: ate:Athe_2402 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45223"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDN0"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADQ45223.1"
FT                   /translation="MEKRFEKVEYMNVYGTDSQKVIVEGEILLPEMKPDALKVLQTDSE
FT                   VLITNVEILNDRVIVQGEIEFKVIYLSSDPQRKVVSVSSSAEFSKTFDILGVRPTMAYE
FT                   VKDDLIYTFCSLLSPRKLSAKAIAEITVLIKAPATVEYLADIEEDSIKYLKEKISISNP
FT                   RTMTEEISKREILEIPQGKPSIREILRCFARLSDRNIKFDRKKMTFDLKVDLKTLYSPD
FT                   IGQNPIEMVEHEVLIQHYSELPDSPDDVEPVVKFYIKSFRVLPKTDEIGELRRIEYDIT
FT                   IEAEITFHAVKTIEPIVDAYSTAYEIKDSKKLLSIEQFVGKARHMHLLKDTITLPIEPE
FT                   QVFSVSGRIEVDVIKPEKNKVNVKGVAVIFLIYLSKDQQDIIKNTTSQIPFDLKLDLEG
FT                   VEETDRTFANIEIENISFSIISTSEIELRIHLAIEVWIKRALSKEILSDLELVEEIKKE
FT                   EERLASVYIYTVQKGDTLWKVAKKYRTTVEKIIDFNQIEKEEIVPGQKLLIVK"
FT   gene            complement(431396..432763)
FT                   /locus_tag="Calkro_0319"
FT   CDS_pept        complement(431396..432763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0319"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: ate:Athe_2401 UDP-N-acetylmuramate/alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45224"
FT                   /db_xref="GOA:E4SDN1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDN1"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADQ45224.1"
FT                   /translation="MNKYFFIGIGGISMSAIALILKNQGFCVEGSDIQESATTKMLREN
FT                   GINVYIGHDESHIHGDETVIYTAAISKDNPELLAAKRMNLKIYERAEFLGLLMRNFKNV
FT                   IAIAGTHGKTTTTSMIGYILKKANYNPTILVGAFVKQLGGNFVIGSKDYLVVEACEYVD
FT                   SFLKFKPTIGVILNIDNDHLDYFKDIDSIKESFRKFAMKIPSSGFIVANCDDKNVKDVI
FT                   SKLHTQVVCISTKEKADIFADNISYNDGYYEFDVKNKNNEILAHIKLNIPGFHNVYNAL
FT                   AAFAVASKLRIESFTIEQTLSEFCGASRRLEKVGEFNGIYLYDDYAHHPTEIKATLATL
FT                   KKISEGKVLAIFQPHTFSRLKTLLNEFAESLKLADKVIVTDVYAAREKNVFGITSEKLY
FT                   LKLKEIGIDCEYISNFEDIACYVVKEAKKGDIIATIGAGDVNKCIDIILKKAPVKS"
FT   gene            433127..434134
FT                   /locus_tag="Calkro_0320"
FT   CDS_pept        433127..434134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0320"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2311 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45225"
FT                   /db_xref="GOA:E4SDN2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDN2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ45225.1"
FT                   /translation="MKYTIKDIAKMTGYSVATISRALSGKKGVSEEKRNEILRIIDQLG
FT                   YIPNQSARKLRSKQTKNILVMIPDIENYFFNKLIKGIEAEAREKGYNIILGDFSDSQEI
FT                   EEEYYKMMKGQIADGILIVGSLSGPQKVIEMSRQFPMVVISDYFSDELVTVCIDNFKAA
FT                   YDATMFLYKCGYRRIAKITGKIGSILSQDRLKGYRMALENLGLDRDEKYIKYGDFKYES
FT                   GYRLAIELLNAKPCPDAIFCSNDEMAIGACDAAKDLGFSIPDELGIMGFDNIELSSIVT
FT                   PKITTVHQPRYEMGKLAAQLLIKKLTGEKVSKGKYILDTSIIPRDSTKNANITK"
FT   gene            434355..435632
FT                   /locus_tag="Calkro_0321"
FT   CDS_pept        434355..435632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0321"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2310 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45226"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDN3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45226.1"
FT                   /translation="MKRFIAVMVLIAFSVGLFLAFGPANSNAASKKQVTITYVRGKDET
FT                   HATEKIIKEFMKKNPDIKVIYKENPSDTGQNHDQLVTVLSAGGSDIDVFDMDVIWPAEF
FT                   AQAGYTLPLDRFIKRDKINLNDYIKGTIDAARFKGQMWAFPRFIDAGLLYYRKDIVPQN
FT                   ELPKTWDDLIKVAKKYKGKNGTKYGFLMQAKQYEGLVCDAIEYIASYGGKVVDESGNIV
FT                   VNNQGTIDGLNMMRKVITSGIVPPNINTFTEVETHTAFINGLSVFARNWPYMWAMVNSP
FT                   QSKVRGKVGILPLPKGSKGSAACLGGWMVGINKFSKNPEASWRLLKFLVQKEGQKLMAI
FT                   YNGNVPVYKPLFNDKDVIKANPLIGDKKFIEAILAAVPRPVSPIYPKISDVMQIELSNI
FT                   VNGKKDVKTAVADMDKKLKEVVKTSK"
FT   sig_peptide     434355..434441
FT                   /locus_tag="Calkro_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.916 at
FT                   residue 29"
FT   gene            435707..436990
FT                   /locus_tag="Calkro_0322"
FT   CDS_pept        435707..436990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0322"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2309
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45227"
FT                   /db_xref="GOA:E4SDN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDN4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45227.1"
FT                   /translation="MDRKEKVFGYLFLLPAVLIFIFVAVIPLVQVFVFSLFDIQLNNPT
FT                   KSEVSLSYKIDVENYANTLFTATSIIDSINMEALNDSQKKTISRIKHLLAMMEKSIFNT
FT                   KTRIDRLNKVNELLNNFHPVDNKLKYLPVAAKEINQYNTYFKKIMDLTNSLPNTQEMND
FT                   LKQALLAFDQVIVKPNFVGLQNYSYYLKDSRLFSAVKNTLLFTVITVFFELVFGLMLAV
FT                   VMHKVANLKNVFKSIVLLPWAIPTVISALMWKFMYDGQVGILAKFFADIGLIKSSADLL
FT                   SSTTNAMIAAMTADIWKTTPYIAILLVAGLQTIPESLYEAAKVDGANAVYQFFRITLPM
FT                   LKPTILVALLFRTLDAFRVFDLIYVLTGGGPANSTETVSIYTYKTLFNQLDFGRGSTLA
FT                   VLIFIMVTIISFIYIKILGAEVFSHQKR"
FT   gene            437000..437851
FT                   /locus_tag="Calkro_0323"
FT   CDS_pept        437000..437851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0323"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2308
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45228"
FT                   /db_xref="GOA:E4SDN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDN5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45228.1"
FT                   /translation="MKNKKKLTAEKIAKIVMNIIIVLALIVILFPFYWLFLTSIRPKSE
FT                   IFNISSLITLKPHIGNYKMVFTERPFARYILNSFVIGLETTIISIVIASFAAYAIAKTN
FT                   ISPKIKNIVLSLSLAVSMFPQITIVSPIYVMVKNLGLRNSFFGLLIPYTTFSLPLAIWY
FT                   LTTFYQGVSHEIDEAAKIDGCNTFQIFYKIITPLIAPGIFTAAILIFISAWNEFLFALV
FT                   INTDDIWRTVSVGIVMFQGRYTIPWDEISAAAIVVMIPLVLMVFIFQQRIVSGLTAGAV
FT                   KE"
FT   gene            437943..440036
FT                   /locus_tag="Calkro_0324"
FT   CDS_pept        437943..440036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0324"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: csc:Csac_2489 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45229"
FT                   /db_xref="GOA:E4SDU2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADQ45229.1"
FT                   /translation="MSLDIKKFKKLFSTLPGKISLLIFSVILILVLAIDIFAVTSSTST
FT                   LRQNLQSSISTSTFQSGKYFDQILERAKDLSFQLATNETIQKYLNVQRISKDDYEKLDW
FT                   KKNAQRALLSIVSANKFLSGVYILIDKESSLGYPTLSFDNINFKNLMNSSWAKAAFENE
FT                   QGFIRCSDHNQYFNDILKEVGSDIRDYATSVVRVLYDSSSGNKVGLIVVDIGKDIFDEM
FT                   LSNIKVTKNSTSFVVTPDANVIFPNNMNDNLKKNLKTLSANLLKKADKKEIDNFELNLA
FT                   GKWLVSYSKSPDSGYLYVSLVPVSDINSKIVRLQIFIILVSLIFGVLGIILGLFVTLRI
FT                   TKNVKILLDSMSRAANGDLTMTAKVSTNDEIGMLSEGFNSMVQQLKELIIKIKELSEKV
FT                   NKSISVIAGVAAETAAASHEVTKAVSEIAEGASQQAGEATAISQQMSEFSNEISGMVND
FT                   FKNMNKVSENVLVQTNEGFSAIETLYQVARKSQDTTKSMIVNVRELIEWAEKIGKIMNL
FT                   LSSISEQTKLLALNAAIEAAKAGEAGKGFSVVAAEIRKLAQQSRESTKDVEDIIKNILS
FT                   KAKFSDKVAADVESLIKLQENALENVQVSYKAMRDAISELYENLKKSLDILESIEYKKD
FT                   RIFNSVESISAVTEQTAASAQEVSAATQQQLASIEELKNMIEEIRKLSVELDTTTSRFI
FT                   TEN"
FT   gene            440135..440248
FT                   /pseudo
FT                   /locus_tag="Calkro_0325"
FT   gene            440390..441919
FT                   /locus_tag="Calkro_0326"
FT   CDS_pept        440390..441919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0326"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: ate:Athe_2306 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: Cache domain protein; chemotaxis
FT                   sensory transducer; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45230"
FT                   /db_xref="GOA:E4SDU3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU3"
FT                   /inference="protein motif:PFAM:PF02743"
FT                   /protein_id="ADQ45230.1"
FT                   /translation="MQVVLTILTALVLSVVFSILILKIFVDKTLSILQGKNNLSAIEKL
FT                   FLKPVKDWAVSFQSFLSEIFKEIDLAYNKILSVAYDIEASAEKNQQQSNLVLSNTKDIQ
FT                   SSISGLLVGLKLVLQHIEGAYTNVSDLEEFMAHFREKNQNIQEDIQKLLAEVSSDLENM
FT                   VSENTSYTQKMADQITKLKTVFKKVEDFLSTIVKISEKINILALNASIESAKLESVFGE
FT                   NFKTGFHVIADQIRKLSNDTKSTADEIRDFIIEISGIVDGISSLSEKSKDIISRQVEYG
FT                   KTTFQRLNQVSQLVDYTNKKISQASEKLSVQYSIVNDLKHYVTRLENSYIAVDLSTSRI
FT                   LSSVEVSKKTAERLMRLMNRLVDMCREFESVRNDISVKITKRVEIEVNQQRITEAIEII
FT                   ENEVIPQLVLSWQKELNHKEVIDQSLQKFSNILEALWTNNPDGTFIYSNPPEGIENAKV
FT                   REWFTKAVAGHTYVSSAYISAITRNYCITVSMPVYDGIGKLLGVIGADIKL"
FT   gene            442062..443039
FT                   /locus_tag="Calkro_0327"
FT   CDS_pept        442062..443039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45231"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU4"
FT                   /inference="similar to AA sequence:KEGG:Csac_2486"
FT                   /protein_id="ADQ45231.1"
FT                   /translation="MQQKVPHNQYDLTFKRLFQFKEVFLNFLRGNINREWVNRIDAESL
FT                   EFVDRSFIKDEFVEKEADVIYRARLEDTDIYFYVLIEPQSTADKSMPKRLFEYMSLVWK
FT                   RHMEEKADELLPPIVPIVLYNGRSSWNIPTQIFKGFDIFKNDMFNYILVDVNRLDDEKL
FT                   KSRLDLLSIILYLEKSRRNAEEFVEKLNEVSEYVCKLPQSQLKVFCSWLLRIVKPQVIE
FT                   EMKSRIDELLKKIEAEGVEDVGEFIFNVQQLIQEYYREAEEKGKEKGYEEGIQEGIQKG
FT                   IQRKEEEIVRRLIQKGFDDNFIAEATGVEIERIKKIREEYTKYS"
FT   gene            443378..444769
FT                   /locus_tag="Calkro_0328"
FT   CDS_pept        443378..444769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0328"
FT                   /product="Conserved carboxylase region"
FT                   /note="PFAM: Conserved carboxylase region; pyruvate
FT                   carboxyltransferase; KEGG: csc:Csac_2485 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45232"
FT                   /db_xref="GOA:E4SDU5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU5"
FT                   /inference="protein motif:PFAM:PF02436"
FT                   /protein_id="ADQ45232.1"
FT                   /translation="MKRIYITETVLRDAQQSLIATRMPYEDFDGILEKIDKAGYYSIEC
FT                   WGGATFDSCLRYLNEDPWERLRKIRSKVKNTKLQMLLRGQNLLGYRHYPDDVVRMFVRK
FT                   SIENGMDIIRIFDALNDLRNIEVAVDETIKAGGHAQGTIVYTISPIHSLEMYVKIGKDL
FT                   ESMGVHSICIKDMAGIMSPKEAYELVKALKENVKVPVFLHTHSTTGLGILTYLKAIEAG
FT                   VDGIDTAISSFSGGTSQPPTETLSYALKQMGYDTNLDNKLLKEINDFFKPVKDKFIKNG
FT                   ILNPFVLSTDTDALIYQIPGGMLSNLIAQLKQQNALGKLDEVLMEVPRVREDLGYPPLV
FT                   TPMSQMVGTQAAANVLSCERYKVILKEVKAYIRGEYGRPPGEINPELVKKVLGDEKPIE
FT                   GRFADTLEPIFEKTKEQIKDFAKTDEDVLSYILFPQVAEEFLKNRGKKKEPRERKIEYT
FT                   IEGIS"
FT   gene            444801..445157
FT                   /locus_tag="Calkro_0329"
FT   CDS_pept        444801..445157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0329"
FT                   /product="sodium pump decarboxylase gamma subunit"
FT                   /note="PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   csc:Csac_2484 sodium pump decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45233"
FT                   /db_xref="GOA:E4SDU6"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU6"
FT                   /inference="protein motif:PFAM:PF04277"
FT                   /protein_id="ADQ45233.1"
FT                   /translation="MEYSTLGQRFILGLEVTVIGMLIVFAVLALLCWIISLLSGFLQRF
FT                   EKPKKAAEDELPSLEIDETQEYKSVEKTGFTSGEANVIDADDEEIAAILAAVAFECDIP
FT                   LSELKIKSIKPVKE"
FT   gene            445187..445537
FT                   /locus_tag="Calkro_0330"
FT   CDS_pept        445187..445537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0330"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: csc:Csac_2483 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45234"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU7"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADQ45234.1"
FT                   /translation="MKYIVTINGKKFEVEVERVSNGNGQLEASTASKKVSSDEISKVVT
FT                   GGIKVSAPMPGKILSVNVQEGKKVKKGDVLFILEAMKMENEIMAPEDGTVEKVLVSKGA
FT                   QVASGDILAILK"
FT   gene            445556..446692
FT                   /locus_tag="Calkro_0331"
FT   CDS_pept        445556..446692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0331"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; KEGG: csc:Csac_2482 sodium ion-translocating
FT                   decarboxylase, beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45235"
FT                   /db_xref="GOA:E4SDU8"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU8"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ADQ45235.1"
FT                   /translation="MEFFHMITKAISDILTTSGFAKITLGQAIMLAISCILIYLAIGKK
FT                   FEPLLLLPIAFGMMLANLPLSFLSSHEKGGLIYYLYQGVKLGIYPPLIFLGVGAMTDFG
FT                   PLIARPISLFLGAAAQFGIYFAFMVALLIGFTPQEAASIGIIGGADGPTAIFLTTKLAP
FT                   HLLGAIAIAAYSYMALIPLIQPPIMKLLTTKEERMVKMEQLREVSKLERIVFPIAVTII
FT                   VSLLLPSVAPLIGCLMLGNLFRECGVVERLSDTAQNALINIITIFLGLSVGATATADRF
FT                   LNPKTLAIIFLGLLAFIFATVGGVVFGKIMYKLSGGKINPLIGSAGVSAVPMAARVSQV
FT                   VGQKENPSNFLLMHAMGPNVAGVIGSAVAAGVLLTLFK"
FT   gene            446925..449066
FT                   /locus_tag="Calkro_0332"
FT   CDS_pept        446925..449066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0332"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ate:Athe_2304 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45236"
FT                   /db_xref="GOA:E4SDU9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDU9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADQ45236.1"
FT                   /translation="MKKKGIAKSRNNVNLQSLIISFLKSGKLAKRFALLIACIVIVPIV
FT                   IIDILSISMSVNSVINESKKSYLAATDSTAKYFQLAIKTAQNNATQLMSNELIQRYYSE
FT                   SKQAALEDYEKITLQTDANKAMQNVLISNNMIAGIYILVNKEKSLFNPSIVFELDYEKI
FT                   KNTGWYKKILDAGGPTIIEAHDKEFDEVAKKNNTNIPEYAFCIGLPFKDIATNETLGVM
FT                   LFDVSKNWLRDQLQESQISQQGGFMLAVSSQGQVVLPTEWENKFKNIPNKDTNFIKKVL
FT                   ENMKADKQSGAFDTVYSNQPFLITYSLIPDTPWAVIGMIPISQLMTSARKLEVISIVLT
FT                   IIFTLLALVLGIYFALRIVSDIEKITKAFEVAEKGDLTVKLDIQRDDEIGLMAHSFNNM
FT                   TKNIKQLIEKGVTLSGEVTSAISTLSTVAGETAAASNEVAKAISEIAEGASNQAKEATG
FT                   VVEVVSRFGEKIETIVESSSKMERLTQEVSNLSEKGKNAVEVLSNVSLDTENITNTMIS
FT                   TINQLAEYSRSIGKIIQVLSSISEQTKLLALNASIEAAKAGEAGRGFAVVASEIRKLAD
FT                   QSKESTREVEDMIKRIVSQTKAAQDVADKVEDVIEKQNEAVKNVSEAFSSIKSAMDDLI
FT                   DGIENINQSIMSIDKEKDTIVRSIENISAISQETAASSEEVSASTQEQLAAIEELRAMA
FT                   ESLNKLAQDLKEAMQVFKV"
FT   gene            449227..452280
FT                   /locus_tag="Calkro_0333"
FT   CDS_pept        449227..452280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0333"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   ate:Athe_2303 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45237"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV0"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45237.1"
FT                   /translation="MKKFKRLIAIVTVLLFALSIIAPAFAQDESTTESTSSVYDQAAKV
FT                   LVEKGILKGNEQGDLMLDKSLTRAEILAMIIRATGQEDVINDYKDVEPSFTDVPKDHWA
FT                   FAYVEAGKDLGIVNGYPDGTFKPDKPVKFEELAKMLVAAKGESPAAGKWPLNYVRKALD
FT                   LGLFNGIEDEVGIGDVVIRGQAAVAFANAFFQPEKTIVVKDVKAVANDTIEVYVDAYLG
FT                   NEPATLEDGDVIPLDFELKLASDETKTIAVILIDSQASDFGAGKLVLKTQAQTEGATYK
FT                   LYYKGNDTGKTFVGVPVQLQVAKVEVPNLKQVVVTFNRDVKEDVGTNVANYIVKVGDSS
FT                   KTVGAVRLSTDKKVATLILTDNLANQDKVSVTIKKDVGLTADYTQTVGPVVDSAAPSIK
FT                   SVVALTPQKIKVEFNEPINNYTDVAKYTIDGSYLVKEAKSFAEDKSIDPNVLILNLYSA
FT                   LSVANHSITISGVTDVAGYGVINPTWSFEVKADTSPIELKAATATLSKVTLTFNKPIAN
FT                   ASVSLSNGEIVKVDVDGENVIIYSNNDDLTKCIPISGTNVTATVTDYNGQSATITKYVV
FT                   PTVDNERPIVKSVVVADSKTVKITFSEDVRVSGTIVVKDKDGNQKVISNTDWDKDSNGN
FT                   YIYNTLKVTLASDLPAGNVTVEVNGVQDNTPLKNASLPVTVSATLADTSAPSVQAIVYK
FT                   EDPSNKKTYVYIVFNKTLDATSATTLANYKYLDNTFTLKEFSGASVSLMAGNKIVKLTI
FT                   PYDSANTSVWSKVVYLQIVNVADAAGNKLTVAKPNSEFLVAQQVKVTGAKAVATNKIEV
FT                   YLDGIINEYTRYPGDFVISAGSTTINAIGSDWDATNKKLTLTLGTSINADATYTVSNVK
FT                   NPLILTLKSSTTITKDLFGDSIGIASPSFTVVDGIAPSISSVKASYDSVTNATYVTVTF
FT                   SENVNLGSLNDDVIKAQFKVYIGGTLTAPNAIDKSDPSKIKFVFSNADHRYKSIKVDYI
FT                   PDYDASNRVKDTASTPNELAQTSVTGSW"
FT   sig_peptide     449227..449307
FT                   /locus_tag="Calkro_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            452601..452900
FT                   /locus_tag="Calkro_0334"
FT   CDS_pept        452601..452900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fno:Fnod_1562 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45238"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV1"
FT                   /inference="similar to AA sequence:KEGG:Fnod_1562"
FT                   /protein_id="ADQ45238.1"
FT                   /translation="MHNHNYITELLKSKDIILHQVVESEKEVELHISQTQKPHKCPKCG
FT                   SITSKIHDYRVQRVKDVPIMGKRTYLVLRKRRYVCKECGKKFFEQISFWVSDNQ"
FT   gene            453327..454004
FT                   /locus_tag="Calkro_0335"
FT   CDS_pept        453327..454004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45239"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV2"
FT                   /inference="similar to AA sequence:KEGG:Athe_2299"
FT                   /protein_id="ADQ45239.1"
FT                   /translation="MRVPKSLKAHMSLMLILTFIIAVLILSWNISYAQSNSAQNSQPDL
FT                   IGVVKSLSGSKITIYIAKLSSQSDGRGFGRGRIELTNKTQTITVSSKTSIVTKVFQNGQ
FT                   VTEKKLLTKDLKTNNILYIWYADSKKTTVSKILVQGTYDPYQTPELIGVIKNVESSRIT
FT                   ITVATMERPQPRQNTSNNQPQQRMASQPPQGGFGRGMMNLKLSSQTKTIAISKSTVIVT
FT                   RTF"
FT   sig_peptide     453327..453428
FT                   /locus_tag="Calkro_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.767 at
FT                   residue 34"
FT   gene            454179..456170
FT                   /locus_tag="Calkro_0336"
FT   CDS_pept        454179..456170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0336"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: ate:Athe_2298 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein;
FT                   biotin/lipoyl attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45240"
FT                   /db_xref="GOA:E4SDV3"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADQ45240.1"
FT                   /translation="MAEKIKPLKTSKFKFSLKSKVLKRVIISIVIVAILAGAGFGIYRF
FT                   VQGRKNQNQTVQQRTARVTRGDITVSVTGSGPIESAQSVDLTSTVSSTITNVFFKDGDS
FT                   VKKGDVIFELESQDAKDKIDSIKSQIDDVNSSIADVQESIKNLVITAPISGYVKNLNVQ
FT                   EGDRVSKGSTILTIIDTSKLKVTLPFSAALFGKVKIGAPAVVYISDISQSVQGTVSYLG
FT                   NTTYTNDYGGKVFDVEITISNPGALQEGMKASAEIKVGTEVYLSTQDATLEYVDKENVK
FT                   AKVDGEVEEIFARNNQFVEKGAVLLKLSNDDLSKQLKNYQTQLKNLQDQLKDAEDNLEN
FT                   YYIKAPFDGVVTNINFKKGDNIKAGEVLATVFDNKNLVFRVDIDELDIAKIKVGQKVNI
FT                   TVDALPETQTNPLTGKVSKIPLEGKTQNGVTTYSVTISIDNPKNLKIGMNANAEIIVNQ
FT                   KQDVLMVPLEAVQKFGNRYFVFVKSSSQNSTQEGQTGGFFPQGGFGNNQQSSAQGSQNW
FT                   RQRWQQEGSSTENTQQSTSSQSRGSWSQNSQGTGSSSQLRTRRMASLLNNSYYKGAVLR
FT                   PVEVGINNDSYIEIVSGLIEGDIVVLPPLSTGSTSTQTQTQQGFNIMGGFGGPGGGMPG
FT                   EFRQFRQNQSGTGRTNQSSGSQGSNTNR"
FT   gene            456196..456873
FT                   /locus_tag="Calkro_0337"
FT   CDS_pept        456196..456873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0337"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: csc:Csac_2447 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45241"
FT                   /db_xref="GOA:E4SDV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45241.1"
FT                   /translation="MIELYDIYKIYKMGENEVYALNGINLKINAHEFVAIVGPSGSGKS
FT                   TLMNIIGCLDTPTSGTYILDGHEVSRLNDNQLAEIRNSKIGFVFQNFNLIPQLTALENV
FT                   ELPLIYKGVPASMRHKLAKEALARVSLEHRMHHRPRELSGGQQQRVAIARALVTNPAII
FT                   LADEPTGNLDSKSGAEIIQIFKELHAQGSTIVLITHDNNIAAQARRIVRIQDGQIIEDK
FT                   EVS"
FT   gene            456877..458055
FT                   /locus_tag="Calkro_0338"
FT   CDS_pept        456877..458055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0338"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ate:Athe_2296 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45242"
FT                   /db_xref="GOA:E4SDV5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADQ45242.1"
FT                   /translation="MAQFALAFKMAIKSILSNKLRSFLTMLGVIIGIWAVIAVVGLAQG
FT                   STKSITDRLQRLGTNLIQINITGRNSNRNVTYEELQQFAEQHQDDIEAIAPTVSSSVTL
FT                   KYGTNTHDTTLVGTTADYSTVRDVNVSSGRFILPIDVDYRQKVALVGTYIVKDLFNGQN
FT                   PIGKKIKINGQIFTVVGVLEERANSQEQSDDDQVIVPVTVAQRLTRNAIIRNFAIKITD
FT                   GNRSEAVMNYLNDFLMKIYNDSTAFRVFNTAQLLDTLNSVTQTLTLMLAGIAAISLIVG
FT                   GIGIMNIMLVSVTERTREIGIRKAIGAKRRNILIQFLIEASVVTGLGGVVGIILGFVTI
FT                   RVMSKLNIATAIFSIPWAILAFTISLAIGIVFGLFPASKASRLNPIEALRYE"
FT   gene            458076..461303
FT                   /locus_tag="Calkro_0339"
FT   CDS_pept        458076..461303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0339"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   ate:Athe_2295 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45243"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV6"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45243.1"
FT                   /translation="MRKKLLTVILLLGFILVNFGLSSAFAAYKDIPSNASYKQAVEKLN
FT                   KLGILVYKDYFKPNTAILRGEFAAAIVKISNAEDEANLQKGYSQYPDIKPNTVLCGYVN
FT                   WAVKKKYMTPMADGKFNPNSPLTFAQATTAIIRMLRYSDSDLSGIWPQNYIDKASELGL
FT                   IKGINLSASQKVPRWAAALMLSRLLDTEVKSGGNQAQSGQSALSGVSASSQNSSGTKFS
FT                   EYVGLYKSYVVLDTGKTSSKLLSNEVLTDNGVLVNTTKTQLEVGKKYMLQVDSNKITKV
FT                   FGTEADSFQIVSTKVSSKTVYYKESGKTKSITLPSSATYYYNGSKQSYDAIENVLKPNQ
FT                   KISFIYSEDRSKVDYIVIKDIYAQEVYGNYDEVLILATPKTSSSLEANQVQTDKGIYFV
FT                   ASSIKPENLEIGAKYGVYIKDDTITTALQKVWVSDKFTIKNIDDYTLDVQQNGKTQKIQ
FT                   LSSKPLYYYQGTKQNYDSLSNVLKEDQILYVSKDPDTGKVMAYVIQDPYGTQYGNYIEA
FT                   IILQDALLNPALENNQVLTDKGIFYLPNINTKLEIGSKYGVYVKDDKITLVVKKLNTVN
FT                   LYEITDVVSDTNVKLKSSKGQENIILPQKPVYYYNGNKISYSDLKNALKSGQKIYFGYS
FT                   KDGKTCEYIVLQDPYSSEYGAYTEVIVLADAVVSDKLSTNEVLTDKGIYAVKSTAGKLI
FT                   VGAKYGVYIKNDTITKVVKKLNSVDTAEVTEVISDTNVVLKKGSTSSSTFLPQKPVYYY
FT                   NGSKVDYNSLKNIIKSGQKIYFGYNAAGNSYEYAIIQDPYYDSYGKYVETVILGTYSTT
FT                   KGLDVDEILTDQGILTLPENQNVNLDLGSKYGLYIDNDNQITLVYKKLNSTEGVTVLSA
FT                   ISNKVTVDKGGSQVDMILPQNITYYYNGSKIDFSTALSKLQMSTSLVFGLSNKKKGYDY
FT                   CVIFDPVYSKPYIAGDQTYMTLKIGDLDISGSKKFIKDGDVVDYSYIQKYNVVYEVKDI
FT                   WGKNSYILIVDNKIDCYLKSYQPTRFTPKSIVVSVYDLASGKLVEKTYDISENCDTSWI
FT                   LSDTFKTGQRVYILLGYDGKVVAMVNP"
FT   sig_peptide     458076..458156
FT                   /locus_tag="Calkro_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.595 at
FT                   residue 27"
FT   gene            461456..462412
FT                   /pseudo
FT                   /locus_tag="Calkro_0340"
FT   gene            complement(462538..463134)
FT                   /locus_tag="Calkro_0341"
FT   CDS_pept        complement(462538..463134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0341"
FT                   /product="protein of unknown function DUF820"
FT                   /note="KEGG: ate:Athe_2290 protein of unknown function
FT                   DUF820; manually curated; PFAM: protein of unknown function
FT                   DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45244"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV7"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADQ45244.1"
FT                   /translation="MSKGGYKLETSFPNKYEYYTYEEFLTLQKEENRFKIEYDNGFIFS
FT                   MAPAHPNHDRVKNKIATAFINHFGFGGMCEVFTNDIAVVFENQNEIYEFQPDIMVCCNT
FT                   KLFHGPKYKGNPRLIVEVLSYSTEHPDRTIKLSVYEKFQVPEYWIVDISNECIEVYSNN
FT                   INGKYCSINKYKKGMTIKVFDDLVLDVDEIFSVIK"
FT   gene            complement(463161..464501)
FT                   /locus_tag="Calkro_0342"
FT   CDS_pept        complement(463161..464501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0342"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; KEGG:
FT                   csc:Csac_0664 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45245"
FT                   /db_xref="GOA:E4SDV8"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV8"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /protein_id="ADQ45245.1"
FT                   /translation="MIINITELGAKPDGITFCEGAIQKAIDMCHEKGGGRVVVPAGVYL
FT                   SRPIELKSNVTLYLEEGAILKASPYIEDYFKIGYYHNEWGDVTSFLFAMNQKNISIDGK
FT                   GTIDLSGNSFMDFSQAFNIFDELQNLTPEQFEETECKPKFRPNQPIFFYNCGNINLSGI
FT                   SIIDSPCWTVCIHSSKFIKINSIKIVNNLRVPNSDGIHLCSCENAIITSNFFVCGDDCV
FT                   ALSSITNWEKPCENVIVSNCIMQTRSAALRMGHLDSKIKNVIASNLIVLNSNRGIAIFA
FT                   NGKNGYVKHVTISNVTMSTKIFAGTWWGKGEPIVIAAPEEGNLIEDITISNVKAFSENS
FT                   IVVYGKNKNIKNVTLKDIDIYLSFGKNRPQFAKRIDLLPSECPDFTEYMRKIPWIFAKD
FT                   TVNLKLLNINYGYGLNSPNKDYDIEGLFENLTNCLFSNVVKSEKFVV"
FT   gene            464787..464978
FT                   /locus_tag="Calkro_0343"
FT   CDS_pept        464787..464978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45246"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDV9"
FT                   /inference="similar to AA sequence:KEGG:Athe_2289"
FT                   /protein_id="ADQ45246.1"
FT                   /translation="MGQKPPYNQYDLIFKRIFSFKEVFLNFLKSTIKRPWVDKIDLQSL
FT                   EFVDRSFIKDEFVEKEVR"
FT   gene            complement(465068..465832)
FT                   /locus_tag="Calkro_0344"
FT   CDS_pept        complement(465068..465832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0344"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /EC_number="2.1.1.36"
FT                   /note="KEGG: ate:Athe_2288 tRNA methyltransferase complex
FT                   GCD14 subunit; PFAM: tRNA methyltransferase complex GCD14
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45247"
FT                   /db_xref="GOA:E4SDW0"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW0"
FT                   /inference="protein motif:PRIAM:2.1.1.36"
FT                   /protein_id="ADQ45247.1"
FT                   /translation="MEQSFDTKRVIIGPEGFKKVVDISVPKRVNLPTGYIETDKIAQIS
FT                   PGGSFFANDVEYYVFPCDIFDYVMHFLKRHTQIVYPKDGAYILMRLDIHPGKRVGEAGT
FT                   GSGAFTIYLSMAVGPEGKVYTYEQREEFYKMAVKNIKNFSKFDNVVMHNKSIVEGIEEK
FT                   DLDAFFLDIREPEEAISAVREALKPAGHLGILVPTTNQVAETLTALQAHRFYVSEVVEI
FT                   MMRQYKPVPERLRPDDRMIGHTAYMIFARKIL"
FT   gene            complement(465905..466276)
FT                   /locus_tag="Calkro_0345"
FT   CDS_pept        complement(465905..466276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0345"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: ate:Athe_2287 CBS domain containing protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45248"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADQ45248.1"
FT                   /translation="MLANVINRDFIKLLPTDTVKFALEQMQKRKKSVAVVVDENDFLKG
FT                   IIVKVDIYRFLSQPGHYETYPVELAMTKAVITASQNDDIKQVAKLLREHDISAVPVVDN
FT                   GKVIGLIGLEDIVDYFINM"
FT   gene            466409..467215
FT                   /locus_tag="Calkro_0346"
FT   CDS_pept        466409..467215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0346"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="KEGG: csc:Csac_0220 chromosome partitioning ATPase;
FT                   manually curated; PFAM: ATPase-like, ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45249"
FT                   /db_xref="GOA:E4SDW2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW2"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADQ45249.1"
FT                   /translation="MEGERKLRQNIMHPIPKNEFTDVKKIYAIVSGKGGVGKSLVTSLI
FT                   AVGLRREGYEVGILDADITGPSIPKMFGVSGAKIDSDSKAIYPVRTHNDIKVMSMNLLF
FT                   SKEDAPVIWRGPLIAKTIEQFWTEVGWGVLDYLLIDMPPGTGDVALTVFQSLPIDGIIM
FT                   VTSPQDLVSLIVKKAYNMAKQMDIPIVGIVENMSYAVCPHCGKEINIFGKSKLEEEAEK
FT                   LNLKVLGRVPIDPQLTALCDSGEIEKAQNLYLDSCIEVLKSELKEE"
FT   gene            467354..467587
FT                   /locus_tag="Calkro_0347"
FT   CDS_pept        467354..467587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0347"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ate:Athe_2285 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45250"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2285"
FT                   /protein_id="ADQ45250.1"
FT                   /translation="MPWGFGPGFGAGNAARGFGRGFGGGFGKGLGICKWVLLGSTSYAP
FT                   NVKDALEFEKQVLEQRLKLIDKLLKYNEQKQE"
FT   gene            467772..468170
FT                   /locus_tag="Calkro_0348"
FT   CDS_pept        467772..468170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0348"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: ate:Athe_2282 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45251"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW4"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADQ45251.1"
FT                   /translation="MKIAVMMVDNQISPHFGGSEKVCIYTVENDNVVAKEYFNMPEHRA
FT                   GLFAKFIKEKGADVVITGSMGERARYIFDNLGIKYFIGVLGHPDEAVEKLLKGQLKSNE
FT                   SLANEIHEHEEGLHHRSHGHSHQHRHIS"
FT   gene            468360..468779
FT                   /locus_tag="Calkro_0349"
FT   CDS_pept        468360..468779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0349"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; KEGG:
FT                   ate:Athe_2281 protein of unknown function DUF134"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45252"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW5"
FT                   /inference="protein motif:PFAM:PF02001"
FT                   /protein_id="ADQ45252.1"
FT                   /translation="MPRPIRCRKVEFLPRFKYFLPHEGSNDEVLLKVEELEAIRLKDLE
FT                   GLMQEECAQKMQVSRQTFQLILEEARKKVADALVNGKAIRIEGGNYVFGNCKYTCLNCG
FT                   KVFESEKCECPECHSSHVVCHRGKGRGHCFRHNGG"
FT   gene            468937..471393
FT                   /locus_tag="Calkro_0350"
FT   CDS_pept        468937..471393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0350"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: ate:Athe_2280 heavy metal translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; copper ion binding
FT                   protein; cadmium-translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45253"
FT                   /db_xref="GOA:E4SDW6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW6"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADQ45253.1"
FT                   /translation="MKKTLSITGMTCSSCARAIEKSVSKLEGVSSASVNFATEKLIVEF
FT                   DENKASIEMIREAVERAGYGVLDDEEATIREVTIPISGMTCASCARAIEKSISKLNGIK
FT                   EVSVNLASEKAKVVYDSSKLRLSEIKNAIIKAGYTPLEIEKTYYGDLHQERKQKEINNL
FT                   FRRFVIASIFAVPLLLIAMAHLVGLPLPEIILPEKHPLNFALVQAILAIPIVIAGYKFY
FT                   TVGFSRLFKFHPNMDSLIAVGTGAAFLYGLFAIYQIAIGHYQYVKELYFETAGVIIALV
FT                   LLGKYLETVSKGKASEAIKKLMGLAPKTAVVIQGDNEIVIPIEEVEVGDILLVKPGEKI
FT                   PVDGEVIEGRSFVDESMLTGESIPVEKTPGSKVIGATINKNGTLKIKATKVGKDTVIAQ
FT                   IIKLVEDAQSSKAPIARLADVISGYFVPVVILIAVISATAWYFAGSSFIFALRIFITVL
FT                   VIACPCALGLATPTAIMVSTGKGAEHGILIKSGDALETLHKITMVVFDKTGTITEGKPK
FT                   VTDIIPANGWERKRLLQIVASAERFSEHPLGEAIALAAKEKNLKLFDVSQFEAISGHGI
FT                   EAVVDGQTVLVGNEKLMKDKGIEIDFLLDVEKLSQQAKTPMFIALNGKFAGIIAVSDVI
FT                   KPNAKRAIELLHSMGIEVAMITGDNSKTAKAIAKQVGIDRVLAEVLPQDKANEVKKLQG
FT                   EGKKVAMVGDGINDAPALAQADVGIAIGSGTDVAIESADVVLMKSDILDVVNAILLSKK
FT                   TIQNIKQNLFWAFFYNTLGIPIAAGVLHIFGGPLLNPIIAALAMAFSSVSVVSNALRLK
FT                   RFKPVN"
FT   gene            471433..471642
FT                   /locus_tag="Calkro_0351"
FT   CDS_pept        471433..471642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0351"
FT                   /product="copper ion binding protein"
FT                   /note="KEGG: ate:Athe_2279 copper ion binding protein;
FT                   TIGRFAM: copper ion binding protein; PFAM: Heavy metal
FT                   transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45254"
FT                   /db_xref="GOA:E4SDW7"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW7"
FT                   /inference="protein motif:TFAM:TIGR00003"
FT                   /protein_id="ADQ45254.1"
FT                   /translation="MTKKIYIKGMTCDHCVRRVENNLKAIEGVTSVQVDLQEGVATVDL
FT                   SKDVKDEEFVRAIDDAGYEVVRIE"
FT   gene            complement(471736..472803)
FT                   /locus_tag="Calkro_0352"
FT   CDS_pept        complement(471736..472803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0352"
FT                   /product="protein of unknown function DUF1646"
FT                   /note="PFAM: protein of unknown function DUF1646; KEGG:
FT                   ate:Athe_2278 cation transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45255"
FT                   /db_xref="GOA:E4SDW8"
FT                   /db_xref="InterPro:IPR012443"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW8"
FT                   /inference="protein motif:PFAM:PF07854"
FT                   /protein_id="ADQ45255.1"
FT                   /translation="MDFLLILILALVFILPFVFKKVEHNLEIFLFFMGILATIVSRTLS
FT                   VHLIGHILSNYLLYVVTAVVLIMGFLFNLSVNKLKNAINLLLSKINLEIFIFLVLLILG
FT                   LFSSVITAIVATLIMVEILHLLPLRHSSKSKVAIAGCYAIGFGAALTPIGEPLSTIVVS
FT                   ILKEDFAYLLRLVGHYIIPVILVMALLGSFIAKREKKFFYRKEEMSEEDRKYFEIEDQH
FT                   IKEVETHKDVVIRAGKIFLFIVALELLGNGFKPFIDKYIVKLGDKLLFWLNTISAVLDN
FT                   ATVAAAIISPKLTSSQVTAILLSLLASGGMLIQGNIPNIIAANKLEIKSKEWVKFGFPI
FT                   GLVLLTTFYVILFVI"
FT   gene            complement(472808..473242)
FT                   /locus_tag="Calkro_0353"
FT   CDS_pept        complement(472808..473242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0353"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   ckr:CKR_1141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45256"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDW9"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADQ45256.1"
FT                   /translation="MQNNLDLDKISLKMKYIRECLSKLEHLKKLSYQDFIADFRNITSC
FT                   KYLLQTSIEAIIDICNHIVSRKKLGKPSSYSDTIKILLENSYISTNLAEKLIRMVKFRN
FT                   RIVHLYLEVDNQTLYEILQNNLSDFELFWNEISSKIFNEE"
FT   gene            complement(473226..473657)
FT                   /locus_tag="Calkro_0354"
FT   CDS_pept        complement(473226..473657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0354"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: csc:Csac_0229 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45257"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX0"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADQ45257.1"
FT                   /translation="MLNIESKLPKLIEYFSSTPEILGVWIIGSYGTEFQTEDSDIDLAI
FT                   LFDKDMSIFEEIDIEIKICEILETDMVDIVNLNKAPLTLQFKTISEGRQIFERDFKKVA
FT                   DFEEQVLDLYQDHEYFYKAFWEDFKASLSKESSNHAKQP"
FT   gene            474123..474275
FT                   /locus_tag="Calkro_0355"
FT   CDS_pept        474123..474275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2275 addiction module toxin,
FT                   RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45258"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2275"
FT                   /protein_id="ADQ45258.1"
FT                   /translation="MGTSDKFNIIFSKEAYKYLQKLPQNIRPSFFSQNYKTTWEVRRFL
FT                   QIQRR"
FT   gene            474687..475910
FT                   /locus_tag="Calkro_0356"
FT   CDS_pept        474687..475910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0356"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   KEGG: csc:Csac_0232 lysine 2,3-aminomutase YodO family
FT                   protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45259"
FT                   /db_xref="GOA:E4SDX2"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="InterPro:IPR030801"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX2"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADQ45259.1"
FT                   /translation="MEKLNVINNNERFEKLKEAIQDYLEVKDTIKTGIEDEEKIEYQKR
FT                   KILSYFGASEKDWENYKWQLKNRVASSKILKELLNLDEKEAEQIEEVAKSYRFAISPYY
FT                   LSLIDPDNPNCPIKKQSVPSSFELIEKGELDPMDEEHTSPTKIITQRYPDRLIIKVTNI
FT                   CGMFCRFCQRRRLIGETDTHASLDDITDAIEYVAQNPNIRDVLITGGDALMLSDEVLDW
FT                   ILRSLRQIPHVEIIRIGTRAPVTLPQRITKELVDMLKKYHPIYINTHFNHPREITKESK
FT                   RACEMLSDAGVPLGNQMVLLNGVNNDKYVVRKLNQELLKIRVKPYYIFHPKRVKGTSHF
FT                   WVTIEEGMEIIESLRGRTSGMAVPTYIINAPKGKGKTPIMPNYLLYFGKDKVVFRNWEG
FT                   EMFEVENG"
FT   gene            476114..476800
FT                   /locus_tag="Calkro_0357"
FT   CDS_pept        476114..476800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0357"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   cno:NT01CX_1522 Cps19aC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45260"
FT                   /db_xref="GOA:E4SDX3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX3"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADQ45260.1"
FT                   /translation="MEIKEYILIIRKRLPLIVATTLISTLIAAILSFYILPPIYKATVT
FT                   LFAGRSTNSDGANDSIQALYSDVLLGQQLVKDYREIAVSRTVLERVIKELNLNMTPEEL
FT                   GSMVSVQLKNDTRILMINIESKDPKFAATIANKLAEVFIEAVQRIMKIENVQIVDRAVV
FT                   PDKPEKPKKLLNTAVAFVLGLMVGVGIAFFIEYLDNTIKTPDDVEKYLQLPVLAVIPDL
FT                   DEGGKN"
FT   gene            476801..477574
FT                   /locus_tag="Calkro_0358"
FT   CDS_pept        476801..477574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0358"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: clj:CLJU_c05160 putative exopolysaccharide
FT                   biosynthesis protein; TIGRFAM: capsular exopolysaccharide
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45261"
FT                   /db_xref="GOA:E4SDX4"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX4"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ADQ45261.1"
FT                   /translation="MNAVKEVIALYNPRSPITESYRMLRTNIQYSSLDKPIKTIVVTST
FT                   GPSEGKTVTCANLAVVMAQAGSKVLVIDADLRRPAIHKVFGVSNKVGLTNLLVENKNFE
FT                   EIVQKDGVEGLDLITSGPIPPNPAELLGSKKFENFLNTISQSYDYIIIDTPPCGSLTDA
FT                   AIIGRIVDGVILVAAAGEVQIEAIQQAKENLQKVNANIIGVVLNKVKRQTSSYYYYYYY
FT                   YYYYQDENGEVVKKKKTGRRRKKDDRYTLPSDGGR"
FT   gene            477537..478295
FT                   /locus_tag="Calkro_0359"
FT   CDS_pept        477537..478295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0359"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="KEGG: bmq:BMQ_1115 protein phosphatase; PFAM: PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45262"
FT                   /db_xref="GOA:E4SDX5"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX5"
FT                   /inference="protein motif:PRIAM:3.1.3.48"
FT                   /protein_id="ADQ45262.1"
FT                   /translation="MIDIHCHLMVGVDDGAEDLDEAKKMIKLAKKEGINEIIVTPHYTS
FT                   RLKVIYDNKFEEIQKIALQEGVMLHRGCEYKLQDALVQKSDLITLGGSDYVLIEITQGF
FT                   LAEYVLNQVYELKLCGYEVIIAHPERSFEKKDIDKLKKLAEMNVYFQLTAASFIGAFGR
FT                   QIKKFSEELLERGLCHFIASDAHNKSSRQFYFQEAKKYLKDTYNEHWQIDLLFEQNQKA
FT                   ILNGSGEFTAQRLTRKNFLKRLLGSIGRYG"
FT   gene            478295..480676
FT                   /locus_tag="Calkro_0360"
FT   CDS_pept        478295..480676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0360"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; KEGG:
FT                   tte:TTE2615 subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45263"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX6"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45263.1"
FT                   /translation="MKRFKRTVSLAVVAVFLLANVLAFAATPLDNCKSAAKSLLSQLVD
FT                   KIKASGSAQQTAEVISKFISGSGRTVLVNAFNQIAQGPGAAQRLESALGLNPTTLGQLL
FT                   DWMASYQGGGGKNWFVNLVSLSGDALNSALDTAANDLVNKYIQTVGGDVYKAEYQLNKI
FT                   NAAIMLFNGTPGGYKPIKYDSTGNFSVYDTGFNNLFSLLNPLLGNQITGEENKANLKNA
FT                   FQTIVNAVNSIADPTEKLGAKALLQALGLLYVESAPSTGGGVVPSTGGGTTTTQPTTSQ
FT                   QQQQATQPAQQPSQQTQQTTLSDLSKKLDEAIAQGNSAQISEAVNALASVLAAMKNTEE
FT                   AVSSLKEISGKVATALDKISDVSQVKSIVNGLTNAINTVASNIQKQSLSTVEKSLQLES
FT                   LKFETAGLLLKAYEAAAVTPQKTEDTSKVTFKVSANDIALAISKANEVASGIQTTNSTV
FT                   KKSLNFAGVSIAINAISSKDISVMFDKESIDKIKSDSKVTNILIKTQNTSVVIPKSTLT
FT                   ADKFEIKIIPKQVSNALSKAVDVNIVVGDNVQEKFDKPVVLLLKLNNKISDESKVAVYR
FT                   VSDGKTEIVPGIYVSTINSFLVERKSLSTYYVGSYNKTYSDVDSNAWYYKNVQLISAKG
FT                   ITDGYPDGTFRPNNNVTRAEFAKMVVETFQFDTTGQEVTKFEDVKSTDWFYSYVATLYN
FT                   LGIINGRSETKFSPNAPVTREEMAKMISLALVKAGKVSLSAIPTLSFKDDSSISAWAKK
FT                   YVAIVVENGIMEGRGSSTFAPKANATRAEVATVIVRALMK"
FT   sig_peptide     478295..478372
FT                   /locus_tag="Calkro_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            480756..481418
FT                   /locus_tag="Calkro_0361"
FT   CDS_pept        480756..481418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB_G0284775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45264"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX7"
FT                   /inference="similar to AA sequence:KEGG:DDB_G0284775"
FT                   /protein_id="ADQ45264.1"
FT                   /translation="MKRKRKVLLILAISLILMAVLFAIAIEKALNSVLPPEMVKELLND
FT                   KSLNKELSSLINDENIAKDVQSIVYEQNQVKKDLEQAKGGSEPANASNAPTKNTSTGNN
FT                   ELKGKTNNQDSKKQELSNNSSTNNSSQSSLNKDTPKNEEQTSSSPKHDKLNISTSDQLE
FT                   AAKIVLSVMSMAEIKELVSLYKSGKKNEAIQRGVMILKQRLSPEQKKRLKELYFKYK"
FT   sig_peptide     480756..480833
FT                   /locus_tag="Calkro_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.673 at
FT                   residue 26"
FT   gene            481444..482532
FT                   /locus_tag="Calkro_0362"
FT   CDS_pept        481444..482532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0362"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="KEGG: drm:Dred_1394 GDP-mannose 4,6-dehydratase;
FT                   TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45265"
FT                   /db_xref="GOA:E4SDX8"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX8"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ADQ45265.1"
FT                   /translation="MKRALITGITGQDGAYLAEFLLEKGYEVHGIKRRTSLINTQRIDH
FT                   LYEDPHVENRRFYLHYGDLTDSTNLIRIIQEVQPDEIYNLAAQSHVKVSFESPEYTANA
FT                   DALGTLRLLEAIRILKLENKTRFYQASTSELFGKVQEIPQRETTPFYPRSPYAVAKLYA
FT                   YWITVNYREAYGIFACNGILFNHESPIRGETFVTRKITRAVARIKYGLQDKLYLGNLDA
FT                   KRDWGYAKDYVRAMWMILNHDVPDDYVIATGETHSVREFVEKAFKYVDIDIEWVGQEVN
FT                   EKGIDAKTGRVLVEVDPRYFRPTEVDILVGDATKARQVLGWQPTVTFDELVKIMMQSDL
FT                   KEAEKELFNKENGYAYQPSYLE"
FT   gene            482546..483475
FT                   /locus_tag="Calkro_0363"
FT   CDS_pept        482546..483475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0363"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mba:Mbar_A0035 GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45266"
FT                   /db_xref="GOA:E4SDX9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDX9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADQ45266.1"
FT                   /translation="MEKSSKIFVAGHRGLVGSAIVRRLQKEGYTNLVLKGREEVDLTRQ
FT                   EEVERFFEKERPEYVFLAAAKVGGIHANRTYPAEFIYQNLMIECNVIHSAYKYGVKKLL
FT                   FLGSSCIYPRECPQPMKEEYLLSGYLEPTNEAYAVAKIAGLKLCQYYKRQYGANFISCM
FT                   PTNLYGPNDNFDLHTSHVIPALIRKFHEAKINNKPYVEVWGTGKSLREFLHVDDLADAC
FT                   LFLMKNYDDEIWINVGSGEEVSIAELANMIKEIAGYKGEILFNPDMPDGTPRKLLDISR
FT                   LKSLGWERKISLYDGLMSTYEWYVENYR"
FT   gene            483492..484877
FT                   /locus_tag="Calkro_0364"
FT   CDS_pept        483492..484877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0364"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: cpr:CPR_0584
FT                   glycosyltransferase; PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45267"
FT                   /db_xref="GOA:E4SDY0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY0"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADQ45267.1"
FT                   /translation="MPDEVKIWRKVLYNLAGFIALTLAYFAAYRFRFNKVDFFNEKLYF
FT                   LTYGLIILFWFILVLKVSKELNLKKIGVKEIVLNTLKRSIAIFIYVSCIDFIAKLGLSR
FT                   IVIGTFILIYFLVGVALKIVLTKIEDILFKSLIRDYYFVVIGTNEAIKLIKNSNLLNFY
FT                   NKKNKITTIELNSKNENSCSYAIENLCRLIKYSVVDEVILLSEFNLNNEFLKKIIEICK
FT                   ISGRKLRVVYKNDIGVEKAQLSVDGNNIVFEFKTVETSFAYVFVKRVLDILISLVALVL
FT                   TAPLFLLIAILIKIDSPGGPVFFVQERVGLNGRRFKLIKFRTMIPDADKMKDQLMKYNE
FT                   MDGPVFKITNDPRITRVGKILRKLNLDELPQLINVLKGEMSLVGPRPLETKEALGCEFE
FT                   HHIRHSVKPGLTCIWQTTHNRNDVGYNEWMKMDYEYITKKNLLLDLYLIFKTFLAIIKL
FT                   NGK"
FT   gene            484909..485658
FT                   /locus_tag="Calkro_0365"
FT   CDS_pept        484909..485658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0365"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: dba:Dbac_3294 glycosyl transferase,
FT                   WecB/TagA/CpsF family; TIGRFAM: glycosyl transferase,
FT                   WecB/TagA/CpsF family; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45268"
FT                   /db_xref="GOA:E4SDY1"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY1"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADQ45268.1"
FT                   /translation="MKEYLLNNMKLHSISKEELLERIGMWARKNESRVVCFANVHMNIE
FT                   CVESEKVKEAVNSADIVCPDGMPLVWWLKRKGEHDQERLDGPSMMLEICKYAQENNLKI
FT                   GLYGSEKDVLNALIDNLKKMFSALKITYSYSPPFRDLTPEEEEKILEEINQSKTQILFV
FT                   SLGCPKQEIWMSKNKGKINAVMIGVGAAFNMHAGKIKRAPLWMQRMGLEWLYRLIKEPR
FT                   RLWRRYLYTNLKFIKLLVTETLVRGSR"
FT   gene            485850..486953
FT                   /locus_tag="Calkro_0366"
FT   CDS_pept        485850..486953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0366"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tit:Thit_0644 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45269"
FT                   /db_xref="GOA:E4SDY2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ45269.1"
FT                   /translation="MKIVIDCYTLVKGKGKSIGIYNYAKNILNYLVPMLSVNNEVIILC
FT                   NNKNLHDFEYKNITLKIIKADPTKLVNRIMWETIVLPAYLLKLGADVYFSPKGSIPLVK
FT                   VCKVCVTIHDLIPFYYHENFKSHFNRMENYYVRWRITQAVKAADQIITVSEFSKYDIID
FT                   RFKVDPDKINVIYNGVETNVKVEEVSEIDYIFAITSELPHKNLKTLLKGYEIYYNNYNN
FT                   KTKLIICGVKNPDRYKIIDSRAFNNIKFVNNLSDAKLNGYYKNAKMFIFIPLIEGFGLP
FT                   PLEAMRFNVPVICSNCSSLAEIYKNAAVLVNPHDPNDIARAIYAVEENIVDLESIKKEA
FT                   SKLVKKYTWHNAALKTSEVFDRIINNV"
FT   gene            487415..488584
FT                   /locus_tag="Calkro_0367"
FT   CDS_pept        487415..488584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0367"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ton:TON_1855 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45270"
FT                   /db_xref="GOA:E4SDY3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADQ45270.1"
FT                   /translation="MRKKVGLIAICDFIDFPPGGEVSFLTSILKEWKYEDLEIDLIGMT
FT                   HSLNENVGNWQKRSIGEKEYNFFPVFKEVREKEKTRIPFRFRMVWGLLKFRKEIMKKKY
FT                   DILYIHCPELILPFLGDNKTVVVYHVHGEPQHTLKVSRFSIFRFHIFSFLYNTIIKIAI
FT                   TKSKKVIWVSQKALKSYLGEKYSKEKNIVIPSPYDSSLFCLCEEDNLVKKTNQIIIFVG
FT                   RLSAVKNLNLLIDSFKLVREEKKNVKLILCGDGEERIKLERYVEERGLKDDVIFTGYLK
FT                   REEIRFFLNKADVFVLTSLKEGSPVCVVEALAMGVPVVTVDVGDVKEIIRDGYNGYVVE
FT                   RYDPVLISTAIVKILREGRDKYKENCIKSVLARSPSAIANRVYDVLKSC"
FT   gene            488718..488867
FT                   /locus_tag="Calkro_0368"
FT   CDS_pept        488718..488867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pbe:PB000331.02.0 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45271"
FT                   /db_xref="GOA:E4SDY4"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY4"
FT                   /inference="similar to AA sequence:KEGG:PB000331.02.0"
FT                   /protein_id="ADQ45271.1"
FT                   /translation="MVGNSKQDIKLLIYILILTLLIQFGLNSFVVSIYLFFGILNSKLM
FT                   IASY"
FT   gene            489088..489363
FT                   /locus_tag="Calkro_0369"
FT   CDS_pept        489088..489363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0876 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45272"
FT                   /db_xref="GOA:E4SDY5"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY5"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0876"
FT                   /protein_id="ADQ45272.1"
FT                   /translation="MTLVVYISIKDKGIKYYTDLMAKLMLLQVIPINVTYILYKDKYIF
FT                   LGDLYKGTLEDARTTGIFFIASMLYYFFNKDITIFRKIIYVGVLFF"
FT   gene            489475..489714
FT                   /locus_tag="Calkro_0370"
FT   CDS_pept        489475..489714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dtu:Dtur_0583 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45273"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY6"
FT                   /inference="similar to AA sequence:KEGG:Dtur_0583"
FT                   /protein_id="ADQ45273.1"
FT                   /translation="MFIVFIEGVIYIYNDRIISNFKDYVNVNLKMYMYDGTANLKYYSL
FT                   TNALKSIKFPRNLIGLGVGTYGSKAVNFLAKDYM"
FT   gene            489801..490172
FT                   /locus_tag="Calkro_0371"
FT   CDS_pept        489801..490172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45274"
FT                   /db_xref="GOA:E4SDY7"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY7"
FT                   /inference="similar to AA sequence:KEGG:CPR_0587"
FT                   /protein_id="ADQ45274.1"
FT                   /translation="MNIFKMQRFHSGILSYPFSGWVSVFAETGIIGLIFYFVIFYISQQ
FT                   SGFRQIKYKRGKNMLKVCSLMISLIYILLILDNYLEKQSIASIVSMFAFYLATSSSYWN
FT                   KNFESEKGRLSRICSCERS"
FT   sig_peptide     489801..489881
FT                   /locus_tag="Calkro_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.736 at
FT                   residue 27"
FT   gene            490182..490910
FT                   /locus_tag="Calkro_0372"
FT   CDS_pept        490182..490910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0372"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif"
FT                   /note="PFAM: glycosyltransferase sugar-binding region
FT                   containing DXD motif; KEGG: bfr:BF3652 putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45275"
FT                   /db_xref="GOA:E4SDY8"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY8"
FT                   /inference="protein motif:PFAM:PF04488"
FT                   /protein_id="ADQ45275.1"
FT                   /translation="MIPKIIHYCWFGGKKNKLVEKCINTWKICLPDYKIIEWNEQNFDI
FT                   HITKFTTKAYKLKKYAFVSDYVRIWSLYNYGGIYMDTDVEVLKNLDRFLCHRFFTGFES
FT                   NNFAVTGIMGSEKGHPFLKELLEWYNGQDFDANKLKTNTQIISNLMKKYGLELNGKYQV
FT                   LEHDMHIYPKEWFCPYDLEKNKLIITDNTYTIHHFQGSWLPLKDKIKLKIRNMVINIIG
FT                   YEKFELIKLNFIKNNIRDKA"
FT   gene            491238..492644
FT                   /locus_tag="Calkro_0373"
FT   CDS_pept        491238..492644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CA_C3067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45276"
FT                   /db_xref="GOA:E4SDY9"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDY9"
FT                   /inference="similar to AA sequence:KEGG:CA_C3067"
FT                   /protein_id="ADQ45276.1"
FT                   /translation="MLPKRELKIASIRIILYLAPITMYYIIYFSYVKMNCSIIISEWVN
FT                   NILTIVLVALVSIIFVFFMKRVDIIFNFSLLVLITIFPISQQIITGTPYSGAEYKGIFK
FT                   ISLFSLLILNAAIFLFFSKTKLYNSNKKLLSIYALLVFIILLASIMSEGFRSIAIIVEN
FT                   FITPLGIMYIMLNLRIDEIIHSLGILKIGIVINFILGLIEFITNKNIFESDLIELKKSM
FT                   LISLNHIRSYGLVQHPLNYAFVGLVSISIFIITRKRKDFAFVIIGIIMTIISISRAGIF
FT                   LAIILGTVSLFILSKISEKKILTILLAIPYIFLVVIGAYIYFLKDKYDVYSKLSRIIAI
FT                   QYFRTSFFSNLIVGYGLKQSMLADELSQMAKVNIIPENPTIILGSAYGYVFSLLLLFGL
FT                   IFMISHIKDLYQRASCILLLIYLQTFNSYGTKYVYFNLFIYLIWLCILVGNVYSLKVQG
FT                   KIEAKIPRGG"
FT   gene            492650..493819
FT                   /locus_tag="Calkro_0374"
FT   CDS_pept        492650..493819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0374"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: trq:TRQ2_0300
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45277"
FT                   /db_xref="GOA:E4SDZ0"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ0"
FT                   /inference="protein motif:PFAM:PF04464"
FT                   /protein_id="ADQ45277.1"
FT                   /translation="MGMSAILKNLLKSIFAVFIRIERGKIVIIDGTPYSGSNAKALYDF
FT                   IKKSIKYNNIKFLTENDLKWKSFWNLKVFFENFREVCSANIVVTTHLYPKLKKTQIYIQ
FT                   LWHGIPLKAMTLMDKTEGINHKKLSVKNFSEYDYIISSSQFYSTLLNACVGVDGSKYVI
FT                   TGFPRNDMLFNTDAREKLQSIVKQPIDSYKIVFYLPTFRVNYGNQRIEGTTKDKNIFGF
FT                   DDFDYDQFNRFLAKNNILFITKLHPVEEKLFIKKLSKISNSYFIFLTTDVLKIYSIDLY
FT                   EILGSADILITDYSSVYFDYLLLNRPLLFISNDIDIYEKERGFLLKPYDFWTPGPKVKN
FT                   QRELQDEIVNILSGKDTYKELRTLFKTLFHVYNDNKSCERVWNIIKNHI"
FT   gene            493893..494951
FT                   /locus_tag="Calkro_0375"
FT   CDS_pept        493893..494951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0375"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   sne:SPN23F_03300 putative glycerol-2-phosphate
FT                   dehydrogenase WchY"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45278"
FT                   /db_xref="GOA:E4SDZ1"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ1"
FT                   /inference="protein motif:PFAM:PF01761"
FT                   /protein_id="ADQ45278.1"
FT                   /translation="MQLFNLPIFLTIEESIINRLGKELEIKIGNLIKRKTMLFTSEGNF
FT                   HRYKYVIEKLKDELKNISLYFVKDSSYDIAVEAAKTILIEDYELIIGFGGGKVLDTAKY
FT                   AAYVSKKKYISIPTILSNDGVASPIAVLKTTNGRAKSFGCKVPDGIIIDVNIVKEAPDN
FT                   LLMAGVGDTVSNYTALYDWKLQCEYEGIQLNDFAYLLSDAALNLVLYTTEKKLKNENFI
FT                   RQLAQSFVLSGLAMEIAGSSRPCSGSEHLFSHALDEYYSHINVPHGLKVALGSIASCIF
FT                   QKRDYKIIVDFLKTFGVDVSPDKLGINKDIFIDAWMKAKLTRPERFTVLDIIKLSEKYL
FT                   EEVYYKIMEVLK"
FT   gene            494953..495657
FT                   /locus_tag="Calkro_0376"
FT   CDS_pept        494953..495657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0376"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG:
FT                   sne:SPN23F_03310 putative nucleotidyl transferase WchZ"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45279"
FT                   /db_xref="GOA:E4SDZ2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ2"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADQ45279.1"
FT                   /translation="MKALILAAGMGTRLRPITDFKPKCMVEVNGVPIIFKQLDNLIQNG
FT                   IKDITVVAGYKADMLKNALNKNYPFVDVIVNYEYETTNNMYSAYLARSSYAGKEFLLMN
FT                   GDVFFDESVIAELLKEQYVDSIVVEKGVFFEESMKVKFNKGRITEISKQIPKNEAYGVS
FT                   IDVYKFSAEGSRIFFNKIIEYVEIKKDLIQWTEVALNEILSEVKFTPCPLKGRWIEIDD
FT                   FNDLKKAEEIFI"
FT   gene            495783..496289
FT                   /locus_tag="Calkro_0377"
FT   CDS_pept        495783..496289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0377"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: drm:Dred_3018 VanZ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45280"
FT                   /db_xref="GOA:E4SDZ3"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ3"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADQ45280.1"
FT                   /translation="MNMSKKIITLLSWATVHLWLLIIFSLSSQPGPKSNDLSKSVTKQI
FT                   VKATQKVIVQNTYIKPRKNIMNKLNNLVRKYAHVVMYLVLGILVINAFVISGIRAYKAF
FT                   IFSLIFCLFYAASDEIHQLFVPGRVAKVTDVLIDGIGALIGIGLYKFIFKIYYTLKTKS
FT                   STKQL"
FT   gene            complement(496240..496356)
FT                   /locus_tag="Calkro_0378"
FT   CDS_pept        complement(496240..496356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmd:BMD_4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45281"
FT                   /db_xref="GOA:E4SDZ4"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ4"
FT                   /inference="similar to AA sequence:KEGG:BMD_4085"
FT                   /protein_id="ADQ45281.1"
FT                   /translation="MPSPNFFRGLKNGIIISVLLWAVIIVLLKILFLVCNIF"
FT   gene            496572..496871
FT                   /locus_tag="Calkro_0379"
FT   CDS_pept        496572..496871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45282"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ5"
FT                   /inference="similar to AA sequence:KEGG:Athe_2271"
FT                   /protein_id="ADQ45282.1"
FT                   /translation="MILKNIINIEGIAKVSEFPTFTTLDRYSQYEVVEPFCTFIEAPLK
FT                   IPVGTNTLQLLQTLGITLNDVLVGKPNVLIEYVTVSLLDPRTIEKCTVLSSGQH"
FT   gene            497003..497431
FT                   /locus_tag="Calkro_0380"
FT   CDS_pept        497003..497431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45283"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ6"
FT                   /inference="similar to AA sequence:KEGG:Athe_2270"
FT                   /protein_id="ADQ45283.1"
FT                   /translation="MGIIEPHEYDHVKKHVYKQVLTNAEFEIPESKPEIEDFSSVVMQI
FT                   TRKKCKLICGPLGDKIVVTGTINLNMRYTAANPQQSVRNVHLCHDVDAFINIKCLEESY
FT                   KIFCGCCDVKMYIEWADLEAEDKRKIKGCFLVLINCQV"
FT   gene            497452..497799
FT                   /locus_tag="Calkro_0381"
FT   CDS_pept        497452..497799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45284"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ7"
FT                   /inference="similar to AA sequence:KEGG:Csac_0237"
FT                   /protein_id="ADQ45284.1"
FT                   /translation="MIALSGPEFVRKPRDEIINEILESIAKEEMAIANLMNAEAEKIKR
FT                   VVASHDLPKAEDFSQLLSLQKLVAEILEKLIQKQNIIIKKLDMIREFKATIIKKEKPHP
FT                   YHPMPQYDNEE"
FT   gene            complement(497841..499328)
FT                   /locus_tag="Calkro_0382"
FT   CDS_pept        complement(497841..499328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0382"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2268 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45285"
FT                   /db_xref="GOA:E4SDZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45285.1"
FT                   /translation="MSIVLENVSKKFEEFYALKRINLEFFEGEVHVILGKNGSGKTTLT
FT                   KLINGTYQPSEGRVIINGKAFSSLNPLLAKSLGIFTVHQELLYFPHLSVAENIFIENKP
FT                   KNSLGFISTKKMLKLSSEILAKMGVNINPEASCKNLGTSQLQVIEICRALVQDAKAIIF
FT                   DEPTAGLTSYEIENLFRIIKELKQKGIIIIFVTNMVEEALSIADRITILRDGEVVASDK
FT                   VTSFNLNRAISLIFGSVNRTYPKLKVEKGPVIFSVKNLTKSGIIEDISFDVRSGEVYGI
FT                   AGLVGSGRSFLAKALFGAEKVDSGEIFIKGNFLKLSSPSDAIKNGIAFMSEDRIGTGLF
FT                   KTLNIADNIISSNIWNIVNGFFIDSSRQEKIANFFIKRLGIKPKEISQKIATLSGGNQQ
FT                   KVLIAKWLFSQSLVFILDEPTKGLDLASKVEVYNIINELARIGCAIIFISSEFSELIGM
FT                   CDRILVLREGKKVHEFSKKEMDYDRILKSAMGILESK"
FT   gene            complement(499336..500115)
FT                   /locus_tag="Calkro_0383"
FT   CDS_pept        complement(499336..500115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0383"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: ate:Athe_2267 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45286"
FT                   /db_xref="GOA:E4SDZ9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E4SDZ9"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADQ45286.1"
FT                   /translation="MLVAERLKKIKEILLQKKHIDVATLAELLSVSEVTIRRDLDRLES
FT                   EGFLIKTYGGAILKEEAAKILSPTISEDSEKEAIAKVCSYMIESNQAIILAGGNILRLV
FT                   PKYIKEKQNIIVLTNDLLLAIECGKLSIQTIVTGGYIVGNTFTLAGPMLVNPNLDIFVD
FT                   KAFIEVDGVSLERGFTVNNVEFANAYKYFKSIAKETIIVADSSKFDKISLFQIAKVDEI
FT                   KKVISDTNVPDEYKSFFFENGTQIFCSFDFSDLEREV"
FT   gene            500405..501904
FT                   /locus_tag="Calkro_0384"
FT   CDS_pept        500405..501904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0384"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2266 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45287"
FT                   /db_xref="GOA:E4SE00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE00"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45287.1"
FT                   /translation="MKSCTDSELLRLHGITKIFPGTVALSDVSFSVNKAEIHAIVGENG
FT                   AGKSTLMNIISGSLLPDKGEIYLEGKKVNIRSPRDAQNLGISIVHQELALCPHLTVAEN
FT                   IYIGRLPEKSAKIVDYKTLNKMSQEVLSLFDEVNIKPTDKVANLNVAQQQIVEIAKAIT
FT                   FNCKLLILDEPTSALSEADAAVLFKIIKDLKAKGISILYISHRLREIFELADRITVLRD
FT                   GRYIKTLNTSETNPDQVVSLMVGREIKEMYPPKSTFVGKEIFRVENISSDKVYNVSFSL
FT                   REGEILGFAGLVGSGRTELAQTICGILPKHCGEIYLEGKRIEINSFEDAIRHKIGYVTE
FT                   DRKQFGLFLKLPVAHNVSAIHLKYDYKKLLIDKNHELSLADKYVKKLNVKTSSYVQLVM
FT                   SLSGGNQQKVMIAKWLAINPKILILDEPTRGIDVGAKAEIHSLLRELAKNGIGIILISS
FT                   ELPEIIGMCDRVLVMREGRITGELSGEKITEENIMQLAAHK"
FT   gene            501942..502928
FT                   /locus_tag="Calkro_0385"
FT   CDS_pept        501942..502928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0385"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_2265 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45288"
FT                   /db_xref="GOA:E4SE01"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE01"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADQ45288.1"
FT                   /translation="MSNTTLNTSSNKSLLKKLMGFREITLIFIIIVISAIISVLSPNFL
FT                   TAENLITTALGLAADGILAIGMTVVLVSGGVDLSVGSVLGLSAVIAGGLYLSYGVNIWI
FT                   GSFIALVICALIGLFNGYFIARIGIPPLIVTLAMMGIARGAAYVLTQGSPLSLYGNLKG
FT                   FDFLGQGKVLGIPFFILFFIILIILFDFLMRKSAPFRLVYYVGSNENAAKLSGINVPKV
FT                   KISVYVLMSVLAGIAGIFTLSRFSVAAPTAGNGSELNAISACVIGGASLAGGEGTVLGA
FT                   ILGTILVGIINNALVLLNVSVYWQNLVSGVILIAAVTIDYLTHQKKS"
FT   sig_peptide     501942..502085
FT                   /locus_tag="Calkro_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.773 at
FT                   residue 48"
FT   gene            503044..504081
FT                   /locus_tag="Calkro_0386"
FT   CDS_pept        503044..504081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0386"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ate:Athe_2264 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45289"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE02"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ45289.1"
FT                   /translation="MKKNFYKYLSIFLAVALIVSLAYALVPSSKDITQASSGNPKLKGS
FT                   PNEEYYMVTFVSGIEYWKGCFKGMKAAADLYGVKAIYTGAPQFDVNQEVTVLRQVIAKK
FT                   PAGILVTCANPDALKAPIDEAIKKGIPVITFDADSPKSSRYSVLETGNYNAGAMAARYL
FT                   GKLLGGKGEVGISTVAAQLNHEQRKQGFIDTLKKEFPGIKVVAIVNDENDQTKAARQIS
FT                   AMLQAHPNIKGIFCTDALGGVGAATAIKEANKVGKVKIVSFDTDKGTLDLIKQGIIDAS
FT                   IAQGTWNMGFWGMTFLFYLKHGIVNPVDNWQKYGINPLPPYVDTGTMVVTKQNVDAFYK
FT                   VNVIK"
FT   sig_peptide     503044..503118
FT                   /locus_tag="Calkro_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.959 at
FT                   residue 25"
FT   gene            504294..504446
FT                   /locus_tag="Calkro_0387"
FT   CDS_pept        504294..504446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2764 protein of unknown function
FT                   UPF0236"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45290"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE03"
FT                   /inference="similar to AA sequence:KEGG:Athe_2764"
FT                   /protein_id="ADQ45290.1"
FT                   /translation="MTENIVSKIEELLKTFEEGLEKIVKREKDLAEYSIELRDLSRILC
FT                   FQFIT"
FT   gene            complement(504447..505655)
FT                   /pseudo
FT                   /locus_tag="Calkro_0388"
FT   gene            505844..506146
FT                   /locus_tag="Calkro_0389"
FT   CDS_pept        505844..506146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0389"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ate:Athe_2764 protein of
FT                   unknown function UPF0236"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45291"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE04"
FT                   /inference="similar to AA sequence:KEGG:Athe_2764"
FT                   /protein_id="ADQ45291.1"
FT                   /translation="MSSRPRGWSEDIAENMVKLLSLKYNGFELMNVYLEKIKAKKAERQ
FT                   EVKEIAKGIIKNGKRVRKGMEKWNNIPVIANGKVNQLQRALKSLISCNFYNAGIF"
FT   gene            506280..507203
FT                   /locus_tag="Calkro_0390"
FT   CDS_pept        506280..507203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45292"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE05"
FT                   /inference="similar to AA sequence:KEGG:Athe_2256"
FT                   /protein_id="ADQ45292.1"
FT                   /translation="MKTYKKYDEGYKKLFSNKENLIWFLQNVLNEERFKRLEKSDVEII
FT                   ATESINKKWQKKSSDIVYKIKYKDSFFCLTIEFQSREDKRILHRLYEYMHLIQLKNKVN
FT                   GEIPVVVPIVLYNGISHWKPNEQYSEIILFAEDFPEYAQNFKIIFLDIKSIPEEKLISA
FT                   SNVLAIAMYIDQVSNNPERVLNRILNLRGKIHLNWEQREELADWLYEVILRSYGVSEEE
FT                   AEEMFKKSGLEVDEMFSSTAEKIKQGIEREKKKIAKEAMKQGMRQGMKRAMKLIAKQML
FT                   KDNQPIELISKYTGLTPEEIKKLKKV"
FT   gene            507786..509243
FT                   /locus_tag="Calkro_0391"
FT   CDS_pept        507786..509243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0391"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="manually curated; TIGRFAM: glutamyl-tRNA synthetase;
FT                   KEGG: csc:Csac_0706 glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45293"
FT                   /db_xref="GOA:E4SE06"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE06"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADQ45293.1"
FT                   /translation="MEVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTD
FT                   LERSSIESEKVIIESLRWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAY
FT                   YCYCTEEELEAQRQELLSKGQMPRYTGKCRNLTEDQKRRFEQEGRKPTVRFKVPEGVKI
FT                   VVHDLVRGNVEFLSDDIGDFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPR
FT                   QILIYNALGFELPQFAHVSLILGKDRTKMSKRHGSTWVEQYKDQGYLKEGLINFLALLG
FT                   WSPPEDKEIFDMEYLIENFSLERVSKNPAIFDIDKLNYINSQHIKLKSLDELTQMCIPY
FT                   FVEAGYIKEDEAQSKFEWLKKIVKSVYEGLDYLSQIKDRVDVFFNNEIKIEEDEAKEVL
FT                   KWDHVKDLINVFENKIRQMNELTPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHG
FT                   PELVEIIEIVGKENILKRLEFFKTWYN"
FT   gene            509285..509989
FT                   /locus_tag="Calkro_0392"
FT   CDS_pept        509285..509989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0392"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   ate:Athe_2254 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45294"
FT                   /db_xref="GOA:E4SE07"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE07"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADQ45294.1"
FT                   /translation="MFRFFKMIKEEMDVIMEKDPACKSRLETLLYPSLWAIIYHRIAHW
FT                   FYNRRMYFIARWISQRARHKTGIEIHPGAKIGRRVFIDHGMGVVIGETAEIGDDVLIYQ
FT                   GVTLGGTGKEKGKRHPTIGNNVLIGAGAKVLGPFKVGDNTKIGANAVVLREVEDNSTVV
FT                   GVPGRVVRKEKKEKPTVEEQLDQVRFPDPLAMQICRLEAKIEALEKKLAEYERRLKEYE
FT                   ALQHSDNDKRGV"
FT   gene            509946..511343
FT                   /locus_tag="Calkro_0393"
FT   CDS_pept        509946..511343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0393"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   ate:Athe_2253 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45295"
FT                   /db_xref="GOA:E4SE08"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE08"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADQ45295.1"
FT                   /translation="MKLYNTLTMTKEEFEPLEEGKVKMYVCGPTVYDFIHIGNARPLIV
FT                   FDTLRRYFEYKGYEVIYIQNFTDVEDKMINRANKEGVTVFELAERFIQEYYKDADRLNV
FT                   KRATKNPRATEEIEDMIALIQTLIDKGYAYVVDGDVYFRTRKFAEYGKLSHKNIEELMA
FT                   GARVDPNEKKEDPLDFALWKAKKEGEPAWSSPWGEGRPGWHIECSVMAMKYLGQTIDIH
FT                   AGGQDLIFPHHENEIAQSEASTGKPFARFWLHNGYVNINNEKMSKSLGNFFTVREIIEK
FT                   YHPEALRLFMLQAHYRKPLNFSIDLIEQAESALKRIYTCYENLEYLIKNGTTSNSSDST
FT                   LKAVLKELKAKFIDAMEDDLNTAEATGYLFEMVREINTHSNTCSKDVLILARDTLKELC
FT                   SILGILEQYEEKKDEIPPEILELVEKRNEARKAKNFLEADRIRDDLRSLGYIVLDTPQG
FT                   TKIERIK"
FT   gene            511507..511872
FT                   /locus_tag="Calkro_0394"
FT   CDS_pept        511507..511872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0394"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   ate:Athe_2252 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45296"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE09"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADQ45296.1"
FT                   /translation="MSEVKLSTQQMKFSNLKELVSHMISISELSRGRASKIIDEVAKKK
FT                   KNFLVIKNNKPQAVIIPIDLYDQLIQAHEDYKLLLLALKRTENLKQEDCSTFEQVVEEA
FT                   GFTLEEIDKLAESVEIE"
FT   gene            511874..512141
FT                   /pseudo
FT                   /locus_tag="Calkro_0395"
FT   gene            512254..512661
FT                   /locus_tag="Calkro_0396"
FT   CDS_pept        512254..512661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0396"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   ate:Athe_2706 transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45297"
FT                   /db_xref="GOA:E4SE10"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE10"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADQ45297.1"
FT                   /translation="MKFDTNKHSVFLLYYHLILVTKYRRDVIDERISKRLREIFEYIQP
FT                   NYNISLLEWNHDKDHVHILFNATPTTSLSKFINAYKSASSRLIKKEFAEIKQKLWKEYF
FT                   WSRSYCLLTSGGAPVEVIRKYIESQGEKRKC"
FT   gene            512664..512741
FT                   /pseudo
FT                   /locus_tag="Calkro_0397"
FT   gene            512901..513407
FT                   /locus_tag="Calkro_0398"
FT   CDS_pept        512901..513407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0398"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   ate:Athe_2247 protein of unknown function DUF421"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45298"
FT                   /db_xref="GOA:E4SE11"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE11"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ADQ45298.1"
FT                   /translation="MLKYLYIAFCSISVYIFIIIAIRLFGKKDISQLSITDLVFVLLLS
FT                   NSVQNAMVGSDSSLFGGLVSATSLFAVNFVIKLIVYRFPKIEHLLEGEPLILVYRGKIN
FT                   EKNLAKVKITKEELLETVREHGVALLEDVELAVLEMDGNVSIISKKSESEYVKKKIPPR
FT                   IKKRE"
FT   gene            complement(513420..513776)
FT                   /locus_tag="Calkro_0399"
FT   CDS_pept        complement(513420..513776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0399"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: ate:Athe_2246 AIG2
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45299"
FT                   /db_xref="GOA:E4SE12"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE12"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADQ45299.1"
FT                   /translation="MYLFVYGSLLSHNSHNYLLSGCKFIGNAILNGYALYKISWYPAIV
FT                   PKNGCKVAGEVYKVDENTIEKIDDFEDEGEIYKRQEVNVVLNNSEIIKAWTYVYLREVD
FT                   EKNYIPFENQPWRE"
FT   gene            complement(513826..514212)
FT                   /locus_tag="Calkro_0400"
FT   CDS_pept        complement(513826..514212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0400"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   ate:Athe_2245 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45300"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE13"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADQ45300.1"
FT                   /translation="MTQKQKVKEATCEIEVAFEVIGGKWKPLILWYLGEYGTLRFAQLQ
FT                   HLIPDITHRILTKQLRELEEHGLVARKVYPEVPVKVEYSLTEKGKDVLPILDMMCNWAD
FT                   KYDYFGYKLKYNLCNEELCDLQEE"
FT   gene            514358..515545
FT                   /locus_tag="Calkro_0401"
FT   CDS_pept        514358..515545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0401"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   ate:Athe_2244 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45301"
FT                   /db_xref="GOA:E4SE14"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE14"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADQ45301.1"
FT                   /translation="MENLVFNYFIPTKILFGPGSLNRLKDENLPGKKALIVISTGTSMK
FT                   KYGYLDRLTAILKEKGIEYVVFDKILPNPIKKHVMEGAKLAKEEGCDFVIGLGGGSSID
FT                   SAKSIAIMAKNDGDYWDYIVGGSGKGKFPSNGALPIVAITTTAGTGTEADPWTVITNEE
FT                   TNEKIGYGNQYTFPTLSVVDPELMLSVPPHLTAYQGFDAFFHAVEGYIAKIATPVSDMF
FT                   ALKSVELIAKYLPICVKDGTNIEARTYVALANTLAGFVESTSSCTSEHSMEHALSAFYP
FT                   DLPHGAGLIMLSEAYHTFFASKVPKKYIQLARAMGVDVEQLPEDERPFAFIKAMKKLQE
FT                   ECGVGNLKMSDYGIKEDEIEKLADNAIKTMGGLFEVDPYKLSFEETVQIMKNAYK"
FT   gene            515781..520799
FT                   /locus_tag="Calkro_0402"
FT   CDS_pept        515781..520799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0402"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PFAM: glycoside hydrolase family 10;
FT                   Carbohydrate-binding CenC domain protein; S-layer
FT                   domain-containing protein; KEGG: dtu:Dtur_1715
FT                   endo-1,4-beta-xylanase; SMART: glycoside hydrolase family
FT                   10"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45302"
FT                   /db_xref="GOA:E4SE15"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE15"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADQ45302.1"
FT                   /translation="MKKRLIAFLVMLIFVISLLNPMYLSFLTPVAKAQSSQTNLKFDFE
FT                   NGIQGWTGRGVSTTVATVYGVAYEGDYSLKVSGRNSSWDGAVVDITSNVSVNTTYTVSM
FT                   FVYHNDAKPQRFAVYAYVKDSAGEKYIQIADKVVMPNYWKQIFGKFTISTSNPLQIVKL
FT                   LVCVPSNKSLEFYLDSVIVTSAQPTSSGIVKSSTFESGSTEGWQARGTGTDAQISVVDT
FT                   VAHTGSKSLYVTGRAQTWQGAQIDMTSVLEKGKDYQFSIWVYQNSGKDQQITLTMYRKN
FT                   ADNTENYDTIKWKQTVPSGTWTEVTGSYTVPQTATQLIFYVESPALDFDFYLDDFTAID
FT                   KNPPVVNPGLIKSCTFESGTTEDFVPRGSSVSLTVVDNVYYHSGTKALYVSGRASTWNG
FT                   AQIDMTSLLEKGKDYQFSIWVYQNSGSDQKITLTMQRKNTDGSTNYDSIKYQQTVPSGA
FT                   WTELSGSYTVPQTATQLIFYVESPNATLSFYLDDFTAIDKNPVTIPAAVKQPEWEIPSL
FT                   CQQYSQYFKIGVAIPYKVLQNPVESAMVLKHFNSITAENEMKPDALQRTEGQFNFTIAD
FT                   QYVNFAQQNGIGIRGHTLVWHSQVPNWFFQHSDGTPLDPSNPEDKQLLRDRLRTHIQTV
FT                   MSRYQGKIYAWDVVNEAIDESQPDGYRRSEWYRILGPTPETNGIPEYIVLAFQYARQAD
FT                   PSAKLFYNDYSTENPKKRQFIYNMVKKLHDMDLIDGVGLQGHINVDSPTVKEIEDTINL
FT                   FSTIPGLEIQVTELDISVYTSSSQRYDTLPQDVAIKQALKFKELFEMLKRHSDRITNVT
FT                   LWGLKDDYSWLSKDRNNWPLLFDSNYQAKYSYWAIVEPSVLPLAINKAYAINASATIDG
FT                   VMDREYRGAVPIEIKDDAGNTKATARMLWNANEVYLYVYVNDAIYNPSTDYVMICIDQD
FT                   NAKLPEFKSDDFWAIITRGGVLTELQDGKVAAYKVVSKQDSYVVEAKILLDNQLSKGTN
FT                   IGFDLVVRDDANVFCWNDKTNSQLYATDNYGILSMSDSIKFATVYKGTPKIDGEADAIW
FT                   DFATQITTQTPIQVSGTVYAAAYANVKLLWDETALYIWADVYDPLLNKANANPWEQDSI
FT                   EFFVDENNHKTSFYEDDDVQYRVNYENTQTFGTNGSAQNFITSTKITPFGYTVEAKVYM
FT                   RTTVLSEGMIIGFDVQVNDADHTGRRVNVITWNDKSGNDWRDTTGFGCIELALFKNKNL
FT                   KQLNISTGTLSPAFNKDITAYTVTVPYETSSITVTAVPEVPTSLVYINDVLGNTNAISL
FT                   NVGVNTIRVKVVADDNSEKIYTITVTRNAQTTTSPSTIIPSTPSTGASTTTQQTQQTQQ
FT                   TQQQQQTQTQTSAQQLQQTQQVTSQNSATIKVEADKPATVNLGQDTKVIVVPDAVTNKN
FT                   AVINVEKVEKTPVAVNIGTVIAPAIKVNVENADIVKPVQIEIKVDPEVFKDNKIPVAFV
FT                   IDEANKPTLVPVKKGLNKVVVNTTKEGTIMVVSAKLEEVYKDITNTHWAYDTFKQAVTS
FT                   GLVVGYNDMTLRPAKNVTLAEAAVIVQRAFEVQAKDATKPSNVPDWAATAVKALLDNEV
FT                   ISEVEDANKPLTRIEAVSIIMKTLEKIGVTVEPAEIEFSDLFDQSSIDVEYLAKAYKLG
FT                   IVKGYPDGTFRPQNTITRAELLTILFRALNNLKK"
FT   gene            complement(520871..522760)
FT                   /locus_tag="Calkro_0403"
FT   CDS_pept        complement(520871..522760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0403"
FT                   /product="amino acid transporter-like protein"
FT                   /note="KEGG: ate:Athe_2243 amino acid transporter-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45303"
FT                   /db_xref="GOA:E4SE16"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE16"
FT                   /inference="similar to AA sequence:KEGG:Athe_2243"
FT                   /protein_id="ADQ45303.1"
FT                   /translation="MFEKLKRILIGKPLPNEAEKTEKYGVLWGLPILSSDAISSVAYAG
FT                   QEILYVLLPAIGFLAFKEISVVTTAIIILLFILMLSYRQTIENYPNGGGAFIVAKDNLG
FT                   VLAGIVAGAALSVDYILTVAVSISSGVDQIVTALEFLKPYKIALCLFLVLFLMIGNLRG
FT                   IRESSRIFGIPAYAFMFSILALILGGYIKLKMGYVPPEPKVNYSSHPVTLVLLLKAFAS
FT                   GCTALTGIEAVSNAVPNFKDPATKHAKTVLLLLSLIILVLFGGTTLLATHYHIVPSEGA
FT                   MLVLMAQEIFGKSFMYYIVAATTFIILVFAANTAFSGFPMLVAVMAKEEFVPRQLSLKG
FT                   DKLSYSNGIIILALVSALLIVAFNGNVTALIGLYAVGVFISFTLSQSGMFVRWLRNKGN
FT                   HWHIKAFINGFGALTTFVVVIIIAITKFKEGAWIVVLLIPLLVFAMIKVKLHYIAVADQ
FT                   LRVTPEDKELLDVEHNIYRNRVIVPIESLNKASIRALRFAKTISDNIIAFNVSINEEQA
FT                   KKLQERYKMLNCSIPLVIRYSPYRKILEPLLEYIKSEEYNYQKGDMITVIIPKFTVQRW
FT                   WQKVLHNHTWLFIEKELLKHKHIVVSVMPLQLKDDDVVLKKKNKPLWKVLEED"
FT   gene            523178..525136
FT                   /locus_tag="Calkro_0404"
FT   CDS_pept        523178..525136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0404"
FT                   /product="protein of unknown function DUF1680"
FT                   /note="PFAM: protein of unknown function DUF1680; KEGG:
FT                   ate:Athe_2242 protein of unknown function DUF1680"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45304"
FT                   /db_xref="GOA:E4SE17"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE17"
FT                   /inference="protein motif:PFAM:PF07944"
FT                   /protein_id="ADQ45304.1"
FT                   /translation="MSDKDFSVYLNSPRIKDVSITDPFWRKYIDLVKDVVVPYQWEILN
FT                   DNVDIPVKSHAIKNFKIAAGLEEGEFEGFVFQDSDVAKWLEAASYVLEKYPNPDLEKKV
FT                   DEVIQLIGKAQWEDGYLNTYFTIKEKGKRWTNLEECHELYTAGHMIEAGCAHFLATGKT
FT                   TLLEIVKKIADHIYNVFGKEEGKIPGYDGHPEIELALVKLYEVTGDRKYLELAKFFVDE
FT                   RGQEPYYFDIEYEKRGKKSHWAGFKSLGREYLQAYRPLRQQKEAVGHAVRAVYLYSGAA
FT                   DVAAYTQDKELFDVCKTLFDDIVKRKMYITGAIGSSAHGEAFTFEYDLPNDTAYAETCA
FT                   SVGLIFFAHRLNKIEPHAKYYDVVERALYNTVIGSMSQDGKKYFYVNPLEVYPKEVEKR
FT                   FDRRHVKPERQPWFGCACCPPNVARLLASLGRYIYSYNHEGIYVNLYIGSSVQVEVGGV
FT                   KVLLQQMSSYPFEDIVKIDLKPSKEARFKLYLRIPSWCESYEVYVNGKKEEPEEPPSGY
FT                   VCIERLWKENDQVILKIPTEVKMVSSHPQVRSNVGKVAVVKGPVVFCAEEADNGKNLHL
FT                   LFVDVNGKGKLEFDSNILGGLYTVEVDGFRMAEDDFGEELYKSHRPKFVPAKIKLIPYY
FT                   AWANRGANEMRVWLLTK"
FT   gene            complement(525150..526040)
FT                   /locus_tag="Calkro_0405"
FT   CDS_pept        complement(525150..526040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0405"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   ate:Athe_2241 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45305"
FT                   /db_xref="GOA:E4SE18"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE18"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADQ45305.1"
FT                   /translation="MKVRFVSAFFAVILIYTLISSDLVFAQPQQIKIPVLVYHYFAKDQ
FT                   KEAQDYNSSTVVNIQKFERQMEYLYKNNFKTLTMEELYKFLKGEYTPPKKSVVITMDDG
FT                   YKNNITLAYPILKKYRFRACIFVIGKFLISKNSSNEFEYLSFEDTLKYTDVFEFGSHTY
FT                   DMHRLLNGMPILLQANMLDIIFDFVNNQMLINSPYFAYPFGAYDEKVIEVLKSFNYKLA
FT                   FTTKKGYVTSSTDPYEIPRFTISQKTTFDQFVKIVNGEYFDVYVHKSSNKIRKSKQPTK
FT                   LLDEKLQYNFIQKRG"
FT   sig_peptide     complement(525960..526040)
FT                   /locus_tag="Calkro_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.727 at
FT                   residue 27"
FT   gene            complement(526250..527302)
FT                   /locus_tag="Calkro_0406"
FT   CDS_pept        complement(526250..527302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45306"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE19"
FT                   /inference="similar to AA sequence:KEGG:Athe_2240"
FT                   /protein_id="ADQ45306.1"
FT                   /translation="MKRLLRLISSLLVVLILLSMSVSYILGASNQQSQTSLLEKSFKAE
FT                   LAKILNPDSPLSCDIISSSSGQKSLGYGLNLAINDMKTYKIAFDRKNKKLYVQTKKDNV
FT                   NQAVFINGQNVYRLDPKDNKYTHLNIPTNLWMSINIIDSTLTQPVNKLYQNILNYLGSQ
FT                   SSSIVKSAVKTTTSVGSKKITCWQLSANLPSKILEPAFKEFLSTSSKSVISQLKLMFDI
FT                   YLKSLTDDEKKALSSLNIDVNKISSADISKQLEIYLSKIIASLKLDDYKIIFYIDEKTG
FT                   KIVKLIIKNLPSTGSGILSRVEISNIQTGNDVKFPQIPQNMIKTQSNQVDIVGILKLIE
FT                   NFVSKMQQIK"
FT   sig_peptide     complement(527219..527302)
FT                   /locus_tag="Calkro_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.565 at
FT                   residue 28"
FT   gene            complement(527379..527906)
FT                   /locus_tag="Calkro_0407"
FT   CDS_pept        complement(527379..527906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45307"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE20"
FT                   /inference="similar to AA sequence:KEGG:Athe_2239"
FT                   /protein_id="ADQ45307.1"
FT                   /translation="MYEMNEKEAIILERFTNLLKEAPQMLERQKDLDKFAEEVSKILYS
FT                   LLIEIIVYSIEKLDDKIKESEDVKENWKNIKRDYRTILMPHAVVVYKRRYYQHKQTGEY
FT                   AYLVDKFLGIDSYQRLSQHYEEKIKSLFRIHKSFAGVLKELAKASSSTEISAQTIRNKV
FT                   FKDKKKEEKKQN"
FT   gene            528270..529985
FT                   /locus_tag="Calkro_0408"
FT   CDS_pept        528270..529985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0408"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   ate:Athe_2238 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45308"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE21"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADQ45308.1"
FT                   /translation="MSESSNDFWINNFKNIIEGNYERLVQLIKSERGFWLYDIEKKGVY
FT                   ISNGFEYISIQINGSVNFIQDVMTESEFKHLKKLVRDSIEKGQNGFSSRIKLKDGRWIF
FT                   VCATILYSEQEPLKIVGTFEDVTPHVSCDLRLSRYIELIAYYDEITGLPNRNFLNEVLR
FT                   EKIDKSKKDNSGFWVIFIEVSNFGYINELFGHSVGDEFLKAITFEIKKFLPRDWTFCRF
FT                   GGDEFVVLTSNIQRTSVAMVVENLIERFSRPWNVMGKWLYANINVGISGYPQDGEFADT
FT                   LLKNAEIALTEAKKHGRDYGKSQYEFYKISMEEEILRRVEIESEISRGILERQFFLVYQ
FT                   PKVSYDGRTVVGFESLLRWNSQKGILTPDKFIQIAEESGLVYDLNRLVLDIVCKDIKYI
FT                   KQKTSKTIPVAVNLSGKEFAMYNMIGVLNERLKTHNLLPEDIEIEVTERAILNNVELTK
FT                   QIFNSLHEKGIKISIDDFGTGYSSFELLLQLPIYALKIDKKFIDKIQLFGNEYVIVKNI
FT                   IYMAKEMNLKTVAEGVENKEQYEILRELGCDQFQGYYFSKPVNIEEVVVYNNDN"
FT   gene            530119..532014
FT                   /locus_tag="Calkro_0409"
FT   CDS_pept        530119..532014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0409"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: ate:Athe_2237 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45309"
FT                   /db_xref="GOA:E4SE22"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE22"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADQ45309.1"
FT                   /translation="MEKKLLKNDIATTKKVESKKQAEEKAKTKVLLRQQQLSERLAAAA
FT                   AQLMAGIEESTAAVEELNKNVEQLAAAAEETAAAVEESKTATDEIKKSANTAFQNAIDL
FT                   VDRAKTLNISVMDTTRKIHEIIEEVKLSAYKKLQASEFMKQLNESAKDINDIVISVGKI
FT                   ADQINLLALNAAIEAARAGEYGRGFAVVADEIRNLAEVVEKLTDSVSKNVNKINEEIQN
FT                   IDNEIKESVEYENSKAATGEEILTKLLETTRIFEKVLTNANEIQKSSQRTSNSMDEFLK
FT                   LMTNIASASEQIGAAIEEISQTVNEQVKAYKIASEKAEDLNQLAEEMRVSTAVEKDATK
FT                   ISASSDELSSAVEEISQSLSQIAEAFSQVESGSKIQVENANLARNNINEIVVESRKNKD
FT                   LSNELNDIINTFNDQMGEVIEKTVGLISDLSNVLESNNKVLKFIESLDNYIADLEKLIE
FT                   QISLVTVQTNMLSVNGSIEAARAGEYGRGFSVVANDVRNLAYESSENAQKMKDIVKSTQ
FT                   RKVLRFTSDIENLTLSTSNMVEKSKRDIEILNQTMGMIKDMKQATNSINMEILQIQSAL
FT                   EQLTKGIENISAAAQENLASLEEATRAVNEQRLGADELLSAIQDVASLAEEILAM"
FT   gene            532032..533468
FT                   /locus_tag="Calkro_0410"
FT   CDS_pept        532032..533468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0410"
FT                   /product="CheW protein"
FT                   /note="KEGG: ate:Athe_2236 CheW protein; PFAM: CheW domain
FT                   protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45310"
FT                   /db_xref="GOA:E4SE23"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE23"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADQ45310.1"
FT                   /translation="MSKIGTLDLNVIVFQIGKQNFAFSLDNVKEIIKVPSITPVPLTKS
FT                   HVAGLINLRGDVIPVLNLREKYGIESYIKSEDARIIIIEKNNVKIGMLVDKVLNISSID
FT                   QSQVNECKVTTIEEVKAVIKQKEEDKLITFIDTDKILEENLELSVFQKINIESSISKTE
FT                   ETEQKVLKQERYILVQIDGQNYALNIANIQEIIRFSDFSTVPSESEDILGIINLRNEII
FT                   PIINIQKLLKAESKEIDDETKIIIAYNSGFKFGFIVDKILSVISVNEYEIKPLPTIANY
FT                   KDIFTGTIKSDERMFIILGINKIFEKVSSAIYEEIKNQGEEALEMLKTSDEKQVVLFEI
FT                   NNQKFAIDIQKVKEINRIPSIVKVPNEKVYLKGIANLRGDIIAIIDLGILLYGEETQIN
FT                   DSSRVIIVELRGERFGILAKKVLSVSKVSAENIIEVDNSIEDDQMQEKLSNLDIKYIKA
FT                   IIKHNDDLIIQIDPEIILEE"
FT   gene            533501..534568
FT                   /locus_tag="Calkro_0411"
FT   CDS_pept        533501..534568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0411"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: ate:Athe_2235 response regulator receiver
FT                   modulated CheB methylesterase; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45311"
FT                   /db_xref="GOA:E4SE24"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE24"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ADQ45311.1"
FT                   /translation="MIKVLVVDDSAFMRKKLTEILESDPEIEVIATARDGEDAIRKAEE
FT                   YLPDVITLDINMPRMDGLTALRILMQKKIAPVVMVSSLTQEGAEITLKALEMGAFDFVP
FT                   KPGGTISLDIDKVKEDIIEKVRAAATSSKKFVVRKELAKKTMFDVSARPTISTQHEEQK
FT                   PFKAIVIGISTGGPKTIMDVLPYLPPNLNACVFLIQHMPPTFTAQYAKRLNENCQIEVI
FT                   EASAGMKVEKSKCYVGKGGYHLTLYGTNIEDLRIRLTQKPEHRFMPSVDVCMMSVLEKF
FT                   QENTIGVLMTGMGDDGADAMVKIRQRGGITIAESEETAIVFGMPREAILRGGADYVLPS
FT                   YKIAEKLIELIGQED"
FT   gene            534590..534952
FT                   /locus_tag="Calkro_0412"
FT   CDS_pept        534590..534952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0412"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ate:Athe_2234 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45312"
FT                   /db_xref="GOA:E4SE25"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE25"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45312.1"
FT                   /translation="MKRIMIVDDSPMIHKLLKKEIEKLGHEVCFCATNGQEAVEKYFEL
FT                   KPDLIFMDVTMPVLEGDAAYNKIIEKDKSCKVIFLSAIGDKELLNVNDPSNIVAIIRKP
FT                   FKSEDIQNAINKAFGG"
FT   gene            534959..535426
FT                   /locus_tag="Calkro_0413"
FT   CDS_pept        534959..535426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45313"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE26"
FT                   /inference="similar to AA sequence:KEGG:Athe_2233"
FT                   /protein_id="ADQ45313.1"
FT                   /translation="MIDEALNIADVVLKKIISENFNIEANNKQEIVPELDEFWYSGVVG
FT                   VLGIMGEIKGRVIIGIDFELSTYFVKMVYDQDIVTNSDILDVAYEIFNMIVGNTLVECK
FT                   KSYNTILRPTPPSIFLGDNMLIVSPKIQRKKIEYAFEYGKMFIEVGFERGI"
FT   gene            535427..535903
FT                   /locus_tag="Calkro_0414"
FT   CDS_pept        535427..535903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0414"
FT                   /product="CheC domain protein"
FT                   /note="PFAM: CheC domain protein; KEGG: ate:Athe_2232 CheC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45314"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE27"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADQ45314.1"
FT                   /translation="MVNENIIEAVKNATIAILQQFGVSDIRLSYYQQKENNESDYPVNV
FT                   TIGFLGKINGYVIVGLNEHIAEELVSIMTGGFLNTLDDPMARSTILELGNMLSAYIANN
FT                   MSAELGGEKVDITPPTLVMGNEVYIMMTRYESVDIKFSTEKGSIGINISVWGKD"
FT   gene            535907..536746
FT                   /locus_tag="Calkro_0415"
FT   CDS_pept        535907..536746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0415"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   ate:Athe_2231 MCP methyltransferase, CheR-type; SMART: MCP
FT                   methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45315"
FT                   /db_xref="GOA:E4SE28"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE28"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ADQ45315.1"
FT                   /translation="MIQDIDAASIDKIKRFILDKTGIYLNDQKISIVLQKLKKQINEGT
FT                   IKDLSHFYYNLVTDEKVLQDFINFLTVNETYFFREFEQLKAFAEVILPEVIEFKKKSGE
FT                   DRIKIWVAGCATGDEAYTISIILNEFLEDEIKFEIFASDIDTKALKIAELGIYEMRNVR
FT                   FVHHHYLNRYFDITNDGKFKVKDQMKRNIKFIHHNLVDFAKYFIFSKSDFIFCRNVLIY
FT                   FGDEQRKKVIDKMYEILNCGGYLFLGHSESVGRLSDKFNVRRINDYFFYYKECESGW"
FT   gene            536751..538529
FT                   /locus_tag="Calkro_0416"
FT   CDS_pept        536751..538529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0416"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: ate:Athe_2230 CheA signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; Hpt domain protein; Signal transducing histidine
FT                   kinase homodimeric; CheW domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; Hpt domain protein; CheW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45316"
FT                   /db_xref="GOA:E4SE29"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE29"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ45316.1"
FT                   /translation="MKVVVKEDELEILDDFLSESCEYLNNIEAEILALEERVTDEELVN
FT                   SLFRKYHSIKGLSGFFEGMNEFTKLCQIIEDVLAKIRNRTINVSSDVIDFLLKGSDVIK
FT                   KIVFGLSEVRKTGERNIEIEEEFNLELFEKEKESLIETEILKSKVEEKETKDEYFEKDF
FT                   EAKEEGNEEFSDKIEKKDNIEKIIESTTSALSSEFNEVKISYEKIDEMLGLVGEIITTK
FT                   STFYYLSKELEKYDVELSKKFKELFRFIHRTSEILQDNIMKIRMIPFELVVKRFNRLVR
FT                   ETAKKTGKKVKFIFTCNDVVIDKGVAEKLSEPLMHIIRNSIDHGIESASERKKIGKPEH
FT                   GKVELISYYRGQNIVIEIIDDGKGIDIERVTQKAIEKGILSEEKAKSLTADEAIKLIFE
FT                   PGFSTKDIADEISGRGVGMDVVKNTVEALKGKVEVKTEKSKGSKFILEIPTTAAVSQGI
FT                   VVVYNSQKFIIPFEYIEETVKISMKNVYGYVDKLIIDVRDEPIPLYPISYVLYQEDSCS
FT                   EDVVKRFTKDDELSVVILNIRGVKIAICVEKLMQNEEFVLKPLPKFLENNKLLLGTTID
FT                   YEGNVILVLNPEYFRL"
FT   gene            538659..540329
FT                   /locus_tag="Calkro_0417"
FT   CDS_pept        538659..540329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0417"
FT                   /product="L-ribulokinase"
FT                   /note="KEGG: ate:Athe_2229 ribulokinase; TIGRFAM:
FT                   L-ribulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45317"
FT                   /db_xref="GOA:E4SE30"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE30"
FT                   /inference="protein motif:TFAM:TIGR01234"
FT                   /protein_id="ADQ45317.1"
FT                   /translation="MAKFSIGIDFGTQSGRAVLVNVETGEEVATSVKEYTHGVMDESLP
FT                   DGTKLPHDWALQHPQDYIEVLATTVPDVLKKAGVSKDDVIGIGIDFTACTMLPIKKDGT
FT                   PLCMIDKFKSNPHAYVKLWKHHAAQKYANKLNQIAQERGEKFLQRYGGKISSEWLFPKI
FT                   MQILEEAPEVYEEADKFIEAADWIVFKMTGVEKRNSCTAGYKAIWSKREGYPSKEFFKA
FT                   LHPRLENVVDEKLSRDIYPIGQKAGELTEEMAKLIGLNPGTAVAIANVDAHVSVPAVGI
FT                   TDIGKMLMIIGTSTCHMLLWNEEKMVPGICGYVEDGILPGFYGYEAGQSCVGDHFEWFV
FT                   ENCVPAQYHDEAKQKGLNIYQLLKEKAKGLKPGQSGLLALDWWNGNRSILVDADLTGMM
FT                   LGMTLTTKPEEMYRALIEATAYGTKIIIDNFNEHGVEVRELYACGGIAEKDELLMQIYA
FT                   DVTGLEIKVSASPQTPALGSAMFGAVAAGKERGGYDSIFEAAKKMAKLKDYSYKPNLQN
FT                   HEVYKKLYREYRTLHDYFGRGANDVMKRLKEIKDEVSKM"
FT   gene            540433..541545
FT                   /locus_tag="Calkro_0418"
FT   CDS_pept        540433..541545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0418"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="KEGG: ate:Athe_2228 regulatory protein GntR HTH;
FT                   PFAM: regulatory protein GntR HTH; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45318"
FT                   /db_xref="GOA:E4SE31"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE31"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADQ45318.1"
FT                   /translation="MIKINLYIQDDGKMSKTKYELIKDFIIEGINSGKFKEGEKIYSEN
FT                   MLARKFKVSRHTVRRAIMELEFEGLLVSLKGRGTFVAKKSADSSKCIAVLTTFISDYIF
FT                   PLIIRGIEKVIAHEGYGLLLFSTDNSYEFERYHLESIINNPNIDAVIIEPTKSALPSKN
FT                   LELYKKLIQKDIPVIFINTILEEVTQNYIITKDQSAVYKLTTNLIKNGCKRLFGVFKGD
FT                   DLQGIKRYRGFEKACKEANVEFDAIFFTSEEYNFVHKRAAEVISREKFDAVVCYNDKIA
FT                   LPLCVKLKEMGFRIPQDISVTGFDNSLLATLTDIKLTTVEHPKEKLGEMAAKATIAMIK
FT                   KNKVHVSEEIECEIIYRNSTRGGIQECLKA"
FT   gene            541530..542174
FT                   /locus_tag="Calkro_0419"
FT   CDS_pept        541530..542174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0419"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ate:Athe_2227 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45319"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE32"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADQ45319.1"
FT                   /translation="MLESLKEIVCKYNLYLPKFGLVTWTSGNVSARDPETNLVVIKPSG
FT                   VMYDDLTPDKMVVVDMDGNVVEGDLKPSTDTLTHLYVYKHMPHINAVVHTHSNYATAFA
FT                   ALGQPIKVYLTAIADEFGCEIPCGPYAQIGGEDIGKVIVEYIGESPAILLQNHGVFTIG
FT                   KTVDEAVKAAVMVEDVAKTVFIAKMMGQPIEIPLDEVKRAHERYMTKYGQK"
FT   gene            complement(542258..543616)
FT                   /locus_tag="Calkro_0420"
FT   CDS_pept        complement(542258..543616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0420"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   ate:Athe_2226 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45320"
FT                   /db_xref="GOA:E4SE33"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE33"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADQ45320.1"
FT                   /translation="MNVKFNQKTHILEIEYQFRDVEEPNLFRNIYPYNEVPRLVFNHRI
FT                   VPMNVPERLYITDTTFRDGQQSRSPYTVDQICRIYDYLHELDNGSGVILHTEFFLYSKQ
FT                   DKEAVLKCLEKGYDFPKVTAWIRAKKEDFEIVKSLGIKETGILVSCSDYHIFKKLKMTR
FT                   SQAMKQYLEIVSAALEAGIIPRCHFEDITRADFYGFVLPFINELMKLSKEANMPVKIRA
FT                   CDTLGLGSPIPGVALPRSVPQIIYGIVNYGEVPSEWLEWHGHNDFYKAVINSTMAWLYG
FT                   ASMVNTSLLGIGERTGNTPLEAMVMEYIQIRGSADGMNVAVISEIAEYFKKEIGYEIPP
FT                   MTPFVGDNFNATRAGIHADGLMKDEEIYNIFDTGKILGKPPKVIIDAYSGIAGIVIWIN
FT                   RYFKDSGIDIQVDKKDPRVQKVKEWVDSQYENGRNTSISDEELKEVVSRIFGL"
FT   gene            complement(543835..544956)
FT                   /locus_tag="Calkro_0421"
FT   CDS_pept        complement(543835..544956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0421"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: ate:Athe_2219 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45321"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE34"
FT                   /inference="similar to AA sequence:KEGG:Athe_2219"
FT                   /protein_id="ADQ45321.1"
FT                   /translation="MAKSKVYFTDFKTKPGYNMLDKLENLVKKAGIETIDFKNKFVAIK
FT                   VHFGEPGNLAYIRPNYVARIVKLIKSLGGKPFVTDANTLYTGRRSNALDHLEAAYENGF
FT                   NPLVLGCHVIIADGLKGTEYREIEVNLKHTQKAKIGSAIADADIIISMNHFKGHEMTGF
FT                   GGAIKNIGMGSGSRGGKLFMHSSSKPVIKTSKCVGCGMCVKSCAQLAITLNEKKKAVID
FT                   YEKCVGCGQCVAVCQFGAATVRWDEAASIASEKIAEYTYAVLKDKPNFHINFIMNISPD
FT                   CDCWSHNDIPIAPDIGIAASFDPVALDKACVDLVNSSAFTPAGSAFEKAKHIEIDGKID
FT                   RFKSIHPDTDWQVALKHAQEIGLGSMEYELVKI"
FT   gene            545193..545756
FT                   /locus_tag="Calkro_0422"
FT   CDS_pept        545193..545756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0422"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: ate:Athe_2218 glutamine amidotransferase of
FT                   anthranilate synthase; TIGRFAM: glutamine amidotransferase
FT                   of anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45322"
FT                   /db_xref="GOA:E4SE35"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE35"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADQ45322.1"
FT                   /translation="MKVLIVDNFDSFTYNLYNYFLRLKVSTTVINRDKITTEKILQLNP
FT                   THIVLSPGPGRPTDDKILFEIIDKFKESKSILGVCLGHQAIGMFFGAKLKKARRPMHGI
FT                   VDTVFHDQKGVFENLKNPLRVVRYHSLVIDDVDSTQLTITAVSKEGEVMGIRHKRFKIE
FT                   GVQFHPESIATQHGLLMLKNFLKG"
FT   gene            545765..547084
FT                   /locus_tag="Calkro_0423"
FT   CDS_pept        545765..547084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0423"
FT                   /product="Chorismate binding-like protein"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: ate:Athe_2217
FT                   anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45323"
FT                   /db_xref="GOA:E4SE36"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE36"
FT                   /inference="protein motif:PFAM:PF00425"
FT                   /protein_id="ADQ45323.1"
FT                   /translation="MQILVYNTVVDPFLIFCHLKTDFSVLLESSMLSKRYGRYSFLFLK
FT                   PKEVYILDEEDDVFEYLNQLSNKITSKYCPSDFIFNGGFAGYFSYNFGVDLFEIERKKD
FT                   TSPIPKAYFGYFEDFVVIDHFEKKTYASFTSKALAQEFEMILISENLALPSFKRTCIER
FT                   AWCNFEKSEYMQAVKRIKNYIFEGDVYQVNLSQRFFVKGVFDSDFLYFNLRKSNYGCYH
FT                   AYIKLPKASVISTSPELFLRKRGDILITKPIKGTSKRGKTPEEDRILKKRLYNDIKCRS
FT                   ELLMIVDLERNDFAKICLPESIEVEKLFDVEEYSTVFHLVSTIKGKLLDGIDLKRIIEA
FT                   TFPGGSITGAPKLNAIKIIEELEKCPRGIYCGSIGYISNNFNMDFNIAIRTLVIEQDTA
FT                   YFSVGGGIVWDSQEEEEWWETIHKGRPFIEILGINNLTFM"
FT   gene            547101..547853
FT                   /locus_tag="Calkro_0424"
FT   CDS_pept        547101..547853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0424"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: ate:Athe_2216
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45324"
FT                   /db_xref="GOA:E4SE37"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE37"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADQ45324.1"
FT                   /translation="MEEFFRWYSFVLIPFETVYFDKKGVHFLFEHFKRFKRAFWILGVE
FT                   FDLEFEKFKQAIERYMVSCGRDYGGMRVLYVDGNLILEQKEIRYSRALFQKGFELKIAR
FT                   TRKDKANILNYIKTTNIGVNLIEEKSAKNKGFDSCLFLNQDGFICEAAFANIFFRRDKV
FT                   IYTPHISCGLLPGIVRKHVIRVSEKLGYIVRKAFLKIEDIKDMDECFITSSIAGIFPVL
FT                   RIENIEFKQRSFAEYLLSMDKFNRPWVS"
FT   gene            complement(547915..549201)
FT                   /locus_tag="Calkro_0425"
FT   CDS_pept        complement(547915..549201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0425"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   cbe:Cbei_4492 FMN-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45325"
FT                   /db_xref="GOA:E4SE38"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE38"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADQ45325.1"
FT                   /translation="MRKKVMPTQILRFFIQLISFIFFPLSFAMLLSQIKSLYLAFLGKE
FT                   NFQFNQNFIMLIVTLIITIFLGRFFCGWVCAFGSILEWIHFLGKKIFKKTFEMPKKLDS
FT                   FLKMIKYLVLVYLIVIVWTFGKTFYADPWDAFDNLLSLNFDIKTYLPSFVFFVFVLILS
FT                   LFVNRAHCRYFCPLGAIFNIISRAKLLFVKKVDKNCGKCRICTSACPMGIDMNNVENYK
FT                   GECIACVKCVESCPMLNIELNIAKTKIDPRYTSAAAIAGVFSVASFFATASSIELLNQK
FT                   FTSSKSSTTFSQSIQSENNTGLQENQTESENTGLATQNSQETTTQNSASKIYRDGTYTG
FT                   EGFGYRPGLVVQVTIKNDKITDIQIISHHETPSFAQLPFEIIPKEIIESQSTNVDIISG
FT                   ATRTSYGIIMAVEDALSKAKIENDESAQN"
FT   gene            complement(549198..550190)
FT                   /locus_tag="Calkro_0426"
FT   CDS_pept        complement(549198..550190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0426"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: ate:Athe_2215
FT                   ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45326"
FT                   /db_xref="GOA:E4SE39"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE39"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADQ45326.1"
FT                   /translation="MDTALISNKTKIIKSIFALGTDIHFIFYQSNFESAFDRAYKLILD
FT                   MENKLSVFKPKSLVSKLNRYGSYIPIKVCPEVYNLIKKSLEYSKFSEGYFDITIKRLMD
FT                   LWKEAKQKNKMPSKEEIELALTFSGSENIKLLPNYKVKLKNKVKLDFGAIAKGFVADKI
FT                   REIFEQEGINSAIVDLGGHILTVGKKHDESLWKVGIRHPFKTRKDILGFLELGSTSVVT
FT                   SASYERYFTIDGKKLSHIINPKTGFPVKDDIASITVVDTNSTFADAMSTALFAMGFKKA
FT                   INFIQDSKTIEAVVATSFREIYITPGLAQRFTLCDSSFRIIKTNEVIVL"
FT   gene            complement(550310..550912)
FT                   /locus_tag="Calkro_0427"
FT   CDS_pept        complement(550310..550912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0427"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ate:Athe_2214
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45327"
FT                   /db_xref="GOA:E4SE40"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE40"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADQ45327.1"
FT                   /translation="MFLRKEGRRAQKKLIKENKLLDAAYNLFIEKGITATAIDEIVKKA
FT                   GVAKGTFYLYFKDKEDILEKLILKKSSEIVKKALQEVSTREFSSSVDKFLYFLEYIIDY
FT                   LSKNRVLFKFLKKDFSWVFYKKITENEQFAELKRAKEMFLKNFNTNYTQEELEIVVFMI
FT                   LELVSSLTYSSIVNDEPAPIEKVKPLLLSTIRKILEN"
FT   gene            complement(550956..551759)
FT                   /locus_tag="Calkro_0428"
FT   CDS_pept        complement(550956..551759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0428"
FT                   /product="esterase/lipase-like protein"
FT                   /note="KEGG: ate:Athe_2213 esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45328"
FT                   /db_xref="GOA:E4SE41"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE41"
FT                   /inference="similar to AA sequence:KEGG:Athe_2213"
FT                   /protein_id="ADQ45328.1"
FT                   /translation="MIPLWENQDDIPFFDPENPFVPHLVPYTLESSNKLSCIIVFPGGG
FT                   YTHRAQHEGEPVCKWLNSIGISAFLLNYRVLPYKHPAPLLDAKRSIRLVRYFSKKWNID
FT                   PNRIGVLGFSAGGHLASLAGTHFDSGDKKNNDPVERVSSRPDCMVLCYPVISLAEYAHE
FT                   GSKKALLGENPDPVLVWTLSSHNMVSSKTPPTFLWHTSDDSSVPVENSLLFAMALKKHG
FT                   VPFELHIFPHGRHGLGLANETLYVKEWTNLCEKWFESIGFIGYNV"
FT   gene            551925..552968
FT                   /locus_tag="Calkro_0429"
FT   CDS_pept        551925..552968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0429"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: ate:Athe_2212 C4-dicarboxylate
FT                   transporter/malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45329"
FT                   /db_xref="GOA:E4SE42"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE42"
FT                   /inference="protein motif:PFAM:PF03595"
FT                   /protein_id="ADQ45329.1"
FT                   /translation="MKSIIKNFYPSWFVVCMGTGIITNLFKAVGYNFLSITFALINIVF
FT                   FAIIFLIWFLKWFIGFESVKKDIENPLLSNYFATMPISLLIVGLNILINQQFFGKIFSV
FT                   AFARYSFYLGSFLMIIFSITTFLVHLSHREIPGSLLNFAYFMPPVGNIIVPILGNEIIN
FT                   RSVVDGNEKSIITFINLTMFGIGFMLFLSYLPIIKGRFILQEPIEKGHFPTMFILLAPV
FT                   GASIVALKGFVQSLKLTGTIDNAALPALINVLTTILWGFGFWVLMALVFLLLKNLKIKI
FT                   PFSLAYWAYIFPIGIFVLATFKVNSSYNFLLLNLFVKSFVWILFVVWVYNILLTLKNVF
FT                   NKKLLVR"
FT   gene            complement(553058..553357)
FT                   /locus_tag="Calkro_0430"
FT   CDS_pept        complement(553058..553357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0430"
FT                   /product="protein of unknown function DUF1634"
FT                   /note="PFAM: protein of unknown function DUF1634; KEGG:
FT                   ate:Athe_2211 protein of unknown function DUF1634"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45330"
FT                   /db_xref="GOA:E4SE43"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE43"
FT                   /inference="protein motif:PFAM:PF07843"
FT                   /protein_id="ADQ45330.1"
FT                   /translation="MENKKVTTMEDIISIVLRAGVLLSIIVICAGLFLHIVLKLSAGSL
FT                   IIKTGLYILFLTPFARLVVSLLMFLIEKDLIYFAITLSIILIIIGSNLLVSINF"
FT   gene            complement(553358..554188)
FT                   /locus_tag="Calkro_0431"
FT   CDS_pept        complement(553358..554188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0431"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ate:Athe_2210 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45331"
FT                   /db_xref="GOA:E4SE44"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE44"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADQ45331.1"
FT                   /translation="MIAEIFAVSIIAGFVGSLLGIGGGLIVIPFLSIVFKFNMHQAAAA
FT                   GLVSVIATSSGAASAYVKDKLTHLRIGMFLQLATVIGGVLGAILSGILPAKVLSLIFGV
FT                   LLLYNSFLMIKNRKSDEKPQSSSFQISKWAKKLKLYGSYFDKIQNREIEYSAQNIAGGF
FT                   LMMIFAGILSGLLGIGSGIFKVLALDTIMKLPFKVSTATSNFMMGVTALASISIYLARG
FT                   DIVYDACGAVAVGVLFGSLLGAKVMPYIKSKYLRVAFALVLIYTSIEMIKKGLF"
FT   gene            complement(554335..554427)
FT                   /locus_tag="Calkro_R0012"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(554335..554427)
FT                   /locus_tag="Calkro_R0012"
FT                   /product="tRNA-Ser"
FT   gene            554631..555029
FT                   /locus_tag="Calkro_0432"
FT   CDS_pept        554631..555029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0432"
FT                   /product="thioesterase superfamily protein"
FT                   /note="KEGG: ate:Athe_2209 thioesterase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45332"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE45"
FT                   /inference="similar to AA sequence:KEGG:Athe_2209"
FT                   /protein_id="ADQ45332.1"
FT                   /translation="MKKPELQVGLKFEIEEVVNDNMLASHFQSGLLDVFATPSMIALME
FT                   KAALLCVENYLEEGYTTVGSKVDVLHLAPTPKGMKVKAVAQLIAIEDRKLTFKVEAYDA
FT                   FEKIGEGIHERFIVNRERFLNKTYQKAR"
FT   gene            555039..556700
FT                   /locus_tag="Calkro_0433"
FT   CDS_pept        555039..556700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0433"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="KEGG: ate:Athe_2208 formate--tetrahydrofolate
FT                   ligase; PFAM: formate-tetrahydrofolate ligase FTHFS"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45333"
FT                   /db_xref="GOA:E4SE46"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE46"
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /protein_id="ADQ45333.1"
FT                   /translation="MKSISKVQETTLEPISKIAEKIGLDEDDLELYGKYKAKISLDVLK
FT                   KKADKEDGKVILVTSINPTPFGEGKTTTAIGLSMAINRLGFKSIVTLREPSLGPFLGLK
FT                   GGATGGGASQILPSIDINLHFTGDIHAVTSANNLLCAAIDNHIYHGNSLGINPKSITIK
FT                   RAMDMNDRSLRHIIVGLSNDQKGAIREDGFVISVASEVMAVLCLSMSYDDLKEKLGNIL
FT                   VGFTYHKKPVYAKDLNVHGSMALLLKDALKPNLVQTSEYTAAIVHGGPFANIAHGTNSI
FT                   VATKIAQKLSEYVVVEAGFGSDLGAEKFINIVARKSGIYPQAAVLVVTVKALKHHAKIE
FT                   ENSGLQSGVHSIQKGLENLEKHIENLKVMGFETVVALNKFPDDKDEEIELIRSFCEEMG
FT                   VEFSVSSAYTHGSEGVLDLAEKVIEVSNKRKKINFVYQDSDSIEEKIKKVATIIYGAKD
FT                   VKFSKAALSKLELIKNLKVEHFPICMSKTQYSLSDDPKVLGRPKDFVLNVTDIEIKNGA
FT                   GFVVVMCGDIIAMPGLGKDFAALHLDIDNSGNPIFK"
FT   gene            556755..558005
FT                   /locus_tag="Calkro_0434"
FT   CDS_pept        556755..558005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0434"
FT                   /product="Glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: ate:Athe_2207 glycine C-acetyltransferase;
FT                   PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45334"
FT                   /db_xref="GOA:E4SE47"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE47"
FT                   /inference="protein motif:PRIAM:2.3.1.29"
FT                   /protein_id="ADQ45334.1"
FT                   /translation="MIDTTKFSLADFMKSEDKNIMELAKEFWEYKEDYVRRRHYQYRRV
FT                   SITGSGPTMKIIDHYTGQVKEMINLASNDYLNLTKHPRTIKAGIEAVKKYGTGAGSVPL
FT                   LGGTLDIHVELEKKLAKFKGCEDALIYTSGYGSNLGTISAILHEKDVAILDMYVHASII
FT                   DGCRNTNVEFFRHNNMDSLEKVLKKVKDKYNTKLVIVDGVYSMDGDIAPLDQIVEIAHA
FT                   YGAFVMVDEAHATGVIGKNGRGTPEHCNVEGKVDIVAGTLSKALGAVGGFIATNKELVN
FT                   YLHFYSRAYMFSTAPTPQATASLIEALNVIEEEPELRQRLWDNIRYFRENLLKLGFNLG
FT                   NQQTAIFPIIIGDDYKVKEMCRELHEAGIYVNPVFYPAVPRRLSRIRMSITAGHTKEHL
FT                   DRTLDVLEHLGKKYGII"
FT   gene            558098..559315
FT                   /locus_tag="Calkro_0435"
FT   CDS_pept        558098..559315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0435"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   ate:Athe_2206 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45335"
FT                   /db_xref="GOA:E4SE48"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE48"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADQ45335.1"
FT                   /translation="MKAVVFDANVAKYIRTLLLGKISKKFFYNRFSCIQLKDIPEPELP
FT                   SENYVKIKTTYAGICGSDLNLIFLHDSPSTSPFASFPFVIGHENLGVIIEKGKAVSEFE
FT                   IGDRVIVDPVLDCDARELPRCSSCQEEEFSTCLNITEGKLSPGTIMGACSTTGGSWGEY
FT                   FVAHKSQVIKVPATVKDQEAILVDPLASALHPVMRSFPKDSEKVLVYGAGIIGLLVIWS
FT                   LRKLGSSADITALAKYDFQADLAKEFGANRVVKSKEGYLDELAKISDAKIFKPMIGDKV
FT                   LLGGFDKVFDCVGSRKTIRDGMWLTKQRGSYILVGLASLVKDLDLTPIWFKELNVKGAY
FT                   CYSTENINEYKMSTYQLALSLIQQHGIPYEKLITHYFRLEDYQKAIEVASSKGSEKSIK
FT                   VVFKFL"
FT   gene            559486..560400
FT                   /locus_tag="Calkro_0436"
FT   CDS_pept        559486..560400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45336"
FT                   /db_xref="GOA:E4SE49"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE49"
FT                   /inference="similar to AA sequence:KEGG:Athe_2205"
FT                   /protein_id="ADQ45336.1"
FT                   /translation="MKEKFTRAYGIVTFTELLLFFGLVLYIQLQTHTYSIVSWILICIS
FT                   LSLIVAAGYVFGILPIINEFGGRVKKIEDVLKLMESNFEFFNEDDKKFESAVQTLKNKF
FT                   HLVKEESGAENQFIFDYKEMIIRNIQIIYGIAVEKGQKEIEGLAMSLLDALEASVYSNR
FT                   IFVPLWYEVTLFQTILSGCVYSLKNNFEIVVNFHNDSVKERFILHGTLSFIAKLFTSCS
FT                   ERQLPIKSVIQLSIFELSGMLNIRIYYNDVVKNHEKIEEVMNILKNKFALYYPEGSYLI
FT                   TYSTGDNHIVIEMTLPEIKSSES"
FT   gene            560508..561521
FT                   /locus_tag="Calkro_0437"
FT   CDS_pept        560508..561521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0437"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2204 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45337"
FT                   /db_xref="GOA:E4SE50"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE50"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADQ45337.1"
FT                   /translation="MVTIKDIAREAGVSPSTVSRVLSGKAKISPETTKRVMEAIKKLGY
FT                   IPNASAKSLVMKKAYSVGIFMPRRLEQTLTSTFFDQVVSGICSYINNTEYEIVLSIVPP
FT                   EKERESLERLIKSKKVDGFILLTSRINDYAIKYLRNLKFPFVLIGSPDKDKDYVNWVDN
FT                   DNKKAAFEATEYLIRLGHTQIGFLGGMENLVLTQDRLSGYKSALSKYKIPVENQYVMFT
FT                   EFDEQSSYEKAKQMLQLPNRPTAIVCIDEVVAYAAIRACRELDLKVGYDVSVIGFNESI
FT                   FSKLSSPRLTTVNTNIFYLGYYAAEMLIKELEEPYKTYKRLIVEHSIVEGETCRAI"
FT   gene            561541..562299
FT                   /locus_tag="Calkro_0438"
FT   CDS_pept        561541..562299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0438"
FT                   /product="alpha/beta fold family hydrolase-like protein"
FT                   /note="KEGG: csc:Csac_1229 alpha/beta fold family
FT                   hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45338"
FT                   /db_xref="GOA:E4SE51"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE51"
FT                   /inference="similar to AA sequence:KEGG:Csac_1229"
FT                   /protein_id="ADQ45338.1"
FT                   /translation="MQKHVEIKNKIGQVLRGYLHTPEEYEGRIPAVAIFHGFTGNKMEP
FT                   HFIFVKLSRLLEQHGIASVRFDFAGSGESDGEFYDMTVTREIDDARCILEYLFSLDFVD
FT                   KQKVSIVGLSLGGAISSYLAGEYKEKLYKVVLWAPAGNMKEIAKNVVETNPTIKEKGYI
FT                   DLGGLLLSQDFYYDLQKYDFFEEIKRYPGKVLILHGTNDQAVPIEVGRKYKQILGDRAD
FT                   LVEIEGADHTFNKYEWERLVLDKTVEFLKD"
FT   gene            complement(562723..562911)
FT                   /locus_tag="Calkro_0439"
FT   CDS_pept        complement(562723..562911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0439"
FT                   /product="ribosomal protein L28"
FT                   /note="KEGG: ate:Athe_2199 ribosomal protein L28; TIGRFAM:
FT                   ribosomal protein L28; PFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45339"
FT                   /db_xref="GOA:E4SE52"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE52"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ADQ45339.1"
FT                   /translation="MAMCEVCGKKVAFGNKVSHSNKKSRRTWKPNVKKIKVLLQNGQRK
FT                   RIYVCTSCIKAGKVARA"
FT   gene            complement(562993..564060)
FT                   /locus_tag="Calkro_0440"
FT   CDS_pept        complement(562993..564060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0440"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   ate:Athe_2198 protein of unknown function DUF43"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45340"
FT                   /db_xref="GOA:E4SE53"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR014435"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE53"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ADQ45340.1"
FT                   /translation="MDVLKGAVDFVQNKTKVEVNQRDIEKILSALNSTNHFWEVIFLSQ
FT                   KPFAVVRETINYLISIDFVKTDESGNLILTEKGKEFISANNIPVVKNYTCQYCEGRGIV
FT                   FSEIKDAYEKFKEIVKTRPDAIVEYDQGYVTEETAYSRIALMIKKGDLVGKRLIVFGDD
FT                   DLVSIAAALTKLPKEVIVLEIDKRLVDFINQAAKEHNLNLKAIEYDFRNKLPDDFVKSF
FT                   DTFTIDPPETIEALDLCFTRTISSLKGAGCAGYFGLTNIEASLSKWHEFQKLLLNKFNA
FT                   VITDIIENFNHYVNWNYLLPSLESSLTFVNVQPKLNWYTSSMYRIELVKDVDIKNEFIN
FT                   CELYIDNEAILYKEN"
FT   gene            564178..565374
FT                   /locus_tag="Calkro_0441"
FT   CDS_pept        564178..565374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0441"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   ate:Athe_2197 tRNA pseudouridine synthase D TruD"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45341"
FT                   /db_xref="GOA:E4SE54"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE54"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADQ45341.1"
FT                   /translation="MWILKGDNSLKIKVLPEDFVVKEKLKIEIKPSGKYKIYLLAKRHW
FT                   NTVDALRFISKENKIPLEKIGCAGRKDRHALTFQYISVPREYTINFNKENVKVEFIGYS
FT                   DDFVSPLILEGNFFEITMRKLKNKDEKILQRLNEVQQFGFPNYFDDQRFGSTQSEDEFI
FT                   GEKIVKKHYNGALKLYFTTIHPEDKKEEKERKKKISELWGDFEKILPLCKTKVERDIIK
FT                   TLLKGNSRHYLIRALNLIPKEEMSIFLSAYQSYIWNRTLSSILPYYADLLKPVKGKIME
FT                   YLIYTTLSKKSLNELKNLQIPTVSSKIPYVSDIVNNAILEILNERGVKTSDFDTKKIKS
FT                   WYFKSFLRPAIIFPEKLEVSSFEEDDFYEGYYKLRIKFYLPAGSFATMLIKSLTITNI"
FT   gene            565433..565509
FT                   /locus_tag="Calkro_R0013"
FT                   /note="tRNA-His1"
FT   tRNA            565433..565509
FT                   /locus_tag="Calkro_R0013"
FT                   /product="tRNA-His"
FT   gene            565522..565597
FT                   /locus_tag="Calkro_R0014"
FT                   /note="tRNA-Gln1"
FT   tRNA            565522..565597
FT                   /locus_tag="Calkro_R0014"
FT                   /product="tRNA-Gln"
FT   gene            566384..566821
FT                   /locus_tag="Calkro_0442"
FT   CDS_pept        566384..566821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0442"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ate:Athe_2195 DNA polymerase beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45342"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE55"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADQ45342.1"
FT                   /translation="MIRRNKVDIDHAKKAIEDLEEFFRRFGNKVVAAYLFGSFAMGTYT
FT                   PLSDIDIAVLFDKELSKTIVEELENEILDGLMKIFKTDEIDLVVLNSAPLSVRYGVLKT
FT                   GKIVYCSNTEKTVDFQTEVISKYLDIKPYREEFYREFLKSL"
FT   gene            566853..567284
FT                   /locus_tag="Calkro_0443"
FT   CDS_pept        566853..567284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0443"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   ate:Athe_2194 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45343"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE56"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ADQ45343.1"
FT                   /translation="MDEKILFHLKLLKKYTGLLKDISKVDFEEYMANEILKGAVQRYLQ
FT                   IAIETCINIGNRIISIEQTKGKNIKTPETYADIFLALSQLGIINDEFSTRLSQMARFRN
FT                   KLVHLYCEIDDSLVYRFIKENMQDFEEYICCIKRYLQNN"
FT   gene            567404..567479
FT                   /locus_tag="Calkro_R0015"
FT                   /note="tRNA-Lys3"
FT   tRNA            567404..567479
FT                   /locus_tag="Calkro_R0015"
FT                   /product="tRNA-Lys"
FT   gene            567590..569122
FT                   /locus_tag="Calkro_0444"
FT   CDS_pept        567590..569122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0444"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: ate:Athe_2193 Mg chelatase,
FT                   subunit ChlI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45344"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE57"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADQ45344.1"
FT                   /translation="MLAKVLTSSYLGIKGYIVTVETDMSNGLPSFDIVGLPDVTIKEAK
FT                   ERIRVAIKNSGFDFPNRKIIVNLAPANTKKEGSSFDLPVAISVLKSSEQINPKISPYEI
FT                   AIIGELSLDGSVKRVDGALLMTISALENGIKKIIVPYENRAECSIVKGIDVFPVKTLKE
FT                   AVEILDNPQNATPYKVEIDEMNFLDTFTYDVDFSEVKGQEYVKRAVEVAVAGMHNLLLI
FT                   GPPGSGKTMIAQRIPTILPQMTFEESLEVTKIYSCAGLLKDGQALITARPFRSPHHTSS
FT                   SIAIIGGGRVPKPGEVSLAHNGVLFLDEFPEFDKKTIEVLRQPLEDGYVTISRVNASIE
FT                   YPARFMLVCSMNPCKCGYFLSDERECTCTPAQIKQYLGRISGPILDRIDVQVEVKVVKL
FT                   ENFNSSICKDSAAMRKEVERARQIQLERFKGLGIFYNSQMKGSLVNKFCKLSKKEKQLL
FT                   ERAFTTLGLSLRGYTKILKVARTVADLEGSEEIKAEHLQEAISYRMLERRLI"
FT   gene            complement(569115..569930)
FT                   /locus_tag="Calkro_0445"
FT   CDS_pept        complement(569115..569930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0445"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: ate:Athe_2192 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45345"
FT                   /db_xref="GOA:E4SE58"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE58"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADQ45345.1"
FT                   /translation="MLQYEFMQRAFLAGVLVSIMTSLVGNFLVLKRLSQIGDSLSHTAI
FT                   VGVAAALLFNFSPTIGAIISTVAFALAIEYFKSRFKRFEEISLALTSITALGLASVLFG
FT                   ILKSSSNLMSFLFGSIVTIGNEDVWIIFAVCLVTVTFIAMFRKRLILATFDEVSAMVSG
FT                   INTKLLDFLLGIISATIIAVSVKIVGGLLISSLIVFPTAIAMRFSKNFRMLQVVSLLVS
FT                   LIAVISGLTSSYYLDIPPGGSTVLIFVLIFFVVEITNIARKRSLAKTFK"
FT   gene            complement(569953..570702)
FT                   /locus_tag="Calkro_0446"
FT   CDS_pept        complement(569953..570702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0446"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_2191 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45346"
FT                   /db_xref="GOA:E4SE59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE59"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADQ45346.1"
FT                   /translation="MIELIDVNFYIDQKRILKDINLKVQKGEFVAIVGPNGSGKSTLLN
FT                   IISGIYAPTSGKILIFGKQHLTPQDRQKISFVPQKVTNFNQSFPLSVFETVLLGLVPKK
FT                   GLLQRFSKQDFEKAESILEKLQIKQLKNRLIGELSGGQQQRVFLARALISDPQILLLDE
FT                   PTVGIDSLSEQLLFEILGEKKKEGTTILMVTHDVYAVTQHADTIICMGDGMIYTACRAK
FT                   DFSPSKYESVYKYKIKKIEHRHSYIKK"
FT   gene            complement(570726..571589)
FT                   /locus_tag="Calkro_0447"
FT   CDS_pept        complement(570726..571589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0447"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ate:Athe_2190 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45347"
FT                   /db_xref="GOA:E4SE60"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE60"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADQ45347.1"
FT                   /translation="MKKIKLLTIPLLISFMVFLSSCKNESLTTTKGTVYTTIYPLYSIT
FT                   KLIAGQNITVEKLVKDGAEIHSFEPSSRDIAKITSAKAVIYLGLVDEWVKKPLEGTKVK
FT                   IFRASEGIGFVDNDPHIWTSPRLLKKIARNIENFLTSLDPKNKSYYQENASKLIASLDK
FT                   LDKEFSSVVKNSKRKEFLIAHPSFGYLARDYSLKQYSITGVNEEEEPSAQKMKEIVQLI
FT                   KEKNIKYILVDPNENLPAVKTIAKDTGVKIVNIYGMGIVNSSQAKNETILSLMEKNLKA
FT                   FEMVLK"
FT   sig_peptide     complement(571518..571589)
FT                   /locus_tag="Calkro_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.388 at
FT                   residue 24"
FT   gene            complement(571589..572011)
FT                   /locus_tag="Calkro_0448"
FT   CDS_pept        complement(571589..572011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0448"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: ate:Athe_2189
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45348"
FT                   /db_xref="GOA:E4SE61"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE61"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADQ45348.1"
FT                   /translation="MKHQDVKSILNLHNIKATRQRIEIYKVLQKAQQCLSADEILQTLE
FT                   AQNMKINLATVYRNLELFVQNGIAVKSTINRKHFFEIKKSSHHHYFVCIKCNAKAEIVD
FT                   CKINLIEEELNKRNFKILDHNLEVYGICDKCCGRKE"
FT   gene            complement(572168..572485)
FT                   /locus_tag="Calkro_0449"
FT   CDS_pept        complement(572168..572485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0449"
FT                   /product="regulatory protein ArsR"
FT                   /note="KEGG: ate:Athe_2186 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45349"
FT                   /db_xref="GOA:E4SE62"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE62"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADQ45349.1"
FT                   /translation="MTRLNEILYALSDTTRLRILNILAHREQNVSSLVQLIQESQPKVS
FT                   RHLAYLKNVGLIEARNHAQKRIYSIKEDVFEKYPFLKALIQDLAKVDIFANDLRLLSSL
FT                   T"
FT   gene            572652..574049
FT                   /locus_tag="Calkro_0450"
FT   CDS_pept        572652..574049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0450"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ate:Athe_2185 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45350"
FT                   /db_xref="GOA:E4SE63"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE63"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADQ45350.1"
FT                   /translation="MELPKKIIGEAVLKQVIRYLSNNPEENIGKILDLTEKIVRRDRDK
FT                   WYIQNAKKYLLDPNSSWHHYAMRIIKETNPRVRERILINFFLNAGFIGVPKQLELIKKY
FT                   DINIPYAILIDPTAACNLHCKGCWAGEYHKAAKLDYEILDRVVKEAQELGIYFIIFSGG
FT                   EPLLRKDDILKLCEKYEDTVFLSFTNATLIDDDFIDKVAKVGNLAFAISIDGFEKSTDE
FT                   RRGQGVFKKVVTAMEKLKEAGVVFGFSTTYHRYNVEEVSSDEYIDFLIEKGAKFGWYFT
FT                   YVPVGKDADISYMATPEQRAYMYRRIEEIRWSKPIFVLDFWNDGEPAGGCIAGGRRYLH
FT                   INANGDVEPCAFIHFSNVNIKECSLLDALKSPLFMAYRKNIPFNENHLRPCPMIDNPLK
FT                   LKQIVEESGAHPTQIGGETETAEELANKLIEYSEAWGRVADKLWEQRKQGVPQNKVDLS
FT                   VIEEIKR"
FT   gene            complement(574081..574710)
FT                   /locus_tag="Calkro_0451"
FT   CDS_pept        complement(574081..574710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0451"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   ate:Athe_2184 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45351"
FT                   /db_xref="GOA:E4SE64"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE64"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADQ45351.1"
FT                   /translation="MKMKEFVFYFFAFLIGSIPFSYIITKKFFNKDITHFYDNNPGATN
FT                   AFRVAGIKAGIPSLILDISKGYFTIYIANTIFYPQKLPVYVCAFMVVLGHAYSIFLKLK
FT                   GGKSIASTMGILLFLYGVLPVIFFCLGTFLGLLVFRKDNIGTVLGIWSVILFAVLFNTN
FT                   ANDIIFLSMLCLFLTYRQLRTPSIPIDIIKVIKNTIKKASHSFLGK"
FT   gene            574804..576159
FT                   /locus_tag="Calkro_0452"
FT   CDS_pept        574804..576159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0452"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   ate:Athe_2183 protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45352"
FT                   /db_xref="GOA:E4SE65"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE65"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ADQ45352.1"
FT                   /translation="MKKIRDGVYTNDYAIFFMTEEILKDLDEGVLQQAKNASQIPNVEF
FT                   LGYTPDAHIGKGTSIGTIIVWDMSKAWISPTIVGVDIGCGMRLILTDKFADDIDKALLK
FT                   KIMDEVEDLIPTGVGKKNKKIALSKTKYEEYLQNTEIDKDISDKMVLIHEFDLDTIPDE
FT                   AYEIGKEQFATLGGGNHFIEFQKLHVIDKIIAEKWGLFDGQFVVMIHSGSRRFGAVIGD
FT                   YYQKKFKDVMKSKGITTPDPQLTFLPIDNKVAKDYIKAMQSAAIYAKINRHYMSNFIIS
FT                   VLEKHSIDAWVLYDVAHNIAYMERFANREKLVIRKGATRALPPNHYLIPNPKFAETGHP
FT                   VILPGSMGSSSYLMRGIEDNIISYHTVNHGAGRVLSRTKAKKTISIEEFSKALKQGQSG
FT                   EILINTKNLKDFLDESPQSYKDIELVINSVITSRLATPVAKMEPLGVIKGKD"
FT   gene            576191..577288
FT                   /locus_tag="Calkro_0453"
FT   CDS_pept        576191..577288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0453"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: ate:Athe_2182 DNA protecting protein DprA;
FT                   TIGRFAM: DNA protecting protein DprA; PFAM: SMF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45353"
FT                   /db_xref="GOA:E4SE66"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE66"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADQ45353.1"
FT                   /translation="MNREELIYSLWLYSIKGIGPKKFRQIKNKYKSLKDAYLNKKELEV
FT                   EGIIGAVKDEIKNSDLQRAEKILEFCEKNSINIILEDDELYPDEFKVFDHAPVMLFVKG
FT                   DAKLLKFPRKISIVGTREPTYYGKKVAKELASLLTSLEILVVSGMARGIDSFCHAGALE
FT                   NGKTVAVLGCGVDIVYPKENLKLYRQIIENGCVVSEFLPGTLPEKMNFPQRNRIVAMFS
FT                   PCLVVIEASTKSGTFSTVDFALEQGKEVFAVPGNIFSQKSSGTNRLIKEGARIICSYED
FT                   FLEDIKEIYTLKPAQLSFDANEDEEELTDDEKRLIKLLDENGEMHVESLIALTGWEPGK
FT                   LASLITSLEIKAKVVRGRGNIISKL"
FT   gene            577320..579401
FT                   /locus_tag="Calkro_0454"
FT   CDS_pept        577320..579401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0454"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; TIGRFAM: DNA topoisomerase I; KEGG: ate:Athe_2181
FT                   DNA topoisomerase I; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain-containing protein;
FT                   DNA topoisomerase type IA zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45354"
FT                   /db_xref="GOA:E4SE67"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE67"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADQ45354.1"
FT                   /translation="MKKLVIVESPAKAKTIAKYLGKEFKVEASMGHVRDLPKSDLGVDI
FT                   ENGFVPKYINIRGKADVINRLKKSAQEAEKVYLATDPDREGEAISWHLATILGLDTNDN
FT                   VRITFNEITKKAVQESLKNARPIDQNLVNAQQARRVLDRLVGYKLSPFLWEKVKGGLSA
FT                   GRVQSVATRLVVEREEEIENFKPEEYWTLEAVFKKDVQEFKAKFYGDKKGKIELKNQDQ
FT                   VQKIEEKIKNKEFKVVKIKVSEKKKSPPPPFITSTLQQEASRKLRFTPAKTMAVAQMLY
FT                   EGVEIKGEGSVGLITYMRTDSTRVSEEAQQAARSLIVQKFGKEYIPEKPRVYKTKKDAQ
FT                   DAHEAIRPTYLDMDPESIKDSLTLDQYKLYKLIYDRFLASQMESSIYEVLSAELEVEGY
FT                   IFRLTGSKLKFAGFMEVYVEGKDTEDEEEENQLPEIREGETLKPIKLESKQHFTQPPSR
FT                   YTEATLIKALEEKGIGRPSTYAPTIQTILERGYVAKEDRFLKPTELGRIVTNILKEYFK
FT                   DIIDIEFTAELESNLDKIEEGKLEWTEVVKKYYQPLEKELEIARATLLKVKVEDEETDI
FT                   VCENCGRKMVIKKGRYGKFLACPGYPECKNTKPYYDYLDVLCPKCGKRIIEKKSKKGKR
FT                   YYTCEGYPDCDLILWEKPVKNCPKCGSLMFEKGKKGNKKLVCSNENCAYQEKTGEKGE"
FT   gene            579407..580717
FT                   /locus_tag="Calkro_0455"
FT   CDS_pept        579407..580717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0455"
FT                   /product="gid protein"
FT                   /EC_number="2.1.1.74"
FT                   /note="TIGRFAM: gid protein; KEGG: ate:Athe_2180 tRNA
FT                   (uracil-5-)-methyltransferase Gid; PFAM: glucose-inhibited
FT                   division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45355"
FT                   /db_xref="GOA:E4SE68"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE68"
FT                   /inference="protein motif:TFAM:TIGR00137"
FT                   /protein_id="ADQ45355.1"
FT                   /translation="MEIVVIGAGLAGVEAANVITKFGIKVKLFEMKPKKFSPAHKIDNF
FT                   AELVCSNSLKSKLLTNASGLLKEEMKVFGSLVMEAAEATSVEAGQALAVDRYKFSEYIT
FT                   QRIKQNGLISVIHEEVTEVPRDKVVVVSTGPLTTESLLSDISKLCNSKNLYFFDAAAPI
FT                   VLKDSIDFSKAFFASRYNKGSNDYINCPMTKEEYERFYWELVNAEVIEVKDFEKDLLFE
FT                   GCMPIEEMARRGIDTMRYGPLKPVGIIDPRTGKMPYAVVQLRKDTQDGKLYNMVGFQTR
FT                   LKWGEQKRVFRLIPGLENAEFVRYGVMHKNSYINSPEVLTKYLFLKKYPNIFFAGQITG
FT                   VEGYLESASTGIIAGINAARQILGKEPISLPPNTCIGALIEYITTPKKDFQPMNANYGI
FT                   ISIDDEISKIKDKEKRKLLIAQKSLNICRELANKIFE"
FT   gene            580741..581271
FT                   /locus_tag="Calkro_0456"
FT   CDS_pept        580741..581271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0456"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   ate:Athe_2179 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45356"
FT                   /db_xref="GOA:E4SE69"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE69"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ADQ45356.1"
FT                   /translation="MFHATTIVAVKKGESVAIAGDGQVTFSQNMIMKSTAKKVRKLYNG
FT                   KVLVGFAGSVADAITLCEKFEEKLEQNSGNLQKSVVELAKEWRQDKILRRLEALMVVAD
FT                   KDHLFVVSGSGEVVEPDDNIAAIGSGGPYALAAARALLQSTDLSAAEIARKALEIAASI
FT                   CVYTNNNITVLEL"
FT   gene            581285..582679
FT                   /locus_tag="Calkro_0457"
FT   CDS_pept        581285..582679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0457"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; Clp ATPase-like;
FT                   KEGG: ate:Athe_2178 ATP-dependent protease ATP-binding
FT                   subunit HslU; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45357"
FT                   /db_xref="GOA:E4SE70"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE70"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ADQ45357.1"
FT                   /translation="MELTPQEIVRELDKYIVGQDRAKKCVAIALRNRYRRAKLPKELQD
FT                   EITPKNILMVGPTGVGKTEIARRLAKLVNAPFVKVEATKFTEVGYVGRDVDSMVRDLVE
FT                   NAISLVKSEYMERMKERAKALVEDRILEILIPEPQARKAGFKNPFEALFGATSQEMEQS
FT                   YQTTDDYIRTQREILREKLRSGELEDKVIEVEVEDTVKPPFEMIMGTISDEMGISFQDV
FT                   FGSLFPKKKKKKKMTIREAREVLEQEEYNKLIDMDEVIKEAIQRAEQHGIIFIDEIDKI
FT                   AGKGSSVGPDVSREGVQRDILPIVEGSTVMTKYGPVKTDHILFIAAGAFHVAKVSDLIP
FT                   ELQGRFPVVVELSPLTEEDFKKILTQPKNAIIKQYIELMKTEGVNITFTDDAIEAIAKV
FT                   AVKINEQSENIGARRLHTVVEKIMEDISFEYANVEKPVDLVIDKDYVYSKVSDIIKDKD
FT                   LSRFII"
FT   gene            582726..583520
FT                   /locus_tag="Calkro_0458"
FT   CDS_pept        582726..583520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0458"
FT                   /product="GTP-sensing pleiotropic transcriptional repressor
FT                   CodY"
FT                   /note="PFAM: Helix-turn-helix CodY domain protein;
FT                   GTP-sensing transcriptional pleiotropic repressor CodY;
FT                   KEGG: ate:Athe_2177 transcriptional repressor CodY"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45358"
FT                   /db_xref="GOA:E4SE71"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE71"
FT                   /inference="protein motif:PFAM:PF08222"
FT                   /protein_id="ADQ45358.1"
FT                   /translation="MQQSLLEKVRKLNRVIQSKDKEVLDFEKLCSVVGDVTDSSVFFID
FT                   KDGKVICKYIMPFVNVDIKLSEEKKIGDNLQKFFWWFVDTRANMKFSDITRIAEIESKV
FT                   GSENELLCTSVPVIGGGRRFGTVLAFKSFSSFTEEDIIVLEYASTVLGLELLNLSKEED
FT                   EEEKKKREMIKSAIETLSMSELEALVHIFDELKGNEGLLVASRIADKVGITRSVIVNAL
FT                   RKFESAGLIETRSLGLKGTYIKVLNEMVRDEIEKQKENLKLK"
FT   gene            583678..584079
FT                   /locus_tag="Calkro_0459"
FT   CDS_pept        583678..584079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0459"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="KEGG: ate:Athe_2176 flagellar basal-body rod protein
FT                   FlgB; TIGRFAM: flagellar basal-body rod protein FlgB; PFAM:
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45359"
FT                   /db_xref="GOA:E4SE72"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE72"
FT                   /inference="protein motif:TFAM:TIGR01396"
FT                   /protein_id="ADQ45359.1"
FT                   /translation="MINMFDKIDLYKKALDWAWERNKIISNNIANADTPGYKAKDLNFE
FT                   AFLQRSLDQEESLELVTTNERHIKESSSNPDNSIEVLDSSLQMRLDQNTVDIEQEMGKL
FT                   LQNSLYFDGVSLQLSREINKWKTVIKEGR"
FT   gene            584092..584529
FT                   /locus_tag="Calkro_0460"
FT   CDS_pept        584092..584529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0460"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="KEGG: ate:Athe_2175 flagellar basal-body rod protein
FT                   FlgC; TIGRFAM: flagellar basal-body rod protein FlgC; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45360"
FT                   /db_xref="GOA:E4SE73"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE73"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ADQ45360.1"
FT                   /translation="MFDAINISSSALSAQRVRMDVIAQNIANANTTRTENGQPYRRKVV
FT                   VFEESKQSFADILSQKIGKDQTSSYGGVRVKAILEDPSPFKKVYDPTHPDADQNGYVNY
FT                   PNVDIVTEMVNMIEASRSYEANVTALNITKSMITRTFEIGK"
FT   gene            584550..584864
FT                   /locus_tag="Calkro_0461"
FT   CDS_pept        584550..584864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0461"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="KEGG: ate:Athe_2174 flagellar hook-basal body
FT                   complex subunit FliE; TIGRFAM: flagellar hook-basal body
FT                   complex subunit FliE; PFAM: flagellar hook-basal body
FT                   complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45361"
FT                   /db_xref="GOA:E4SE74"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE74"
FT                   /inference="protein motif:TFAM:TIGR00205"
FT                   /protein_id="ADQ45361.1"
FT                   /translation="MVGNINFDSITKAFEKQFSSINTNSASTQNSQVSFVDFLYKALEG
FT                   VDGLQKEADYQNRLFLLGLSTNPQDAIVASEKASIALQLTLQIRNKILDAYNEIMRMQV
FT                   "
FT   gene            584897..586579
FT                   /locus_tag="Calkro_0462"
FT   CDS_pept        584897..586579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0462"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="KEGG: ate:Athe_2173 flagellar M-ring protein FliF;
FT                   TIGRFAM: flagellar M-ring protein FliF; PFAM: Flagellar
FT                   M-ring domain protein; secretory protein YscJ/FliF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45362"
FT                   /db_xref="GOA:E4SE75"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE75"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ADQ45362.1"
FT                   /translation="MPQFLNDYLKNIKEKWSSLSKSQKIMFVVSSSIILLSVIVAIYIT
FT                   TRPHYVTIFSGLDPKEAAEIQNILSDQKIDSKAANGGTTILVRDKDVDRAKMAAAQAGY
FT                   PKNSSITFEDALKLSSSMTATETDKRRTFIKLKESEIQQALKQMSDYIEDAVVNLSIPE
FT                   DYTFALKSEAEKPTASVKLTLKKSLSSDQIEGIQRFVAASVEGLLPENVVIIDNKGNYL
FT                   SDNSSDTTEGLSSKQLQLKIATKNEIEKKIKELLGSYVSSPEDVKVSVNLDMNFDMQKI
FT                   SETKYSPVLEDSGIVVSKKTTKEEAQSTNSSSSGVPGTDTNPTQNAPQYPITSQGGQST
FT                   YTKTDETVNYQNNEKKIETIKAPGTINYDKSSIAVVLYRYVTYTQEDFEKSEQAKNMSW
FT                   AQFKLQNQNNKRSFLTDQKEVETIINLIKSATGIQNVTVEGYEIPTFVDKPQRQIPVDY
FT                   IYVALAFLLLMVFAASVLIKASRSKSKTVELAGVGPLEISEGKPTAEEILHEAEKRKEP
FT                   EVEEINVEEFGVSQYEKQIDKLLKEKPEIVAQLLRNWLNEDWE"
FT   gene            586589..587596
FT                   /locus_tag="Calkro_0463"
FT   CDS_pept        586589..587596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0463"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="KEGG: ate:Athe_2172 flagellar motor switch protein
FT                   G; TIGRFAM: flagellar motor switch protein FliG; PFAM:
FT                   flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45363"
FT                   /db_xref="GOA:E4SE76"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE76"
FT                   /inference="protein motif:TFAM:TIGR00207"
FT                   /protein_id="ADQ45363.1"
FT                   /translation="MAKSNISGKQKAAMLLIALGPERSAKIFKHLKEEEIEELTLEIAN
FT                   IRTVSPEQKQAILEEFYNLCLAQEYIAEGGIDYAKEVLEKALGPEKAREVIEKLTVSLQ
FT                   VRPFDFIRKADASQILNFIQNEHPQTIALVISYLKPQQAAQVLASLPQEKQADVARRIA
FT                   LMDRTSPDVIREVEKVLEKKLSSVVMQDYTVVGGIQAIVDILNAVDRGTEKRILEALEL
FT                   EDVELVEEIRKRMFVFEDIVKLDNRSIQRILREVENNTLAIALKGTTEEVRKVIFSNMS
FT                   KRMAEMIQEDMEYMGPVRIRDVEEAQQKIVNIIRKLEDAGEIVISRGGGDEIIV"
FT   gene            587589..588344
FT                   /locus_tag="Calkro_0464"
FT   CDS_pept        587589..588344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0464"
FT                   /product="H+-transporting two-sector ATPase, E subunit"
FT                   /note="KEGG: ate:Athe_2171 H+-transporting two-sector
FT                   ATPase, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45364"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE77"
FT                   /inference="similar to AA sequence:KEGG:Athe_2171"
FT                   /protein_id="ADQ45364.1"
FT                   /translation="MSNVIRNNQVLIQNPVETNYKVLLEKLIKAKAEIEHYERRLKEQE
FT                   EEFEKQKNRAEVLQKEAEEVLQKAKEEAQRIVDEANVRAQLILQQAQEDGYREGLEKGL
FT                   LDAQKEYEKMLEDIEIQKAMILKERENILKDLETKVLFLVPQILEKVLEREIKDKSFLQ
FT                   QYIKNAILQLSIRNNLTLRVSEEDFEYVNSKLDEILRGIDGIDKVDVKVDKALRSGDVV
FT                   VETPYGFVETGVKMRLEKIQEIVLSLIGD"
FT   gene            588346..589641
FT                   /locus_tag="Calkro_0465"
FT   CDS_pept        588346..589641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0465"
FT                   /product="ATPase, FliI/YscN family"
FT                   /note="TIGRFAM: ATPase, FliI/YscN family; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: ate:Athe_2170 ATPase, FliI/YscN
FT                   family; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45365"
FT                   /db_xref="GOA:E4SE78"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022425"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE78"
FT                   /inference="protein motif:TFAM:TIGR01026"
FT                   /protein_id="ADQ45365.1"
FT                   /translation="MIEKLKSKIENANFYQFTGFVNQVIGLTIESQGPAVSIGTLCRIK
FT                   AAKTETLAEVVGFKENKVLLMPYSDLVGVFPGCKVIAQDSMFEVKVGKELLGRILDGLG
FT                   QPIDGKGEIKSKIKYPVENRAPNPLERPRIDTIMPLGIKAIDTLLTIGKGQRVGIFAGS
FT                   GVGKSTLLGMIARNAKADVNVLALIGERGRELKEFLEKDLKEEGLKRSVVVVATSDESA
FT                   LKRVKAAYVAMAIAEYFRDQGLDVLFLMDSLTRFAMAQREIGLAIGEPPVSRGYTPSVF
FT                   SIMPKLLERAGKNQKGSITALFTVLVDGDDFNEPITDTARGILDGHIVLSRAIANKNHY
FT                   PAIDVLASISRVMNDIVEPFHRDLANETKRVLAVYREAEDLINIGAYTKGSNPEIDRAI
FT                   ELVPRINQFLRQDVDERFEFEEEIDMLKAIIS"
FT   gene            589669..590127
FT                   /locus_tag="Calkro_0466"
FT   CDS_pept        589669..590127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0466"
FT                   /product="flagellar export protein FliJ"
FT                   /note="TIGRFAM: flagellar export protein FliJ; KEGG:
FT                   ate:Athe_2169 flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45366"
FT                   /db_xref="GOA:E4SE79"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE79"
FT                   /inference="protein motif:TFAM:TIGR02473"
FT                   /protein_id="ADQ45366.1"
FT                   /translation="MEKFRFDQLLSIKTQFEEIKKSELAKQNQILNEYIEKKLELEENI
FT                   KKAREDLKSLCLNGFSPQQMKVYSQFLSMLKKRVDVQNQLIYYQQIRVEEKKKEVIESM
FT                   IEKKKFEKLKERYLINLMNKIKQLENKELDRVVSYKIYKGIGDRSGRN"
FT   gene            590114..590935
FT                   /locus_tag="Calkro_0467"
FT   CDS_pept        590114..590935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45367"
FT                   /db_xref="GOA:E4SE80"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE80"
FT                   /inference="similar to AA sequence:KEGG:Athe_2168"
FT                   /protein_id="ADQ45367.1"
FT                   /translation="MAETKLVEDLTVENMPKKKEKKKRKGLLVFLVIFLILAGASFATV
FT                   HFNLFGAKTALDGILKKTPFAKSANKTQTVDMQKVYEKQIADLQKQKEALQSKLSLLEK
FT                   QNADLQKRIEDLTMKITDLTSKQQDIQNRTKYFASLLQNMDSKKAAKIVENLLDTNSQM
FT                   ANDVLSAIPSETASEILSNIAPEKTIKLLGISNSNQKTNSEDISILTNIYKNIDPKVAA
FT                   SIFENMMSDNTKYTLVVRILKSLDTKTSSQIISNMSAENAAKVTSSLSAFR"
FT   sig_peptide     590114..590245
FT                   /locus_tag="Calkro_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.584 at
FT                   residue 44"
FT   gene            590980..592518
FT                   /locus_tag="Calkro_0468"
FT   CDS_pept        590980..592518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0468"
FT                   /product="Flagellar hook-length control protein-like,
FT                   C-terminal domain"
FT                   /note="PFAM: Flagellar hook-length control protein-like,
FT                   C-terminal domain; KEGG: ate:Athe_2167 flagellar
FT                   hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45368"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE81"
FT                   /inference="protein motif:PFAM:PF02120"
FT                   /protein_id="ADQ45368.1"
FT                   /translation="MGTQNIVNTNMLFLKTFSATSKTKDRQENSISFKDVFKKASDIAK
FT                   NTDKKSNGLQKNVEESYRAAIVTSKRQVQNENQNLHVDTPFSKELPDGTNSDLENRAEI
FT                   QSLQAQMMEFLQLIFNLLQSGESLDKFNLDKLFQNSSIQGTDFLNLQLQSLKMEGDLDQ
FT                   YLNLNINQSNKTTITKILHNILQKMVKDTQNQQVQNFIYVQGSEVNQENIFELLKKVLL
FT                   EKEGEKQIFDVKSDDNSWVKSFINFFAQEDQSFKVLSEASGGKEILNNVLNELENIAKR
FT                   LNGQKIVDSFNMESPERVQIAEKENSNFNGIGSNDGDFNKVFSTLLKKDEGSSINDQKG
FT                   EVKTLDLRQHAFAFQNKVENIENTTPSQNDRIMKDLRMSIINQLAEKISVVSRQNLTTL
FT                   QVSIKPEWLGSVVIELSKDSSGKIFGNFIVTTPHVKEIIEGSLNSLLTILKDQGINISQ
FT                   LNVSLGGNFTGQQNQEQQRFSQRRNLIVQGNEESIRSIESLIYEINESILNLKA"
FT   gene            592531..593025
FT                   /locus_tag="Calkro_0469"
FT   CDS_pept        592531..593025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0469"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   ate:Athe_2166 flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45369"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE82"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ADQ45369.1"
FT                   /translation="MPDLIVSNNTNISNSTQGSATSLGKNVLGKQEFLNLLVTQLRYQD
FT                   PLKPMEDKEFVAQLAQFSALEQMQNLNESFEFLKAQSMIGRYVVATNPADTSKTIEGRI
FT                   DSIRVDGSKVYLKVNGTEVLSDNVKEVYHSYSEEVISSLLSKVPSKEDLLEILSSLQKG
FT                   E"
FT   gene            593031..593393
FT                   /locus_tag="Calkro_0470"
FT   CDS_pept        593031..593393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0470"
FT                   /product="flagellar operon protein"
FT                   /note="TIGRFAM: flagellar operon protein; KEGG:
FT                   ate:Athe_2165 flagellar operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45370"
FT                   /db_xref="InterPro:IPR013367"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE83"
FT                   /inference="protein motif:TFAM:TIGR02530"
FT                   /protein_id="ADQ45370.1"
FT                   /translation="MTVNNNIKGITGGKLEGFVSTNPKKATESFASIFSQTLKISKHAS
FT                   ERLKFQNINLDEVTLSKLEEAVKKAEQKGLKNDVLVLDGNKAYIVNIKNKVVVTVKDVS
FT                   GLKDNIFTNIDGVLMI"
FT   gene            593520..594986
FT                   /locus_tag="Calkro_0471"
FT   CDS_pept        593520..594986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0471"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="KEGG: ate:Athe_2164 protein of unknown function
FT                   DUF1078 domain protein; TIGRFAM: fagellar hook-basal body
FT                   protein; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body FlaE domain protein;
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45371"
FT                   /db_xref="GOA:E4SE84"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE84"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADQ45371.1"
FT                   /translation="MMRSMFSSISALRAHQTRMDVIGDNIANVNTVGFKSSRVTFASVF
FT                   ASVLKSASAPDTASGRGGSNPMQIGLGVSVASVDMNMTRGSLQRTDNPTDLAIEGDGFF
FT                   VVGGDGKAPRFTRAGNFSLDKMGNLVTATGLNVLGWMYDPVNNQIDTTKSPSKINILAF
FT                   PTLPPKATDKISFDGNLSADTKIYSGQITKFEDLLNVPADSKYSTSFKIFDSQGKEHTL
FT                   QLTFIKTGDNTWEWFVDAPRVKKNIGTAQNPQEAYVYVDDMIEANNDYDNFIARGTITF
FT                   GQAGKVLDDENTPDVEGIAITGGRFINTQDGTFTINFKNSVVNPVTLKVNSSQFDVNDA
FT                   TNIAFFLKNITQFGNMESSIRVAQMTGYSAGSLQGFNVDASGKITGVYSNGLNQLIGQI
FT                   AIATFANPAGLQRIGDNLYINTVNSGDPEIGTPGSGSRGTISQGTLEMSNVDLAKEFTD
FT                   MIVTQRGYQANARVITASDELLQDLVNIKR"
FT   gene            595101..595328
FT                   /locus_tag="Calkro_0472"
FT   CDS_pept        595101..595328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0472"
FT                   /product="flagellar FlbD family protein"
FT                   /note="PFAM: flagellar FlbD family protein; KEGG:
FT                   ate:Athe_2163 flagellar FlbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45372"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE85"
FT                   /inference="protein motif:PFAM:PF06289"
FT                   /protein_id="ADQ45372.1"
FT                   /translation="MIKLRRINNKEFVVNADFIEFVESTPDTVITLTNGVKLVVKESVD
FT                   EVIEKVIEYKKRIFEGIIFNIQPMQKEHEG"
FT   gene            595325..595795
FT                   /locus_tag="Calkro_0473"
FT   CDS_pept        595325..595795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0473"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: ate:Athe_2162 flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45373"
FT                   /db_xref="GOA:E4SE86"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE86"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADQ45373.1"
FT                   /translation="MKGEKMNSIILILLVLLLLMMVGMGIGFLTVVKNLSPTSSAAKTT
FT                   TVEKKPEKLYTYDVNDGKALMSNLQDTQTNAGRIIRVTVQLEVTDKKLPETMKEKNIVI
FT                   ADIIDSVLRSKTADELLKPEGKEKVRKEIKDRLNEIFGNKVYNVNFGEFIIQ"
FT   sig_peptide     595325..595402
FT                   /locus_tag="Calkro_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.225 at
FT                   residue 26"
FT   gene            595818..596807
FT                   /locus_tag="Calkro_0474"
FT   CDS_pept        595818..596807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0474"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="KEGG: ate:Athe_2161 flagellar motor switch protein
FT                   FliM; TIGRFAM: flagellar motor switch protein FliM; PFAM:
FT                   flagellar motor switch protein FliM; surface presentation
FT                   of antigens (SPOA) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45374"
FT                   /db_xref="GOA:E4SE87"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE87"
FT                   /inference="protein motif:TFAM:TIGR01397"
FT                   /protein_id="ADQ45374.1"
FT                   /translation="MGDILSQSEIDELLRSLTSGELSIEEIQKPKQEKNVRVYDFKRPS
FT                   KFAKDHLRTLQMIFENYARIVTTFLSGYLRTVVQMDVLSVEQLTYYEFSNSLSNPVVMG
FT                   IVNFSPLKGSIVFEMAPEIAFAMIDRVLGGFGKGIDKVRTFTEIELALIERLLQQLINY
FT                   FQEAWENIVDLRPRLEKIETNPQFTQIVSPNETVALVTIAMKVGEAEGMANICIPHMVI
FT                   EPIMPRLSTKFWFSTSAKESSEETKEYLQKKIERTRVTVKAVLGRTQITVREFLELQVG
FT                   DVLRLDRRKNQEIEVFVGNKLKFYGVPGRKEGRIAVKITRVEEGEDFR"
FT   gene            596804..597940
FT                   /locus_tag="Calkro_0475"
FT   CDS_pept        596804..597940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0475"
FT                   /product="CheC, inhibitor of MCP methylation / FliN fusion
FT                   protein"
FT                   /note="KEGG: ate:Athe_2160 flagellar motor switch protein;
FT                   TIGRFAM: flagellar motor switch protein FliN; PFAM: surface
FT                   presentation of antigens (SPOA) protein; CheC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45375"
FT                   /db_xref="GOA:E4SE88"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE88"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ADQ45375.1"
FT                   /translation="MSDLLSQDEIDALLRGMSETSPSSPTISDQDKDVLGEIGNISMGT
FT                   AATTLSILLNQKVNITTPVVSILKWDELPREFPVPYVAIKVVYKEGLDGVNLLILKKED
FT                   VEIIADLMMGGTGQIEFTDELTELQLSAIQEAMNQMVGSASTSLSSMLNLKIDINPPEA
FT                   FVIDFAQNAEEMIPELKRADEIVKVAFRMTIGDLIDSQIMQLIPVDFAKQLVDAMLKNT
FT                   LGTPAQSETSTQTQQETLKEEVLRQTFSQTTKSQKKASQPSYTPPPQRTEQPQQVYNVS
FT                   PVQFESFDEEEERRYPENIELILDVPLEITVELGRTQKLVREILEFSTGSIIELEKLAG
FT                   EPVDILVNGKVIAKGEVVVIDENFGVRITDIVNPSNRL"
FT   gene            598030..598392
FT                   /locus_tag="Calkro_0476"
FT   CDS_pept        598030..598392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0476"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ate:Athe_2159 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45376"
FT                   /db_xref="GOA:E4SE89"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE89"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADQ45376.1"
FT                   /translation="MAKRILIVDDAAFMRMMLKDIITKNGYEVAGEAENGAKAVEMYKE
FT                   LKPDLVMMDITMPEMDGIQAVREIKKIDPQAKIIMCSAMGQQAMVIESIQAGARDFIVK
FT                   PFQAERIVEAIKKVLG"
FT   gene            598425..598820
FT                   /locus_tag="Calkro_0477"
FT   CDS_pept        598425..598820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45377"
FT                   /db_xref="GOA:E4SE90"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE90"
FT                   /inference="similar to AA sequence:KEGG:Athe_2158"
FT                   /protein_id="ADQ45377.1"
FT                   /translation="MELGIRIVFALVVICVLIYITYYVLRIVNKKMLGRKGEYIKIVDL
FT                   LPLSQDSILVLVEIGDKVILLGKTQKSITFLKEFSKDQLFNLGEQHHSFKNIIDNQINS
FT                   SFEMKNKVLNLYNLIKDSEGKEDDEKK"
FT   gene            598807..599565
FT                   /locus_tag="Calkro_0478"
FT   CDS_pept        598807..599565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0478"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="KEGG: ate:Athe_2157 flagellar biosynthetic protein
FT                   FliP; TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45378"
FT                   /db_xref="GOA:E4SE91"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE91"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ADQ45378.1"
FT                   /translation="MKKNKSLYIISTLLLILITTCTKKEIAFATASLNINLGNPQNPND
FT                   VSSALQLIIFLTILTLAPSILIMMTSFTRILIVLGFIRNALGTQQMPPNQILIGLALFL
FT                   TFFVMAPVTDKIYTQAYQPYINGRITSQEALKRAEEPLKEFMLKNTRKKDLDLFVKLSN
FT                   VNPNTNVKDLPLRVVVPAFIISELKSAFEMGFLIYVPFLIIDMVVASILMSMGMLMIPP
FT                   VMISLPFKILLFILVDGWNLVVESLVRSFK"
FT   gene            599589..599858
FT                   /locus_tag="Calkro_0479"
FT   CDS_pept        599589..599858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0479"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="KEGG: ate:Athe_2156 flagellar biosynthetic protein
FT                   FliQ; TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45379"
FT                   /db_xref="GOA:E4SE92"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE92"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ADQ45379.1"
FT                   /translation="MDTTVVLEIARQAILTAFYVAGPILLISMVVGIVVSILQATTQIN
FT                   EQTLTFVPKLIAIALSLLIFGQWMLTKVIEFTRYLWTNINQFVK"
FT   gene            599881..600663
FT                   /locus_tag="Calkro_0480"
FT   CDS_pept        599881..600663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0480"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="KEGG: ate:Athe_2155 flagellar biosynthetic protein
FT                   FliR; TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45380"
FT                   /db_xref="GOA:E4SE93"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE93"
FT                   /inference="protein motif:TFAM:TIGR01400"
FT                   /protein_id="ADQ45380.1"
FT                   /translation="MTDIINAFLNSSYIFFLVLARMSGLFIVSPIFGRRNIPAYFKIGF
FT                   AFFLSLLVVSTYRFSYSAPSNLLEYIFVVIKEFIVGLLIGYISYMIFSAILLAGQIIDN
FT                   AIGFGMANVIDPMSEVQVPLLGNFLYLYMLVVFFGTDAHHLLIRAVIYSYKLVPIGYEG
FT                   FRREFTWNFFRFFSELFLIGVEISLPILMSMLIVDIILAVLSRAVPQMNVFMVGLPIKI
FT                   AIGFLVLVIIFPFMNKMIFVLIDKIAVYTFETLRGGIR"
FT   gene            600660..601760
FT                   /locus_tag="Calkro_0481"
FT   CDS_pept        600660..601760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0481"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="KEGG: ate:Athe_2154 flagellar biosynthetic protein
FT                   FlhB; TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45381"
FT                   /db_xref="GOA:E4SE94"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE94"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ADQ45381.1"
FT                   /translation="MKLKFDIQLFSEASAKTEKATPRKRQEARKRGMVAKSREVTSAFA
FT                   LLISVLFLKFGYSLIIVPLQQGSKYFFSNLNYSLEDISDASKLLSFIITTSLKIVLPFC
FT                   VTIMFVAAIVEWAQSSFLITGQSLKMSFQKINPIEGFKRIFSINSVVELIKSVLKVLII
FT                   GYTGYCYTQTFAKKLLEMYEMNVFTIVRFSFDSAINLILWMAVMFFGIAVIDFIFQRQQ
FT                   YEKKLMMTKEEVKEEFKQTEGNPQIKSKIRERQRRISLQRMFQQLPKADVVITNPTHYA
FT                   VALLYEPEKFDAPRVIAKGKDYIAQKIKQEAIKHRIEIVENRELARALYNMCEVGDFIP
FT                   PELYQAVAEVLAYVYSLKNYQKVNTR"
FT   gene            601757..603793
FT                   /locus_tag="Calkro_0482"
FT   CDS_pept        601757..603793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0482"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="KEGG: ate:Athe_2153 flagellar biosynthesis protein
FT                   FlhA; TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45382"
FT                   /db_xref="GOA:E4SE95"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE95"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ADQ45382.1"
FT                   /translation="MNFKGATFSVFAIVIVLSMILPIPPSLLDVLIAVNLSLALVIFLN
FT                   SINIKEALDFSVFPSLLLFTTLLRLALNISTTRQILTGQGENVRIVYTFGNFVIGSNIV
FT                   VGVIIFFIIIIIQFIVITRGAERVSEVAARFTLDAMPGKQMAVDADLNAGIITEDEARE
FT                   RRKKIQKEADFYGAMDGASKFVKGDAIAAILITFINALGGLIIGVAMRGEDVTEAIQKY
FT                   LLLSVGDGIAAQIPALLISTATGIVVTKAADESKLSESLIKQLFEFHPKVLYTVGGILA
FT                   VLALIPTMPKLSLFFLSGAMFAMGFRMNSSLKKIESIEEKQVEQKEVEELKKPENVVNL
FT                   LYVDPIEVEFGYGIIPLADKEQGGDLLERVVMIRRQLALELGIIVPTIRLRDNMALKPY
FT                   EYRINIKGVEVAKAELMSDSLLAINPGFVTEQIEGIPTKEPAFGLDALWIPSSMKERAE
FT                   MAGYTVVDLPSVIATHLTEIIRRHAHELLTRQDVQKLIDNVKEINPVVVDELIPKLMTV
FT                   GEVQKVLANLLKERISIRDMVTILETLADWAPTTKDTDILTEYVRQAMSRYITKKYVSG
FT                   NVLEAVTLSPEVEDMIMNSIQKTEQGSFLNLPPDYIQKLINNLSNILEKLVSASSQPIV
FT                   ICSPIVRIYFRRLIENIFPDVVVLSYNEILPSVQIKTVGMVEV"
FT   gene            603796..604914
FT                   /locus_tag="Calkro_0483"
FT   CDS_pept        603796..604914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0483"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhF; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   KEGG: ate:Athe_2152 GTP-binding signal recognition particle
FT                   SRP54 G-domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45383"
FT                   /db_xref="GOA:E4SE96"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE96"
FT                   /inference="protein motif:TFAM:TIGR03499"
FT                   /protein_id="ADQ45383.1"
FT                   /translation="MRIKRYLAHDMQEALIRIKADLGKDAVILSTKKVRQKGLFGFFKR
FT                   PLIEVTAACEDEKIVKKEEESIKQESLALSLQLTQIKELERKIDSLEKILKEVIKKEQE
FT                   EDISQTKELSKKNFIDVMRENLIKNGVESEIIDMLFSNLSGEASINNVVNNIYKEIKNM
FT                   LGVAAPLSFNSKIPKIVFFVGPTGVGKTTTIAKIAAKLMFEDGKKVGFITADTYRIAAV
FT                   EQLKTYAEIMNIKTKVWYEVDEYDRIIENFSDSDVVLVDTAGRSHKNQEHMDELKAFVA
FT                   KANPDEVFLLLSATTQPSVFKEVVNTYSFLNDYKVIITKVDEVSTYGNILNIRYFTQKP
FT                   IAYITTGQNVPDDIEQFNPEQFAKLIIGSKVL"
FT   gene            604911..605807
FT                   /locus_tag="Calkro_0484"
FT   CDS_pept        604911..605807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0484"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: ate:Athe_2151 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45384"
FT                   /db_xref="GOA:E4SE97"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE97"
FT                   /inference="similar to AA sequence:KEGG:Athe_2151"
FT                   /protein_id="ADQ45384.1"
FT                   /translation="MRDQAQGLRNLVRKAEICTNIPAYQGTQSKVVTITSGKGGVGKTN
FT                   LTVNLAIALKKMGKRVLIIDADLGLSNVEVLLGTSPKYNVKDVLEGKKDIFSIVEEGPL
FT                   GINFISGGSGIVDLANLDEERLLRLIECAQLINKSFDVVLIDTGAGISRNVMEFVMMSD
FT                   EVIVITTPEPTSITDAYAIIKAIIARDFNHKINLLVNRVNGVKEAEEIFFRLNSVIKRF
FT                   LQREVEYIGYIEENSIVSKSVIKQVPFMISYEKSNISRQVENVALKLVKSSENVEEKNQ
FT                   GGFSRFIDSIIKRLREK"
FT   gene            605823..606524
FT                   /locus_tag="Calkro_0485"
FT   CDS_pept        605823..606524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0485"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ate:Athe_2150 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45385"
FT                   /db_xref="GOA:E4SE98"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE98"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADQ45385.1"
FT                   /translation="MQKIFKVGDKIEIVRIDRRTWEEKDVQYISKIADIKDEYFYIFTP
FT                   IKEGVYVTFYIDEILRVYKVSSDGVWMFDGVVEERFKEPEYIVKVKQISDVRKIQRRMF
FT                   FRLPINLDIFVKVLNSDKMSKENTHEDWAADDFSEGKIVKALTKDISGGGVCFIAQEEF
FT                   EIGDLILAKIPIEQEELILKAQILRKERVQHPTYRFMYGCKFVEARQNEIDKIVRFIFA
FT                   QQQKMRQKGLL"
FT   gene            606577..608577
FT                   /locus_tag="Calkro_0486"
FT   CDS_pept        606577..608577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0486"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: ate:Athe_2149 CheA signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; P2 response regulator binding domain protein; Hpt
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; CheW domain protein; SMART: CheW domain
FT                   protein; Hpt domain protein; ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45386"
FT                   /db_xref="GOA:E4SE99"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:E4SE99"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADQ45386.1"
FT                   /translation="MDMSQYLGMFIEEARDHIQSLNDNMLKLEENPEDLQIVNEIFRSA
FT                   HTLKGMAGTMGFVNMQKLTHAMENVLAAARDGKLKVNPNIMDILFKTVDALESYLDVII
FT                   ATGTEGQEANLHLVNALNAILGKPAEDVAVSSATKAGKKYEYDEFVVRAIERAWDQGFN
FT                   VYRFDVELDQNCLLKSARAYLVFRAVEELGEIIHSKPSVQDIEDEKFDFEFSITVISKQ
FT                   PIEKIRDRILSISEIREVKALEIKSGEVSMAEEKEEIEEVQQETQVQETVKVVRQQKQE
FT                   SLQKTSKTVRVDIERLDVLMNLVSELIIIKSRIEGLAKKYNDRQYEESIEYLERITTSL
FT                   HDAVMKVRMVPVERVFSRFPRMMRDLARELGKEFELVMSGEDTEVDRTIVDELGDPLIH
FT                   LLRNAADHGIEDPDERVKNGKPRSGLIKLSAYHDGNNVVIEVEDDGKGIDLEKVKQKAI
FT                   EKGLLKEDQIELTEQEIIDFLFMPSFSTKDKVTNLSGRGVGLDVVKTKIEQLGGMVEVK
FT                   TQKGKGTKFVIRLPLTLAIIQALLVTVHDEIYAIPVASIREIVDVAKEDIKVVQKGKEI
FT                   IMLRNQVIPIKHLHSIVGLEPVLDKKKFTVVIVRRGEKLTGIIVDKLLGQQDIVIKSLG
FT                   KYLEGIRLISGATILGDGSVAMILDPNMLTV"
FT   gene            608608..609030
FT                   /locus_tag="Calkro_0487"
FT   CDS_pept        608608..609030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0487"
FT                   /product="CheW protein"
FT                   /note="KEGG: ate:Athe_2148 CheW protein; PFAM: CheW domain
FT                   protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45387"
FT                   /db_xref="GOA:E4SEA0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA0"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADQ45387.1"
FT                   /translation="MEQYLVFRLADEHYGLNVNNIENIEKLMPITRVPHTKQYVKGVIN
FT                   LRGEIVPVIDLREKIGVEKEEFGEETRILVVNWKGEFKVGLIIDEVLDVVYLSKEDFDQ
FT                   ATRDRNEFKFSIAKYNGMLINIINLEDVLFEKAEEV"
FT   gene            609036..609653
FT                   /locus_tag="Calkro_0488"
FT   CDS_pept        609036..609653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0488"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: ate:Athe_2147 CheC,
FT                   inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45388"
FT                   /db_xref="GOA:E4SEA1"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA1"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADQ45388.1"
FT                   /translation="MNLSNNEMNEMYLDVLKELGNIGTGNAVSALAMMIGRKINMKVPV
FT                   VKMVKLQEVPEILGGAEIPVVGILLNVEGDIEGFIMFVMSQSSAHLLVNMLLGTTLNGY
FT                   SEFTDIEKSALMEIGNILAGAYLTALSTLTGFKMIQSVPQLAEDMAGAILSFPAIQFGE
FT                   TGDTALYIETEIFEESNRIVADFFLIPTIESYQKMLKALGVA"
FT   gene            609657..610139
FT                   /locus_tag="Calkro_0489"
FT   CDS_pept        609657..610139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0489"
FT                   /product="CheD"
FT                   /note="PFAM: CheD family protein; KEGG: ate:Athe_2146 CheD"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45389"
FT                   /db_xref="GOA:E4SEA2"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA2"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ADQ45389.1"
FT                   /translation="MMEIIKVGMADLNVTGYPNALTTLGLGSCVGVCIYDTKTKIIGMI
FT                   HIMLPYSWGVKNNTNPAKFADTGIPLLIEKMEELGAAKKNMLAKLAGGAQMFEVTRSEF
FT                   MNIGKRNVEAAKKVLQEQNIPIVAEDTGGNYGRTIIFYSEDGRLEIKTIGKGTKTI"
FT   gene            610157..610348
FT                   /locus_tag="Calkro_0490"
FT   CDS_pept        610157..610348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45390"
FT                   /db_xref="GOA:E4SEA3"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2145"
FT                   /protein_id="ADQ45390.1"
FT                   /translation="MKGEQLLPEILALVGGSIVLVTCLVTRKSGEYTFFATALVSIIGY
FT                   VFGSIVKDILNDNKDHNP"
FT   gene            610372..611112
FT                   /locus_tag="Calkro_0491"
FT   CDS_pept        610372..611112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0491"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /note="KEGG: ate:Athe_2144 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG; TIGRFAM: RNA polymerase sigma factor,
FT                   FliA/WhiG family; RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45391"
FT                   /db_xref="GOA:E4SEA4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA4"
FT                   /inference="protein motif:TFAM:TIGR02479"
FT                   /protein_id="ADQ45391.1"
FT                   /translation="MDDALLWEKFTKTKDPKIKEQLIIKYMPLVKLVAGRMAIYFGGNV
FT                   EYDDLVSYGSIGLLDAIEKFDSQKGVKFETYAYTRIKGAIIDCVRNQDFLPRSIRQKAK
FT                   EIERAYIEIEKEGKTPTNQEVAKRIGISVEELQKLQDRISSGMIISLESFLEQNYESKI
FT                   GGLEDFVSQPEHFIENEELRKVLRQQIDNLMENERMVIVLYYYEDLSIKEIAKVLGVSE
FT                   SRVSQLHTRALLKLRSALQKYLEK"
FT   gene            611149..612534
FT                   /locus_tag="Calkro_0492"
FT   CDS_pept        611149..612534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0492"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   ate:Athe_2143 protein of unknown function DUF342"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45392"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA5"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADQ45392.1"
FT                   /translation="MSSEQKVDIKVMVTSDRLKASVVLVQNQNGVDLTFENVMNKLREN
FT                   KITFGIDDEAIKKLVENPIFGTPIVVAQGKPPGKPVDGKLIYHFDIKREIRPKELPDGR
FT                   VDYKDLGIVQNVRKDDVLVTMIDPVDGENGMDVFGGVIRGQKGRKLNLPRGKNTYIDSD
FT                   GHTLKAACDGQVCIIEGKVTVLNTLEINSDIDNSTGNINFVGNVHIKGSVLSGFKVVAE
FT                   GNVEVDGIVEAAEIEAKGNVVLHKGITGMGKGRVVAGKSVFAKFIENATIVAGEDVQAE
FT                   AIVHSDVKCGNKLILVGRKASIVGGSCKVGKEVEAKVIGSYLSTATEIEVGVDPLMVER
FT                   YREIRREMSELRENIKKCDQGIEVLRKIEAAGLLTDEKREMLQKFTRSKITASEKLKEL
FT                   QSEFEEIEKRLEERNEGIVKVQDTIYPGVKITIGNVCKLIKEPVKYCKIYREDADIKIA
FT                   PYA"
FT   gene            612583..612846
FT                   /locus_tag="Calkro_0493"
FT   CDS_pept        612583..612846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45393"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA6"
FT                   /inference="similar to AA sequence:KEGG:Athe_2142"
FT                   /protein_id="ADQ45393.1"
FT                   /translation="MNIRPIDVKILYPKSTEVSQVVLGEQQKENMLRHINSQKNQAKVD
FT                   EDLRRVREKDNVSEIRLTQKQEREKQELKKSKKQQKGFDIRI"
FT   gene            612878..613408
FT                   /locus_tag="Calkro_0494"
FT   CDS_pept        612878..613408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45394"
FT                   /db_xref="GOA:E4SEA7"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA7"
FT                   /inference="similar to AA sequence:KEGG:Athe_2141"
FT                   /protein_id="ADQ45394.1"
FT                   /translation="MDAYVILFIFFGLIIVLWSLRSIKKDIERGEKILHESEKAQKTLS
FT                   QLLSEAIETVEELDSFGEYIIERIENKVRWAKGEILDIEKAPVKGDTEHLNTEEKVEKS
FT                   DQTKSYAGKEDFIEPGKDMQRDEGKKHSKEELYRKAVELYKQGYTVDEIASSLNIGKGE
FT                   AKLAIRIVGRERS"
FT   gene            613429..613725
FT                   /locus_tag="Calkro_0495"
FT   CDS_pept        613429..613725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45395"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2140"
FT                   /protein_id="ADQ45395.1"
FT                   /translation="MGIGVGWVLGVCAMYFVTISKAKEVLPNLNNTVDIYIDNIDNIAD
FT                   VLYQNGVVQDKESFERFIKSKNVNSNLLVGQRITFSKAMTYEEIFEAVYKSHK"
FT   gene            613744..614592
FT                   /locus_tag="Calkro_0496"
FT   CDS_pept        613744..614592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0496"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: ate:Athe_2139 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; Cupin 2 conserved barrel domain protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45396"
FT                   /db_xref="GOA:E4SEA9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEA9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADQ45396.1"
FT                   /translation="MIEAINKILPVIVKTLERVHDNSWKMDYNIHDSYELIFIKKGNID
FT                   FWVEEEKIDLKAGDLLIIKPFTKHKFEVIGSTKAEFVVIGFYLNPENKAKVNDLKEIYG
FT                   FLKVLENTTNKFYFFHVRKRSNIFFCLESILREAKESKNSILLYIKCLELFVYITREVD
FT                   SLEMIKNYDYSLIAKHIKEYIDNNYMEDIKMGDVAKRFFMSESSLSRIFKNHFGILPKE
FT                   YLLSKRIEKAKEYLTISNLKISNIAMMCGFSSLQRFNDIFKKYTGLSPTQYRKQILQDF
FT                   K"
FT   gene            614812..615099
FT                   /locus_tag="Calkro_0497"
FT   CDS_pept        614812..615099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0497"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: csc:Csac_1291
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45397"
FT                   /db_xref="GOA:E4SEB0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB0"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADQ45397.1"
FT                   /translation="MKIRPIGDRILIKFKEREEVTKSGIVLPDTVKEKPQIAEVIEVGP
FT                   GGIVDGEKVEMVVKKGDKVIVSKYAGTEIKIDGEEYTIIRQDDVLAIIED"
FT   gene            615132..616751
FT                   /locus_tag="Calkro_0498"
FT   CDS_pept        615132..616751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0498"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: ate:Athe_2137 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45398"
FT                   /db_xref="GOA:E4SEB1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB1"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADQ45398.1"
FT                   /translation="MAAKMILFDEEARRALERGVNKLADTVKVTLGPKGRNVVLEKKFG
FT                   SPQIVNDGVTIAKEIELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGL
FT                   KNIAAGANPMILRKGIQKAVDVVVEEIRKMSKKVRGKEDITYVASISAGDEEIGKLVAD
FT                   AMEKVTNDGVITVEESKTTETTLEIVEGMQFDRGYISAYMVTDTERMEAVLDDPYILIT
FT                   DKKISTIQDILPLLEQIVQQGRKLLIIAEDVEGEALATLVVNKLRGTLQCVAVKAPGFG
FT                   DRRKAMLQDIAILTGGQVISEELGLDLREVKLSQLGRARQVKVQKENTIIVDGAGDPSE
FT                   IKARIQSIKKQIEETTSDFDREKLQERLAKLAGGVAVIHVGAATETELKEKKLRIEDAL
FT                   AATKAAVEEGIVPGGGTALINAIPALDKLIESLTGDEKTGAMIVRKALEEPLRQIAENA
FT                   GLDGSVIVNKVKESPAGVGFDALNERFVDMFEAGIVDPTKVTRTAIQNAASAAAMLLTT
FT                   EAVVAEKPEKEKNPPAPAPDMY"
FT   gene            616857..617696
FT                   /locus_tag="Calkro_0499"
FT   CDS_pept        616857..617696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0499"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: ate:Athe_2136 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45399"
FT                   /db_xref="GOA:E4SEB2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB2"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADQ45399.1"
FT                   /translation="MYKLIAIDLDMTLLDKNKNISSRNKRAIELVKQKGVQIVLCSGRI
FT                   LKGVMYFAKVLGLYDQVIVACNGAIVRDLKKNKDIYYIGLENSKSLEIARICKENDIYY
FT                   HYYFQDTMIARRLDYSSKFYYEKNKELPEEERINIIIDDSENTIKACGDLITKFVIIDK
FT                   DLEKVNYVRKIIESKIPGIETTKSDINILEVMKEGVNKKRALEFVISYLGIAPEEVMAI
FT                   GDNENDLEMVEFAGLGVAMGNAIEELKKIADYVTSSYENDGVARAIEKFVLGETINV"
FT   gene            617689..618816
FT                   /locus_tag="Calkro_0500"
FT   CDS_pept        617689..618816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0500"
FT                   /product="protein of unknown function DUF362"
FT                   /note="KEGG: ate:Athe_2135 protein of unknown function
FT                   DUF362"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45400"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2135"
FT                   /protein_id="ADQ45400.1"
FT                   /translation="MCKVAIVKCDTYNLQDVKEAILKGINLIGYEIPKKDCVLVKPNLL
FT                   MKKNPEDAVTTHPSIAQATVEIIKEKASKIIIADSPGGPYTKKRLESIYQAAGIKVLEK
FT                   LENVYLNYDTSYKDLSIETTTFKKLSLISPYFESQGIINLPKLKTHQMAVYTGAVKNLF
FT                   GLVPGGQKAEMHFRFQDVRRFMEMLLEILTVAKPMLNIMDGIVAMEGEGPSAGKPKELG
FT                   ILLISEDAIALDYVACKIIGLDIKDVPLLEVANEKGLLNPDKVEIVGERIEDVAPSSFE
FT                   LVLRPEISFVKGRLPQFLARFLDNFLSPRPIFDINICIGCAECFNACPAQAIEMRSRKA
FT                   YVDLKKCIRCYCCHELCPAKAIKIKRSFLFEKILK"
FT   gene            618877..619353
FT                   /locus_tag="Calkro_0501"
FT   CDS_pept        618877..619353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0501"
FT                   /product="CheC domain protein"
FT                   /note="PFAM: CheC domain protein; KEGG: ate:Athe_2134 CheC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45401"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB4"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADQ45401.1"
FT                   /translation="MASVNVEYINPFIQASQQVLKQVANIDFKLGKVYIKEPTYKVDQV
FT                   VVIIGMTGNIKGQVNFCMSIETAKKIASMMMGGFPVSDFDELAKSAIGEMANMIMGNTS
FT                   TLFSQKGLKVEITPPSILIGENMTLSTSKMINICVPLLLDNGDKIDMDVAFMEN"
FT   gene            619383..619847
FT                   /locus_tag="Calkro_0502"
FT   CDS_pept        619383..619847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0502"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="KEGG: ate:Athe_2133 RNA methyltransferase, TrmH
FT                   family, group 2; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 2; PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45402"
FT                   /db_xref="GOA:E4SEB5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB5"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ADQ45402.1"
FT                   /translation="MPINIVLHEPEIPYNTGNIARTCACTGSKLHLIEPLGFSLEDKYL
FT                   KRAGLDYWQYLDVKIYKDLNDFFEKNRGANIFYFSTKGKQYYTQAPYEDNCYLMFGKET
FT                   AGLPQWLIEQNIHRTYRIPMISDVRSLNLSNSVAIVLYEALRQLGFPNLV"
FT   gene            619875..620717
FT                   /locus_tag="Calkro_0503"
FT   CDS_pept        619875..620717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0503"
FT                   /product="degV family protein"
FT                   /note="KEGG: ate:Athe_2132 DegV family protein; TIGRFAM:
FT                   degV family protein; PFAM: DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45403"
FT                   /db_xref="GOA:E4SEB6"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB6"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ADQ45403.1"
FT                   /translation="MGVTIVTDSTCDLSPQMLNEFGIKMVPLKVFFEDEVYKDWVEITP
FT                   EMFYEKLASSTVLPRTSQPSPEEFLDVFKQEIENGNEVVSIHLSSKLSGTYNSACLAKD
FT                   MLDPQKIFVIDGKSASIGTGVLAILAKRLAEKGMPAKDIASLIIQKTNTIRHIFAVETL
FT                   EYLKKGGRISPAKATIGNILNIKPILHIVDGVVEPLDKVRGMKRALPRIIEEVNKKGLD
FT                   LKNQVCGFCYAGDLSEAEELINAIKQELSPGELIVTQIGSVIGTYVGPGTFAFIFFEE"
FT   gene            620804..622645
FT                   /locus_tag="Calkro_0504"
FT   CDS_pept        620804..622645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0504"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ate:Athe_2131 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45404"
FT                   /db_xref="GOA:E4SEB7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADQ45404.1"
FT                   /translation="MIVKDKVFKLLYDVEKPGRYIGNEINMVKKDPEKVDIRFAFCFPD
FT                   VYEIGMSNLGLKILYHLLNEREDVYCERAFMPWVDMQKKMKKEGIKLFSLETFTELDRF
FT                   DIIGFSLSYEMSYTNVLKMLELGGLPLESQKREKGMPIVIAGGPCTYNPEPLWEFIDVF
FT                   VIGEGEEVILEIIDLYKRYKFSNMTKEEFLHECAAIEGCYVPSLYNVEYNPDGTIKSIV
FT                   PVSENVPARVKKRIVKDLDTSYFPTKMITPLIEVVHDRITLEIFRGCARGCRFCQAGII
FT                   YRPVRFRKAEKVLQYAKELVENCGCNEISLVSLSTSDYPNIDELAREILKFAEDKKVNI
FT                   SLPSLRLDTTSLDLLKEVEKVRKPTLTFAPEAGTQRLRDVINKNIKEEDIYSTVRLAFE
FT                   RGFQNIKLYFMLGLPLEKDEDVMGIYTIAKNIREIYKELGFKKRIRITVSTSFFVPKPH
FT                   TPFQWEAQDSIENMQRKMKLLKENLKKVKDVEYSWHDFYLSKLEAVLSRGDRRLSKVIK
FT                   RAVDLGCQFDDWGEFFDFSKWEKTFQQENIDWRFYSDRKRSFDEVLPWDIIDTGVTKEF
FT                   LKRECLLAYEGKTTSSCFDRCTGCGVASFRGGICVDK"
FT   gene            622632..623267
FT                   /locus_tag="Calkro_0505"
FT   CDS_pept        622632..623267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0505"
FT                   /product="Protein of unknown function DUF2344"
FT                   /note="PFAM: Protein of unknown function DUF2344; KEGG:
FT                   ate:Athe_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45405"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB8"
FT                   /inference="protein motif:PFAM:PF10105"
FT                   /protein_id="ADQ45405.1"
FT                   /translation="MLTNKYRFYFSRDLPAAFISHLDMTRLFERLFRRLNIKLKFTQGF
FT                   NPHPKIVFILPMPVGLCSKEEIFEVECEQELDISIIENFNKILPEGLKILKVELATDKI
FT                   QVSDMYYQCFVEAEEEFCKYFDEFMKKNPAIKKEKEGKVTVKKIFDFILSYECEKEEKA
FT                   IKISFHINVLNGSYIKPEDILREFSQEYNIECKIVRVERVKVNYKRVI"
FT   gene            623267..624982
FT                   /locus_tag="Calkro_0506"
FT   CDS_pept        623267..624982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0506"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: ate:Athe_2129 ribonuclease, Rne/Rng family;
FT                   TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA-binding
FT                   protein AU-1/Ribonuclease E/G; RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45406"
FT                   /db_xref="GOA:E4SEB9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEB9"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ADQ45406.1"
FT                   /translation="MQSEIIVDVSFNQTRVAVLEDKELVEIYIEREDSQSIVGNIYKGV
FT                   VENILPGMDAAFVNIGQEKNAFLYLGDVNRLEFGDTDEYYEIKTNPLALRCGQEIVVQV
FT                   IKEGYDQKGPRVTTNITLPGRYLVLLPCTEYVGVSKRIESEEERQRLKEIACRIRPEGM
FT                   GLIVRTAAESKSEEILKSELEFLKNMWKKIRQKSCQSAPVLLYKDYDLVFKAVRDMFTN
FT                   QVDRFVINDRKKYNKIIEFLSSYAPSLKSKVEYFNLATNIFEYFQIEQKLSKALSKRVW
FT                   LKSGGYIVIDETEALTVIDVNTGKYVGKTDVAETILKTNLEAAQEIARQLRLRDIGGII
FT                   IIDFIDMKNPDHQKIVLDALKEALKRDKTKTVVVDITPLGLVEMTRKKVRQRLSCVMQS
FT                   NCPYCEGTGKILSPESVAFKVLKEIEWYCKNKVEDKFFVEINTKVCEILRKGEIDRIKD
FT                   LEQKYKKKIYIKASSNIHINKFTICPVKDEDHYMALCGWLCEGDEVLAFVEEEDRFNPK
FT                   NAIGYVNQNRIELDDAADLVGKYIYAKIEKVYGTLSKGKILDVYEVDKEDVKEF"
FT   gene            625051..625608
FT                   /locus_tag="Calkro_0507"
FT   CDS_pept        625051..625608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0507"
FT                   /product="translation elongation factor P"
FT                   /note="KEGG: ate:Athe_2128 elongation factor P; TIGRFAM:
FT                   translation elongation factor P; PFAM: Elongation factor P
FT                   ; Elongation factor KOW-like domain-containing protein;
FT                   Elongation factor P/YeiP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45407"
FT                   /db_xref="GOA:E4SEC0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC0"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADQ45407.1"
FT                   /translation="MVEAGDFRRGLTIEYEGQIFQVIEFLHVKPGKGAAFVRTKLKNIK
FT                   TGAVIEKTFRPDERMPLAHIERREMQYLYNDGELYYFMDTQTYEQIALNQEMVGDALKF
FT                   VKENMTVTVLSHNGVVFGVEPPRFVELEVIDTEPGFKGDTQTGATKPAKVETGAVIQVP
FT                   LFINVGDKIKIDTSTEEYLSRV"
FT   gene            625712..626182
FT                   /locus_tag="Calkro_0508"
FT   CDS_pept        625712..626182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45408"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2127"
FT                   /protein_id="ADQ45408.1"
FT                   /translation="MENLYEKVAYLRGLAEGLGVNEDSKEGRLLLSIIDVLDEFADAIN
FT                   ELDVKQAELEDVVDSIDEDLEKLEDEVYENYDEDYDDYYDDEDDEDLVEVTCPNCKVTF
FT                   YLEEDEYLNEDEIECPNCNEIIYLDELEEEFDDEEDDDEYEDEVDDEDKKDK"
FT   gene            626413..627573
FT                   /locus_tag="Calkro_0509"
FT   CDS_pept        626413..627573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0509"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: ate:Athe_2126
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45409"
FT                   /db_xref="GOA:E4SEC2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC2"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADQ45409.1"
FT                   /translation="MRKPKLLMTPGPTPLPPEVISAMSQQIIHHRTKEFGEIFSRVNEN
FT                   LKKVFQTKNNVLTFAASGTGAMEASAVNFFSEGDTVLVVSVGVFGDRFINICKTFGLNV
FT                   IEKKYQYGDVANIDEIIEIIESNKDIKGVFITHNETSTGVTNPIEKLARYLKNTDKILI
FT                   VDAVSSLGAIDLKTDEWGVDVVVTGSQKALMSPPGLAFVSVSEKAWEFYKTSKLRKFYW
FT                   DFKKYQDNLLKESQDTPFTPAVTLIRAVDAGLRLILDYGLENNFKRHTRLAHLTQLAAE
FT                   KLNLELLPKKEYSSAVITAIKSPEGVDIEKVRKIMNQKYDIMVTGGQATLKGKIIRIGH
FT                   MGYVDEFDLLKTIECFELALLEVGYKNFGVGEATKAVLQEIAKEVR"
FT   gene            627579..629174
FT                   /locus_tag="Calkro_0510"
FT   CDS_pept        627579..629174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0510"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="KEGG: ate:Athe_2125 D-3-phosphoglycerate
FT                   dehydrogenase; TIGRFAM: D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45410"
FT                   /db_xref="GOA:E4SEC3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC3"
FT                   /inference="protein motif:TFAM:TIGR01327"
FT                   /protein_id="ADQ45410.1"
FT                   /translation="MKVLVTERIAKEGIDILKNEGIEVDEKVGLSHQEICNIIGEYDAL
FT                   IVRSATKVNEEMIKCGRNLKVIARAGVGIDNVDVEAATKQGIIVVNAPDGNIMAAAELT
FT                   IGLIFSIFRYIPQAYMSCKQGDFRRNKFKGVELYEKTAGIIGFGKIGALVAERLKACGM
FT                   RVIAYDPYVSDEKFKKYGVEKVDFETLLKESDLITIHTPKTKETYNLISEKEFKKMKKG
FT                   VRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEKEPNFELEKQEYHNPLLELDNVVI
FT                   TPHLGASTQEAQVNVAVSVAREVAAVLKGGIAKNAVNLPAFEKEKLEETMPYLELAEAM
FT                   GKIFIQAERAFANKIEIVYSGQIDEKATTWLTRALLKGYLEFSVQDTVNYVNSQLLAKE
FT                   QGIEVIESKTEEAGKFKNMITARFTTSEKVLELSGTVYNNEGRIIDFFGYKVDFKPEKY
FT                   MLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGEKAVMVCEIDGELPDEAVEKL
FT                   KNTDGILRVTMAKL"
FT   gene            629229..630503
FT                   /locus_tag="Calkro_0511"
FT   CDS_pept        629229..630503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0511"
FT                   /product="Uncharacterized conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: ate:Athe_2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45411"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC4"
FT                   /inference="protein motif:PFAM:PF06245"
FT                   /protein_id="ADQ45411.1"
FT                   /translation="MANIKGFRGLRYSPEIELDKCICPPYDIISEEEREELYRKSEYNI
FT                   IRVEFGKEYENDNQENNKFTRAKEYLDNWIKQGILKFDSNDCIYVLEQEFEVDGKKYVR
FT                   TGLIVVLELVEFEKGIVIPHEFTLSKPKQERLELMRKTHANISSIFGLYEDKTKEIKEI
FT                   LDRIKSKKEDVSYNGIGTFERMWVVSGSDTIEKLRQLFYDKKIFIADGHHRYETALEYK
FT                   KEMEQKEGKRDDADYNYIMITLTSLEDPGIVILPTHRIVLSTDIEEDIFVEKLKADFEV
FT                   EQGDYKRLKEKLEAKKKYAFLVYTYNHNFYLITLKEPENSLREIEGSKAYKNLDVVILQ
FT                   KLVLNKVLEITDEDILYQRNIKYTKSDKELIETVKKGAKYGFILNPTLVEELKDVSLSG
FT                   EKMPQKSTYFYPKLMTGNVMYVHLK"
FT   gene            630622..631422
FT                   /locus_tag="Calkro_0512"
FT   CDS_pept        630622..631422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0512"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: ate:Athe_2123 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45412"
FT                   /db_xref="GOA:E4SEC5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC5"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADQ45412.1"
FT                   /translation="MIKLVATDLDDTLLSKDLTITEKNLNAIEFLKKNDIILILASGRP
FT                   YPSVKNVAYELENFYPMITYQGALVYDPKTDQKLYGCEISPDSAKELVRLAKDEGIHVH
FT                   IYIDNIWYVEAMNEKTEYYRNLTKLEPCIVKNLLEFIDRPVTKVLFFDEHERLKGLKES
FT                   LPDDFSKKFNIMFSKPFFLEFTDVNVSKGNALKFLTEYYGLKREEVMAIGDGDNDISMI
FT                   EYAGIGVAVENAVEKLKEAADFVVARSDDSGFAQAIEKVFNVHF"
FT   gene            631607..631981
FT                   /locus_tag="Calkro_0513"
FT   CDS_pept        631607..631981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0513"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="KEGG: csc:Csac_1308 S-adenosylmethionine
FT                   decarboxylase proenzyme; TIGRFAM: S-adenosylmethionine
FT                   decarboxylase proenzyme; PFAM: S-adenosylmethionine
FT                   decarboxylase related"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45413"
FT                   /db_xref="GOA:E4SEC6"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC6"
FT                   /inference="protein motif:TFAM:TIGR03330"
FT                   /protein_id="ADQ45413.1"
FT                   /translation="MHALGRHIIAELYGCDKEVLNNRELIEKIMVESALKAGAEVREVA
FT                   FHKFSPQGVSGVVVISESHLTIHTWPELGYAAVDVFTCGERVDPWQACNYITEMLKASH
FT                   MTTTEVKRGLFEQPVKVANL"
FT   gene            632347..633270
FT                   /locus_tag="Calkro_0514"
FT   CDS_pept        632347..633270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0514"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ate:Athe_2118 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45414"
FT                   /db_xref="GOA:E4SEC7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC7"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADQ45414.1"
FT                   /translation="MKVVCYGEVLIDFLNVKGNLFEANPGGAPANVAAAVAKFGGKSYL
FT                   ISQVGNDIFGKMIIDSLSACGVDISNVKMTDEYFTTLAFVKLDSRGERSFSFSRKYGAD
FT                   VYLKVEDIDINIVKSADIFHFGSLSMTYEQNKRTTLELLKIARQSGSTISYDPNYRSSL
FT                   WESQKKALDTMIEPVENGFVDILKMSEEEVLLYEKDVNDFYNRIKDKVKIFLVTLGEKG
FT                   SMVFFKGKSYFVDTIKVDVVDTTGCGDCFVGMVLHEISKSLPIENLSEDEIVNIVKKAN
FT                   IAGALCATKKGAIPAIPEYNQVLERL"
FT   gene            633311..633583
FT                   /locus_tag="Calkro_0515"
FT   CDS_pept        633311..633583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0515"
FT                   /product="ACT domain-containing protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   ate:Athe_2117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45415"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC8"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADQ45415.1"
FT                   /translation="MMRAIITVVGKDKVGIIAAISSLLAQNNVNILDISQTIMQGFFTM
FT                   IMLVDLQDCKLKFSELKDLLIKRGREIGVDVNMQHEDLFNSINRI"
FT   gene            633615..634973
FT                   /locus_tag="Calkro_0516"
FT   CDS_pept        633615..634973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0516"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711; KEGG:
FT                   ate:Athe_2116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45416"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEC9"
FT                   /inference="protein motif:PFAM:PF05167"
FT                   /protein_id="ADQ45416.1"
FT                   /translation="MFTSQEIIETINMVKQSNLDIRTITVGINLFDCSSDIPQRFIDNM
FT                   RKKIIKYAGNLKNVANEIEDMFGLPIVNRRVALTPISLLTFSYSYEDLIEVALAIDEIA
FT                   KELEVDLIGGYSAAVHKSYDENTKKFISSIPDALASTDRLCSSVDVGTTRAGINLDVIA
FT                   HLGFIIKDIAQKTKDKDSFGCARFVVFANAPDDNPFMAGAFHGTGEGDSAINVGISGPG
FT                   VVKRALEEKKYASIDEIYETIKKMAFKITRAGQLVLQYASKKLQIPAGIVDLSLAPTPK
FT                   VGDSIAEILEEIGLEKVGGYGTTFALALLNDAVKKGGAMAATFTGGLSGAFIPVSEDSG
FT                   MVRAVEAGTLSLEKLEAMTSVCSVGLDMIVVPGDVEAEVISAMIADEIAIGVYNNKTTA
FT                   VRVIPAYGKKEGDEVNFGGLLGRSKVMSVNRSSPKRLIERGGRVPPPIISLRN"
FT   gene            634999..635835
FT                   /locus_tag="Calkro_0517"
FT   CDS_pept        634999..635835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0517"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   ate:Athe_2115 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45417"
FT                   /db_xref="GOA:E4SED0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED0"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADQ45417.1"
FT                   /translation="MLFSKMHGLGNDFIVIDARGKEDIDYNLLAKRMCHRHIGVGADGL
FT                   LLVLDSKLADIRMRIINSDGSEAEMCGNGIRCFAKYVFERGIVKATKFKVETLAGIIEP
FT                   ELFINEYGLVDKVKVNMGKPSFKRKDIPMQGDPKSDAINTSIVVDGNEYRITSLLMGVP
FT                   HTILFVDDLEKVDIYTLGPKIEKHEIFPRKTNVNFVQVIDKNNIKVRTWERGAGATFAC
FT                   GTGSCASVIAANLNGLTERKANVHLYFGILEIEWREDGIVFMTGPAEEVFVGEYLD"
FT   gene            complement(635929..636498)
FT                   /locus_tag="Calkro_0518"
FT   CDS_pept        complement(635929..636498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_1120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45418"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED1"
FT                   /inference="similar to AA sequence:KEGG:Csac_1120"
FT                   /protein_id="ADQ45418.1"
FT                   /translation="MKKFFIFSTIILGLFLTIFLITVFSFKLLSLQDSGVKEFEKTFNI
FT                   RLPKGTVSEKMYDDYGSFHNDGMKLYKFVFTTDGRKSFTSYIAKQKNWKKLPLNPAYQI
FT                   LMYGGKVQDSPCNTLERIGFAKKVCLPKISKGFWRAVGDRSVLTAKLIDYENLDIKILD
FT                   NLYSYDFYLAIYDAEKGILYMFNINT"
FT   sig_peptide     complement(636406..636498)
FT                   /locus_tag="Calkro_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.802 at
FT                   residue 31"
FT   gene            complement(636510..637208)
FT                   /locus_tag="Calkro_0519"
FT   CDS_pept        complement(636510..637208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfs:MFS40622_1369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45419"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED2"
FT                   /inference="similar to AA sequence:KEGG:MFS40622_1369"
FT                   /protein_id="ADQ45419.1"
FT                   /translation="MNNRRFQTLVIIICLTLITLLFLPSKVFAESEGNFQITYENAHEV
FT                   FEKMSNEELNNFINNIATSYSNSKTSQTSILQTVSVEQYNSIQLAWLAAAQIARNYGYP
FT                   CAATLVEFSVKNIPYSECGEGLFINKIRTISVYKDYISKLKSDSKIPNSITFSKSDNAD
FT                   LFYALHKVNIKSSKGLLSIYTITILDTFDFAYDNNYNDLFTNIVNNWAWLCQQTHVLHP
FT                   ISVIITLSEQ"
FT   sig_peptide     complement(637119..637208)
FT                   /locus_tag="Calkro_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(637655..637972)
FT                   /pseudo
FT                   /locus_tag="Calkro_0520"
FT   gene            638110..638349
FT                   /locus_tag="Calkro_0521"
FT   CDS_pept        638110..638349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0521"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ate:Athe_2113 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45420"
FT                   /db_xref="GOA:E4SED3"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED3"
FT                   /inference="similar to AA sequence:KEGG:Athe_2113"
FT                   /protein_id="ADQ45420.1"
FT                   /translation="MIEFFLSCDIILIWFLWLFARKVNVLKVFYVKIEYKDGRKVEDIF
FT                   LTNAKAKEMCDLLLGEDKEGAIKLVETKCREVDL"
FT   gene            638407..638643
FT                   /locus_tag="Calkro_0522"
FT   CDS_pept        638407..638643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0522"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: ate:Athe_2112 preprotein translocase, SecG
FT                   subunit; TIGRFAM: preprotein translocase, SecG subunit;
FT                   PFAM: Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45421"
FT                   /db_xref="GOA:E4SED4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED4"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADQ45421.1"
FT                   /translation="MAKIILTVLELLLAIALIIVVLLQSGKSAGLSGSIAGGAETFFGK
FT                   YKGRTLDAMLGRYTWIIAAAFFVVSIVLFFVIK"
FT   gene            638742..639299
FT                   /locus_tag="Calkro_0523"
FT   CDS_pept        638742..639299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0523"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: ate:Athe_2109 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45422"
FT                   /db_xref="GOA:E4SED5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED5"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADQ45422.1"
FT                   /translation="MSITREVALEELKKRIKTQNLFKHCLACEAIMRELACYFEQDMDK
FT                   WGICGLVHDIDYEDTKNDPNAHSLVGAKILEDLGFDKDIVYAVKVHNDAHGLPRLSLLD
FT                   KALYCVDPTSGFIVAGALILPSKKLSDVTVPFLLNRFNEKSFAKGANREQMKACSELGL
FT                   ELEEFLGIALKAMQKISNDLGL"
FT   gene            639326..641476
FT                   /locus_tag="Calkro_0524"
FT   CDS_pept        639326..641476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0524"
FT                   /product="ribonuclease R"
FT                   /note="TIGRFAM: ribonuclease R; VacB and RNase II family
FT                   3'-5' exoribonuclease; PFAM: ribonuclease II; Ribonuclease
FT                   B OB region domain; RNA binding S1 domain protein; KEGG:
FT                   ate:Athe_2108 ribonuclease R; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45423"
FT                   /db_xref="GOA:E4SED6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED6"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ADQ45423.1"
FT                   /translation="MKKIKFEEKKQEVLNLFQEESYHPMTFSEILEILNWQEKDEKLLR
FT                   KILEELEQEGKIVKTKRGRFGLAEEMNLFAGVLEVNPRGYGFLIPDNPNVPDIYISPEN
FT                   MNGAMHGDRVLVKALSAVPVEGKKIEGYVERILQRGITKVVGRYEDSKNFGFVIPDDQR
FT                   ITYDIYIPKSSKNKAKTGQKVVVEITRYPEKRRNPEGKIVEILGYENAKGVDILSIIKK
FT                   YELDEEFPKEVLKEVENIPDEVTEEDLEGRVDLRNLTIFTIDGEDAKDFDDAVSIQKLP
FT                   NGNYLLGVHIADVSHYVKPNTHLDKEAYKRGTSVYLVDRVIPMLPFKLSNGICSLNPNV
FT                   DRLTFSVMMEIDKQGNVVKHDIFESVIRSKERMTYTNVTKILKEEDKELLKRYEHIRED
FT                   LELMRELALILREKRMKRGALDFDFDETKVILDKNGKPIDVVRYELTISNKIIEEFMLI
FT                   CNETVANHFYWLNVPFLYRVHEEPDIEKIYQFAEFIYNMGYVLKGISNKVHPKALQAVL
FT                   EQSRGTPEERVIHTLCLRSLKKARYCEENLGHFGLSTEYYCHFTSPIRRYPDLVIHRIM
FT                   KDVLKGKMTEKKAQKLKLKMPEIAKWTSQRERVAEEAERETIDLKKVEFMQDKIGQVFE
FT                   GIISNVTPFGFFVELENTIEGLVRVSSLEDDYYVFNEKTYQLIGEKSKKVYKIGDKVKV
FT                   MLIDANVPLRQIEFSVVEKLKM"
FT   gene            641494..643098
FT                   /locus_tag="Calkro_0525"
FT   CDS_pept        641494..643098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0525"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG:
FT                   ate:Athe_2107 DNA polymerase III, subunits gamma and tau;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45424"
FT                   /db_xref="GOA:E4SED7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED7"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADQ45424.1"
FT                   /translation="MHIALYRKYRPKVFEDVVAQEHITRTLKNQIKQDKVAHAYIFCGP
FT                   RGTGKTTTAKIMSRAVNCLNPKDGNPCNECEICRSILDEKTLDVLEIDAASNTSVNDVR
FT                   QIRDEVRYPPSVCKKKVYIIDEVHMLSTGAFNALLKTLEEPPEHALFILATTDIQKVPA
FT                   TILSRCQRFDFKRISVKDIYERLKKIVQMENISIDDNALYLISQKAEGALRDALTILER
FT                   CINTSDEHITYKFVANLLGVTSTEIVKEYIAAIVENDSNKGLKVVNRLWDEGMDVNTFL
FT                   EEAVKLLRSALILRLGAKDVLVDMLESDKDFVINISNLVDSNRLVSIIKMLIDTANQIR
FT                   WTRFPKVLLEINTIKLCDSQFDTSFETLIERVRKLETKLSQLAENPKAFEALKFEKAQS
FT                   TKQEQKTVNIAEKSASSVDSNASFSLSEILSRWQEIKEAIKEEKPGLSHVLQNASLRLE
FT                   NGVKVCFKQEDSVFAEVLSRNMEYFKSVLKRIVGYEGEVIVDVEKQEPFKENTVSDQEI
FT                   INKLKDIFPDTEITIKE"
FT   gene            643113..644195
FT                   /locus_tag="Calkro_0526"
FT   CDS_pept        643113..644195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0526"
FT                   /product="protein of unknown function DUF362"
FT                   /note="KEGG: ate:Athe_2106 protein of unknown function
FT                   DUF362"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45425"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED8"
FT                   /inference="similar to AA sequence:KEGG:Athe_2106"
FT                   /protein_id="ADQ45425.1"
FT                   /translation="MNNNIYIIYGKDAKSMTKQLLEYADVKKYIPLGSKIAIKPNLVVA
FT                   KPYTSGATTNPHIVEGIIEYLSENGFENIAILEGAWLGASTKRAFEVCGYTEIAKKYNV
FT                   KLIDTKDDKPLKINVDGFELNICSQVYSYDFLINVPLLKGHCQTQLTCALKNLKGLIPD
FT                   SEKRRFHTLGLHKPIAYLNKAIKTHIIVVDSIMPDPDFEEGGNPVEKDFIALGFDPVLI
FT                   DSFAAEHLGYNPYDIEYIRLAEKLGIGKAGEYNLIEINSDKKPTGVSKRSSIVSRYTKY
FT                   IEEKDACSVCYANLISALMRLDEQGILKRLSKKLYIGQGYKGKVMDGIGIGSCTSDFNI
FT                   CKQGCPPKSNEIVEFLKQNL"
FT   gene            644480..645025
FT                   /locus_tag="Calkro_0527"
FT   CDS_pept        644480..645025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0527"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: ate:Athe_2105 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45426"
FT                   /db_xref="GOA:E4SED9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:E4SED9"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADQ45426.1"
FT                   /translation="MNFIISGKNIEVTDALKERVEKKLSKLERYIKLNTDVHVTLSVEK
FT                   ISHIVEVTIPFHGMILRAEERSNDMYSAIDLVVDTLERQIRKFKTKIAKRAKDAESLRY
FT                   MTFELEEPEKEVQEENSEFKIAKTKRFPIKPMSVEEAILQMNLLGHNFFVFLNQDTDKV
FT                   NVVYKRNDGAYGLIEPEY"
FT   gene            645181..647727
FT                   /locus_tag="Calkro_0528"
FT   CDS_pept        645181..647727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0528"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: ate:Athe_2104 preprotein translocase, SecA
FT                   subunit; TIGRFAM: preprotein translocase, SecA subunit;
FT                   PFAM: SecA DEAD domain protein; SecA preprotein
FT                   cross-linking region; helicase domain protein; SecA Wing
FT                   and Scaffold; SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45427"
FT                   /db_xref="GOA:E4SEE0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE0"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADQ45427.1"
FT                   /translation="MLKIIEKLIGSYSEREIKKILPIVDKIESLAPEYERLTDAELRQK
FT                   TDIFKQRLKNGETLDDILPEAFAAVREAAWRTLRMRHFRVQLIGGIVLHQGRIAEMKTG
FT                   EGKTLVATLPAYLNALEGKGVHIVTVNDYLAKRDAEWMGPIYNFLGLSVGVIVHGLSHE
FT                   ERKKAYNCDITYGTNNEFGFDYLRDNMAIYKEELVQRELNYAIIDEVDSILIDEARTPL
FT                   IISGPAEKSTDLYKRADNFVRRLKPLYYNSDDDKQMPDTNGYDYIVNEKRHTVSLTEEG
FT                   IKKAEKYFGVTNLADPENATLHHHIIQALKAHALMKRDRDYVVKDGQVIIVDEFTGRLM
FT                   YGRRFSEGLHQAIEAKEGVRIERESKTLATITFQNYFRLYKKLAGMTGTAKTEEQEFRE
FT                   IYKLDVIEIPTHKPMIRIDHPDKVYKTEKAKFEAIVQEIVETHKKGQPVLVGTVSIEKS
FT                   EMLSEMLKKHGIKHEVLNAKHHEKEAMIIAKAGQRGAVTIATNMAGRGTDIVLGEGVAE
FT                   LGGLKVIGTERHESRRIDNQLRGRAGRQGDPGESRFYVSLEDDLMRLFGSERIKNLVES
FT                   LGLPDDQPIEHKILSDAIEKAQKRVEARNFEIRKHLLQFDDVLNKQREIIYSQRRKVLE
FT                   GENLRDSILGMIDELVDYKIKIYTGESPHPEDWDIKGLLQDLKFIFLDSELSEQDAKNM
FT                   TKQELKEKLISIAKEKYEKKEQEIGELMRELERVVLLRVVDMHWMEHIDAVEQLREGIS
FT                   LRAIGQKDPIVEFRFEAFEMFDEMIKRIQEDTIKIILHANVENMPQRERVAKEMYENAP
FT                   SDTPVRKPVVKTQKVGRNDPCPCGSGKKYKKCCGAV"
FT   gene            647767..648886
FT                   /locus_tag="Calkro_0529"
FT   CDS_pept        join(647767..647841,647843..648886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Calkro_0529"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: ate:Athe_2103 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45428"
FT                   /db_xref="GOA:E4SEE1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE1"
FT                   /inference="similar to AA sequence:KEGG:Athe_2103"
FT                   /protein_id="ADQ45428.1"
FT                   /translation="MLMLEEILQRLEKAEEDLKEMRVSLDIDGLESELKSLENETSKPE
FT                   FWQDIENSQKVLQKIKRIKDKIERFQKLYSQWEDLKVLTELSIEEGNHEMSEELEKELI
FT                   SLERKIDEFKIEILLNGPYDKNNAILSIHAGAGGTEAQDWAEMLLRMYTRWAAKKGYKV
FT                   ETLDILPGEEAGIKNVTIRIVGENAYGYLKAEKGVHRLVRISPFDAAGRRHTSFAAVEV
FT                   LPEVEDDTDIEIKEEDLEIDTYRSSGAGGQHVNKTESAVRIKHIPTGIVVTCQNERSQH
FT                   KNREIALKILKAKLLELKEKERREKIQKLKGEQTEIGWGNQIRSYVFCPYTLVKDHRTE
FT                   AEVGNVEAVMDGEIDVFINAYLKKFRNEEDVA"
FT   gene            648883..649338
FT                   /locus_tag="Calkro_0530"
FT   CDS_pept        648883..649338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0530"
FT                   /product="CheW protein"
FT                   /note="manually curated; PFAM: CheW domain protein; KEGG:
FT                   ate:Athe_2102 CheW protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45429"
FT                   /db_xref="GOA:E4SEE2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE2"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADQ45429.1"
FT                   /translation="MKQYVIFNVGDYSFGVDILEIVEIIKPNKIVKVPSMPQYVEGIID
FT                   VRGTSVPVYNLAKRLEIESKAETQKIIIVELSKFQLGFLVDDVSEILKIEDDKIEKANE
FT                   SIRGIKRKFIDSIARVGDDMIIILDLKNVLTIEEEEQISDMLTDKNQ"
FT   gene            649511..650800
FT                   /locus_tag="Calkro_0531"
FT   CDS_pept        649511..650800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0531"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="KEGG: ate:Athe_2101 3-isopropylmalate dehydratase
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: aconitate hydratase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45430"
FT                   /db_xref="GOA:E4SEE3"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE3"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ADQ45430.1"
FT                   /translation="MTKPMTMSQKILAYHAGKEYVEPGDLIFANVDLVLGNDVTTPVAI
FT                   KEFEKIGIDRVFDKDKIAIVPDHFTPNKDIKSAQQCKMVREFAKKYEITNYFEVGEMGI
FT                   EHALLPEKGLVVPGDLVIGADSHTCTYGALGAFSTGIGSTDMACAMATGKCWFKVPEAI
FT                   KFILYGKKTGWTSGKDIILHIIGMIGVDGALYKSMEYTGEGLKSLSMDDRFTIANMAIE
FT                   AGAKNGIFEVDEKTIEYVKQHSTKPYKIFKADEDAEYSQVFEIDISKIRPTVAFPHLPE
FT                   NTKTIDEITEKIYIDQVVIGSCTNGRIEDLRIAAKILKGRKVKKGLRCIIFPTTQNIYK
FT                   QALKEGLIEIFIDAGCVVSTPTCGPCLGGHMGILADGEKALATTNRNFVGRMGHPNSEV
FT                   YLSSPAIAAASAVLGYIGSPEELGMKGDDE"
FT   gene            650801..651301
FT                   /locus_tag="Calkro_0532"
FT   CDS_pept        650801..651301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0532"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: ate:Athe_2100 3-isopropylmalate dehydratase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45431"
FT                   /db_xref="GOA:E4SEE4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE4"
FT                   /inference="protein motif:TFAM:TIGR02084"
FT                   /protein_id="ADQ45431.1"
FT                   /translation="MIFKGKAHKYYDNIDTDVIIPARYLNTSDPNELAKHCLEDLDKEF
FT                   VNKVQKGDILVAGKNFGCGSSREHAPIAIKACGVSCVVAKSFARIFYRNAINIGLPIVE
FT                   CEEAVDGIEAGDEVEVDLVNGIIKNLTKGKEFKAKPFPEFMQNIMKAGGLIEFVKGELK
FT                   KDA"
FT   gene            651294..652361
FT                   /locus_tag="Calkro_0533"
FT   CDS_pept        651294..652361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0533"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; KEGG:
FT                   csc:Csac_1333 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45432"
FT                   /db_xref="GOA:E4SEE5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE5"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ADQ45432.1"
FT                   /translation="MHRIAVIPGDGIGPEVIEQALIVLDKVSSKFSMKFEYIFIDAGGC
FT                   AIDKYGVPIREEDLELVKKCEATLLGAVGGPKWDGLPGNLRPEQALLKLRGGLKVYANL
FT                   RPAVLYDELKDSSPLKKEIVDKGIDILVVRELIGGMYFGPKGREEKDGDEVAYDTEVYS
FT                   KSEVRRIAKVAFEAARKRKKKVTSVDKANILESSRLWRETVEEVAKDYPDVELNHMYVD
FT                   NASMQLVKDPSQFDVILTSNMFGDILSDEASMIVGSIGMLASASLGDNKVGLYEPIHGT
FT                   APDIAGQDLANPIATILSAAMMLRYSFDMEDAAKAVENAVKIALKEGYRTRDIYTENCK
FT                   LVGTKQMGKIICENI"
FT   gene            652475..653605
FT                   /locus_tag="Calkro_0534"
FT   CDS_pept        652475..653605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0534"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: csc:Csac_1334
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45433"
FT                   /db_xref="GOA:E4SEE6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE6"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADQ45433.1"
FT                   /translation="MKYRPFGKTDFMVSALGFGAMRLPILDGDYSKIDEEKAIEMLHFA
FT                   IDNGINYIDTAYVYHGGNSEVLVGKALKGGYREKVKIATKLPVWQVNNFDDADRILDEQ
FT                   LKRLDTSYIDFYLLHALNKDHWKKLKEMNIFKWIEKVLLEGKIKYIGFSFHDDVATFKD
FT                   IVDSYNWTFCQIQYNILNRNYQAGEEGLKYAAAKGMAVVIMEPLLGGRLAKEPPQEIKQ
FT                   LWEKAPIKRTPVEWALSWLWNQKEVSVVLSGMSTLDQVKENIEYASKYEVGSLTDEELE
FT                   LVEKVAQKYNELRKVNCTECKYCMPCPQGIDIPWNFSIYNQASMYNMFEEMKNDYLKKE
FT                   KERAENCIECGVCETKCPQNLPIRDLLKEVAAYFSK"
FT   gene            653737..654027
FT                   /locus_tag="Calkro_0535"
FT   CDS_pept        653737..654027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0535"
FT                   /product="ribosomal protein S6"
FT                   /note="KEGG: csc:Csac_1335 ribosomal protein S6; TIGRFAM:
FT                   ribosomal protein S6; PFAM: Ribosomal protein S6,
FT                   bacterial-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45434"
FT                   /db_xref="GOA:E4SEE7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE7"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ADQ45434.1"
FT                   /translation="MVERKYETVFIISPTLDDEARNSLIEKFKNLISSNGQLLNVEEWG
FT                   KRRLAYKIDKHAEGYYVLMQFISKPEFPRELERVYRITDGVIRFLIVKLEK"
FT   gene            654043..654531
FT                   /locus_tag="Calkro_0536"
FT   CDS_pept        654043..654531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0536"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: ate:Athe_2096 single-strand binding protein;
FT                   TIGRFAM: single-strand binding protein; PFAM: single-strand
FT                   binding protein/Primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45435"
FT                   /db_xref="GOA:E4SEE8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE8"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADQ45435.1"
FT                   /translation="MNKVILMGRLTRDPEFRLTANNTPVANFTLAVNRRFKRENDQDAD
FT                   FIPIVAWSRLAEFSKNYLKKGRQVVVIGRLQLRTWDDEANRRHYITEVVAEEIYFAEPK
FT                   PKDVPVDSEAEVKEDIILPDLDEEAIESELENFFEEDVKIPSKNNNDVDDGIEDDLPF"
FT   gene            654569..654847
FT                   /locus_tag="Calkro_0537"
FT   CDS_pept        654569..654847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0537"
FT                   /product="ribosomal protein S18"
FT                   /note="KEGG: ate:Athe_2095 30S ribosomal protein S18;
FT                   TIGRFAM: ribosomal protein S18; PFAM: ribosomal protein
FT                   S18"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45436"
FT                   /db_xref="GOA:E4SEE9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEE9"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ADQ45436.1"
FT                   /translation="MNNNQNLQQAQATQTMERVSSRQKKKKRVCSFCVERIYEIDYKDV
FT                   NRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILALLPFIVE"
FT   gene            655024..657558
FT                   /locus_tag="Calkro_0538"
FT   CDS_pept        655024..657558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0538"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: ate:Athe_2094 glycoside hydrolase family 2 sugar
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45437"
FT                   /db_xref="GOA:E4SEF0"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR033400"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF0"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADQ45437.1"
FT                   /translation="MNESIKLSSLFDEINNPPATASIIHWWIFSDEMNENRINVELDYI
FT                   SNLGFKQVLIAAGHNVSPKYLSHDWFEIVKFAVVQAKKRGIKVWIADEGTYPSGFAGET
FT                   FNKKYPHKRMKAIIVEKEFVIEDNLCRIEPHSGTIGILAKDMNQNKYFAFEKLEFSSGF
FT                   LYLPYHSTWQIKVISSAYRTSPTRYVHHPTGAKDTTYSLCDYLDYEAVKLFISEVYEKY
FT                   KAYIGEEFGKTIIGFFADEPDYSISGLPYTDNIFDIFYNEKGYDVKKYIPYFFKEQLDE
FT                   KIKRVEADYWDVWSNIFTNTFFKQIYKWCEANGLKFVVHLNHEDMIEQLIKSEGQFFSH
FT                   MKYVHIPAIDVIWRQIWYDKKAIFPKYASSVSHIRNIAQTFSESFAVYGRGISVEQIKW
FT                   VVDYQFAMDINLFLTSIFKYLYDHPQNYFFPEVIKYINTISYLLYVSTPCTKVLVYFPT
FT                   PDLWAGENISASKAIEIGNALLENQIDFDFFDHSLLEYLEIKNQRIYTNDRKEYDIVIL
FT                   PPIKYLPQDLFRFLKLFSSKGGKIIFFENYPLFVYNKTFTSFFHFVDREIGVVVESIEQ
FT                   LSKMVEKDITVVDSKDVRVLHKRIGNSHLIFLFNVSGTSFLGKIILKFSKKNVYIWDPM
FT                   QNKFLMVSNIKSNGKNIQLELYMHPYRTLVLIASDEYIDGIQKIDLLGSLPRTVSELND
FT                   NWEIHFDKDFVLFSDLKDWQSLGFGDYSGSVVYRKMFSFSHVDFIKNKHLFLYCPNVKY
FT                   FAKVWLNKRYLGARAYSPFMWDITEALKIGENELVIEIQNTPAAALLGTQEKLEKLRKE
FT                   AEKNFYLSISLKFDMEMVQSGLLPPVAIVSLE"
FT   gene            657807..658772
FT                   /locus_tag="Calkro_0539"
FT   CDS_pept        657807..658772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0539"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2093
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45438"
FT                   /db_xref="GOA:E4SEF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45438.1"
FT                   /translation="MKNNIINGPKKKGENDLMTATTSIWKRLKKDKWLYILALPGILYF
FT                   IIFRYIPMFGIVVAFQDFNPFLGFWKSPWVGFEHFKTLFTDPDFPMLFRNTLLISFYNI
FT                   LFYFPVPIILALLINEVRNQVYKRIVQTCVYVPHFVSMVVIASITYVLLSSETGVINNI
FT                   LYSLTGKKIEFLTDPRWFRPLIIIQSIWKEAGWGTIIFLAALSNVDPTLYEAAIVDGAT
FT                   RWQQTWHITIPSIMSTVIILFILRLGHLLDTGFEQIFLMKNPINRSVAEVFDTYVYQVG
FT                   VTQGAYSYSTAVGLFKSVVGLILIQVSNYLSKKFTETSLF"
FT   gene            658804..659682
FT                   /locus_tag="Calkro_0540"
FT   CDS_pept        658804..659682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0540"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2092
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45439"
FT                   /db_xref="GOA:E4SEF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45439.1"
FT                   /translation="MRQNKTVASTIFDVFNHIFLGIWAIITVLPFLYVLAASFAPDSEI
FT                   KTRTFFIIPHNPTLLTYKFIFASNYFLRSMLNSVIITVGGTLVNLFFTFTMAYALSKKH
FT                   FIGRSIVLNGVIFTMLFGGGMIPTYLLVKSLGLLNSYWALWLPGAISPFNFFVVKNFFQ
FT                   EMPQDLEDAARIDGCTEAQVLWKIILPLSKPIIATFALFYGVGHWNSWFGALLYINDAE
FT                   KWPVQLILRQIVMLSTTLASDLTQFDPNFQPPQESLKMAIIVVATLPIMLLYPWLQKYF
FT                   IKGMFIGSLKE"
FT   gene            659775..661343
FT                   /locus_tag="Calkro_0541"
FT   CDS_pept        659775..661343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0541"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ate:Athe_2091 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45440"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45440.1"
FT                   /translation="MRKVKKILRLFLVSICIAGLLLTSIGVLGASKSKYSFKLTIMAQY
FT                   FGTEPAPSNSPVILKAEEYLKTDLEFTWVPADGYNDKLNIMLASGNLPMVVYVPGKTAS
FT                   IIGACKAGAFWELGPYIKQYKNLKAIPDIVLWNSSIDGKIYGIPRSRTLGRNGIVYRKD
FT                   WAKNVGITKLETIDDLYNMLKKFTYNDPDKNGKNDTYGMIVCNYNGPFYITLTWFGGPN
FT                   GWGLNKNGQLVPTFLTNAYIENLKFWRKMYQEKLFNHDFPSVPGARWEDYYSQGKGGVK
FT                   IDVIDSANRIYNGLKNNGIIPKDAKDTDIMDIVVSVKGKYGLRNMPTSGYSGYLMVSKT
FT                   SVKDMNTFKKVMSILDKFGDRTMQDLFGYGLPNRHYKLVDGKIDPIPNLPADLSREISG
FT                   LNQVLHFYPANGGTPRYMTPLLQLQADMQALNEKLNILVPNPTEALIGMSDTYIKRGVT
FT                   LDNMIEDARVKYITGQLNDQGFKKVLDNWRRQGGDQIIKEVNALYRKYKKNIPYKEDIY
FT                   KILNP"
FT   sig_peptide     659775..659864
FT                   /locus_tag="Calkro_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.950 at
FT                   residue 30"
FT   gene            661452..664049
FT                   /locus_tag="Calkro_0542"
FT   CDS_pept        661452..664049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_2090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45441"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF4"
FT                   /inference="similar to AA sequence:KEGG:Athe_2090"
FT                   /protein_id="ADQ45441.1"
FT                   /translation="MQEIKLKWLVKPQVGNIGATFCIPWKKAQLWNTENVIVRNKDGSI
FT                   IPTQNWALSYWGDGSVKVSSHAAFFGTNLPDELFACIEESTVTKFETMVEVYEGKDHIS
FT                   VTTGKLECKISKTGDKIIEYLKVGQKIICSNLTQILITERISNFTGYKTKVEEEYIPQI
FT                   LGAKVESHGPLRCVIRVWGRHLRNTKMTFDGSLLKQGWLPFELRLYFYANSDKIKIVHT
FT                   FIYNGNPHQDFIKGLGLKFDLPLHSPLYNRFVRFGGDSGLFCESPKNLIDVYRKERYKI
FT                   MFQNQVNGQPVDFDIDEDHHYIREINNTPEWDEFVLFQDSSEHYVIKKRTSCQCSFVKA
FT                   TEGRRSMGFAYIGDENGGLGVALKDFWQKYPSGFEAKALTSSEANLIVWLWPPYAEVMD
FT                   LRHYDFGTYTSSSYEGFDEYRSTPYGIANTNELWLYCFDYAPTSEQLLECAKMQGFSPL
FT                   LVCSPERYKETEIFGGLNLPDNSNSKKEKIERILTAIVDFYLKEVERRKWYGFWDYGDF
FT                   MHSYDMVRHMWKYDIGGYAWQNTELVPNIWLWLMFLRTGRFDIFKMAEAMTRHTSEVDV
FT                   YHLGEYKGLGSRHNVVHWGCGCKEVRISMAYLHRYYYYLTADERIGQLMDDVKDIDKQI
FT                   MHMDPMRAYFTNDPENRVHIRVGPDVMTFCANWFVRWERHQEEIYKQKIIKILDFLKKN
FT                   PAAFISGGVFDYDPEKTQLKPVEYTGGSNFVFCFGNTLVWLEIAKNFEDKEFEELCAQQ
FT                   GLFYTEFKENKDEILKSWGVPSFGFKLNMLNIGMAAFAAMKKNIPELKKEIWQMFLDHN
FT                   KNPWLKFICDGGINLQLATVPAPVVEIPFISTNIASQWSLNALLALEFIGDEL"
FT   gene            664089..668067
FT                   /pseudo
FT                   /locus_tag="Calkro_0543"
FT   gene            complement(665084..665848)
FT                   /locus_tag="Calkro_0544"
FT   CDS_pept        complement(665084..665848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0544"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="manually curated; PFAM: IstB domain protein
FT                   ATP-binding protein; KEGG: ate:Athe_2292 IstB domain
FT                   protein ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45442"
FT                   /db_xref="GOA:E4SEF5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF5"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADQ45442.1"
FT                   /translation="MSNYVKLLNNLEELGLHNIKNNLDKYLDLVASGEKSMTDALYELS
FT                   NLEIKAKEERAILGCVRVANFPFIKGIEDFDFSFQPSINKQQIMDLMSLRFLEGNENIL
FT                   FVGTPGVGKTHLATAIGIECAKRRYSTYFIHFQELIAQLKKALIENRLEYRLKHFSKYK
FT                   VLIIDEIGYLPIDNDGANLFFQLISSRYEKSSTIITTNVVFSEWGEIFGGATIANAILD
FT                   RLLHHSYVIFIKGPSYRLQSKTAYFSNTNQQS"
FT   gene            complement(665869..667071)
FT                   /locus_tag="Calkro_0545"
FT   CDS_pept        complement(665869..667071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0545"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ate:Athe_2293 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45443"
FT                   /db_xref="GOA:E4SEF6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF6"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADQ45443.1"
FT                   /translation="MQNLTAHLNMIRAMKMKPNFSELARIYGMDRRTVKKYYEGYEGKP
FT                   KNRNKPSKLDKYYDEIKSKLAIKGVTVKGVYEYLKSKDETIGTYSNFNKYVKKKGLKPE
FT                   KKIKGHPRFETDPGEQAQVDWKENIKLVSRNGEEFIINVLDFKLGYSRYCCFEINRTKT
FT                   QEELIETLIRIFKDIGGVPREILFDNTAAVVDITGEKIKVNSRFKSFAKDFGFEVKLCK
FT                   PRHSYTKGKVEAANKFIDWILPYQGEFETEEDLVRIIKEINAKVNMQPNQTTQVPPALL
FT                   FQKEKEYLQPLPDKRLIDSYLNSYKSVKVQKDSLIYYKGSKYSVPPEYIGKTVQVKEVE
FT                   NKIYIYYNTNLLRIHVIDEKNINYHDEDYKQLMLMRVGQREELNKICEENLKKFDNLLK
FT                   T"
FT   gene            668259..669404
FT                   /locus_tag="Calkro_0546"
FT   CDS_pept        668259..669404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0546"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="manually curated; TIGRFAM: dihydroorotate
FT                   dehydrogenase family protein; KEGG: ate:Athe_2085
FT                   dihydroorotate dehydrogenase family protein; PFAM:
FT                   dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45444"
FT                   /db_xref="GOA:E4SEF7"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF7"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADQ45444.1"
FT                   /translation="MPNLSTTYAKLNLRTPVIVASAGITGTVERLQRCEENGAGAVVTK
FT                   SLFQKEICRIAPTPRFKIVKHENTFTLYSYEQASEFNPQEYAEFIFKAKQKLSIPVIAS
FT                   INCYTDDAWLEYSKLMEQAGADAIELNLSCPHGVHIMSGMDVIEEMVHTTKLVKSNVKI
FT                   PVIPKMTPQSTNPGFDALRLDSAGADGLVMFNRFTGLDIDIEKEAPILHGGYAGHGGPW
FT                   AIMYGLRWISAVSPKVKCSISASGGAMNGEDVVKYILAGASTVQVCTTVILNGYGVIKK
FT                   INKYLEEYMERKGYNTIDDFKGKVCSRILDMDSVDRTHWAVARIDKEKCTSCGKCFTVC
FT                   IYDAIEKDDGKFKVNQNCDGCGLCAELCPTKAISMVRRGEE"
FT   gene            669408..671195
FT                   /locus_tag="Calkro_0547"
FT   CDS_pept        669408..671195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0547"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: ate:Athe_2084 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45445"
FT                   /db_xref="GOA:E4SEF8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF8"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADQ45445.1"
FT                   /translation="MIYKTDILVVGGGGAGLRAAIAACEKAYENKKSVKVILAVKGRLG
FT                   SCGTTALAYSDRMAFHVTLPTTEPPGEDNWKYHAKDIYEIGGLVSDYDLAEILAKNSAD
FT                   AYFYLDSLGVPFVKENGVPVQFVTDGSIYARACFTGPDTAVQIEKALIRKLGEMKDIEV
FT                   LEDVMISDLIVVNNKVCGAIGFKENQNIIILAKAVVLATGGAGSIYKSNVFPPRMTGDG
FT                   YAMALRAGAQLVNMEFIQIGLSSPKTKLACSGSIMRCVPRFVNEKGEEFLLNYPITYND
FT                   VFEKGATWPISYEHKTCLIDIAVFREIARGGKVFLDFTQNPKGFEFEHLREDLKQRYYK
FT                   EIKNQIGSRKTPYERLCEINPQTVEWFLKRGIDLRNQMLEIAPSIQHFQGGVKIREKAN
FT                   TAISGLYACGECAGGQHGANRPGGNALLDTQVFGKIAGESSFEFALNTSIDEESIVCQA
FT                   NRLFESYKSYVAEDGIDLEKAISELNSVMDLYASVVRYQAGLQKALMKIEELKTRKVKP
FT                   VEYEYLLELKNMLLCAEAMVKSCILRDESRGPHLMFENYSDLWPKPRDERYNVYHVCRL
FT                   NKETNQIEVFPMQPVKPKA"
FT   gene            671209..672297
FT                   /locus_tag="Calkro_0548"
FT   CDS_pept        671209..672297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0548"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   ate:Athe_2083 alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45446"
FT                   /db_xref="GOA:E4SEF9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEF9"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADQ45446.1"
FT                   /translation="MKAYAMVLEEFNKPLKMKEFELVSPTDGKLLVKIEAAGVCGSDVH
FT                   MFKGNDPRTKLPMILGHEGVGRVYAISGQWRDINGEKIQEGDLIIWDRGVVCGKCYFCA
FT                   VKKESYLCPHRWTYGISVSCEEPPYLRGCYSEYIYLHKDTKILKIKEGIEPEVLVSASC
FT                   SGATCAHAFDIVSPDFGDSVLIQGPGPIGLYAIIFAKLKGARNIIVIGGTKERLKMCKE
FT                   FGATHVLDRNSTTPQQRQEIIMDITNGRGVDLAIEAVGHPSAVSEGIKLVRNGGSYLSL
FT                   GFGDPNGSVTLDCYYDIVRKNLRYQGVWVSDTKHLYMAVNVVLQNRELFKKMITNVYKL
FT                   TDATKALEDMENKNTIKSVLKP"
FT   gene            672294..673535
FT                   /locus_tag="Calkro_0549"
FT   CDS_pept        672294..673535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0549"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   ate:Athe_2082 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45447"
FT                   /db_xref="GOA:E4SEG0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ45447.1"
FT                   /translation="MIINQKGWTVLNIAKIGLIGISGFGSIHLRSIEQLQRKMVDLRAI
FT                   VATSYEKNKEVIDRLTSQGVKYYQDYRLMLENHKDLDFVAISTPIHLHAPMAIDAMERG
FT                   FNVLLEKPPAVTIQDIDTIIETKKRTGKICGVNFQNTSGKAFRKLLEYIKEGRLGRIKS
FT                   IIGVGRWKRDESYYQRNAWAGKLIVDGNYVLDGTINNPLAHLLNNELIIAETSEENGGV
FT                   PQKVTAELYHGHKIEGEDTACVRIITKTGIEVYFYSTLCNREEEPPYIMIEAEKAKAYW
FT                   TFANRFKIEYIDGSTEEFDGGHEDLFVNMYINMVEHLFEGKQLYCPLEVTRNFVLASNG
FT                   AFESSGCVYGIPDEYLEISNENGKIYTYIKNIKEIIDEAAISKKLFSEIGVLWAKQTEE
FT                   FDLVDYCCFSMFKR"
FT   gene            673815..679184
FT                   /locus_tag="Calkro_0550"
FT   CDS_pept        673815..679184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0550"
FT                   /product="S-layer domain-containing protein"
FT                   /note="PFAM: S-layer domain-containing protein; FG-GAP
FT                   repeat protein; KEGG: bsu:BSU07050 polysaccharide lyase;
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45448"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG1"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADQ45448.1"
FT                   /translation="MRKIYAFVVLISFLLFNIFGNGFVAKGNNIFDPSNYVLFDGTNFE
FT                   DGSTWGFTPGGGASATVVTDVYGNKYLEAKGSGSGTRSIVKTFSTSTTKDKVLILFDWQ
FT                   PMDVSTAANNSEVLISDENNNPLFRLVKKGGTNGAIGYSVGTTGLDLSKVTYINTIDTS
FT                   QKWLTVRILFDFVAETVSFEIFNKDDPSKYFSAYGLDLKNIVYLNKIKKISIIGNRASG
FT                   NTLNFTTNVDNVYIYTSTTDAPIQGSKNIVEIVSSYTYNYDFPLGTSINDIISFFPTAL
FT                   NVKLENNVIVNNVPVSWSCYNYNPGQEGNYLFVGNLIIDGITGVKNDYNITAQINVRLL
FT                   NLSFVPPQIPGYEIVYATDFGDTITVVPKYWGFTTQNATLNINTYDIKGNSTPKLEFTQ
FT                   VNQTGGRVATKTFGETIKGDAILVKMNWYPGLLNDKGSNPYENGGELRLIDSSGNVFWK
FT                   LNNTRNSPLQLILGNSVVFNTYFTEPEKWYDIEINCDVLNKVISTKITDTETSTVIEFT
FT                   YSSDNVAFDGTLKSISLVGIRTSGNNITWTTYLDNVWIYNKPIPPNRIINVDKLPYKTI
FT                   YVNTAQDISQIGLPTRVTVTLANGTKKEVEIAKWEILSGQWSADKPGIYTFKGVLKEDS
FT                   SVDNTYGKYAICYVYNRLQPSKAVRQMEWLNRGLIALKAENGIFINWRLLADEYKKDVK
FT                   FNIYRNGQKLNTAPLSVTNYLDVNGNPGDEYKVETLVNGIKIEETKVKALDKDYISIPL
FT                   QKPEDGVNEAGETYTYEANDCSVGDLDGDGEYEIIVKWLPSNAIDSSQTGLTGPTIFDA
FT                   YKLDGTLLWRINMGLNLTSGAHYNQFLVYDFDGDGKSEFVVKTADGTTVYGATYGRVDY
FT                   NKVISVIGDPAKNGAYRYGPNGPFPGKVWGGPEYISIFDGETGAVLDSIEYRYSIEKTG
FT                   VASWGDTWFNRSDRFLAAVAYLNGTTPSIVFGRGYYARTTFVAYDFVNGKLQERWHFDT
FT                   QEIGGKGEGMGNHNLSVADVDNDGCDEIIAGSLTLDHDGKILYVMDGEMGRELGSHGDA
FT                   LHVGAFFPDREGIQVFGVHEVPAVASLELHDGATGETLQAYFAYKDTGRGVCANIASEP
FT                   GYEFWGAGDFYDVNKGAGIYNVYGKIISNDCRAAGLPMNFALYWDGDLMQELLDDVSIF
FT                   KYDETRDKTDIIRTFEDVKSINGTKANPCLQADILGDWREEVIYPTFDNTELRIYSTTI
FT                   PTQYRIYTLMHDPVYRLGIAWQNVAYNQPPHTSFYLGEDIRDVVLSNNLPVKDIFYPNK
FT                   PRKADEPEEKLFYKSSSESKVDLYFENNKVKITIENDEEIVGGKISVRRLSTLNGIQLP
FT                   SGLDTTNNYMEIIKSENIRNMLMKVEFTFSPNNLNGCDINSLKLYRYNSTTAKWEFVNG
FT                   QVVDTMKNIISFVDTEGGIYGVFGTKPATSSGVVTTIILNPQSQTTSSTTGTSSKGQEK
FT                   TQQGITQVTQGETQQPKPQIQTSEKNIVTAKIDTNTVTNVQLNSQVKISVPPQAVEGNN
FT                   PVIKVETLGSYTEKVKVGTTVIEPINISIENGKIQKSIVVEVKIAPETIKNDKVVIGFI
FT                   FDSMSKKWVPVLTKKNINTVQLELNKAGTVQVVAAKLSEIYSDIKENNWAYNIFNQAIT
FT                   KGIITGYADLTLKPEKQITYYEAAVILDRAFNLEKSSNSNLSEVPQWAKDAIMKMVSNE
FT                   IFDETNASNGIVSRIEAVKFMVKILEKKGLQIEPEDVKFKDINNAEYTEIVSKAYKLGI
FT                   VKGYPDGSFKPDKPVTRSEFVAMLIRAIENINK"
FT   gene            complement(679538..681396)
FT                   /pseudo
FT                   /locus_tag="Calkro_0551"
FT   gene            complement(681742..681825)
FT                   /pseudo
FT                   /locus_tag="Calkro_0552"
FT   gene            682149..683501
FT                   /locus_tag="Calkro_0553"
FT   CDS_pept        682149..683501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0553"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="KEGG: ate:Athe_2081 extracellular solute-binding
FT                   protein family 1; manually curated; PFAM: extracellular
FT                   solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45449"
FT                   /db_xref="GOA:E4SEG2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADQ45449.1"
FT                   /translation="MLNRAFNFKKRKEEIYMKRILCIGTIIIFLFSLLLFPFGKPSEKA
FT                   FGSSQSIKLRVAWWGSQTRHDRTQKVLELYRAKVNRKVSFVTEFGSWSGYWDKLTTQAA
FT                   AKNLPDIIQMDYMYLAQYVQKGLLADLTPYTKNGILNLKDVSEASIKSGSVGGRIYAIS
FT                   LGTNALAIIYDPAVAQKAGVKIPEDGNWTWNDYKEIIKKVYQKTKIRADLALTADPKFL
FT                   LEYYVRQQGKSLYKHDGTGLGFTQEKFVIDVFNINLELLKGGYTAKPDEVSATSTIEDS
FT                   LFVKGKTWIGWTWSNMFVATANAAKRPLALALPPKGGIRPGLYLKPSQFFSIAATSKYK
FT                   TEAAKVINFFTNSIEANNILLAERGVPISAKVREGIKNAVEPAVRQTFDYIALAEKNCS
FT                   PIDPPDPPGGTEVGQTFKDLYDQVLYGQIKPETAAKMFMQKANQILAKNKK"
FT   gene            683594..684520
FT                   /locus_tag="Calkro_0554"
FT   CDS_pept        683594..684520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0554"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2080
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45450"
FT                   /db_xref="GOA:E4SEG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45450.1"
FT                   /translation="MSNINRKKSFRELLMSSENVAGYVFISPWLIGFFVFTLIPIAATF
FT                   YLSFTQYDLLSSPKFVGLQNYVQMFKEDPLFWKSMSVTFFYVFVTVPLKLAFALLLALW
FT                   LSYKSRLTPFYRAVYYVPSMMGGSVAVAVLWQRLFTSDGVINSILKLFGIQSETSWIGN
FT                   PRTAIWTLILLAVWQFGSPMLIFLAGLKQIPESYYEAAIIDGANSWQKFVKITLPMLTP
FT                   IIFFNLIMQMIGSFMTFTQGFIITNGGPVNSTLFYAIYLYRRAFQFYDMGYSCAMSWVM
FT                   LIIIGILTAFIFKSSTFWVYYESKEGE"
FT   gene            684524..685366
FT                   /locus_tag="Calkro_0555"
FT   CDS_pept        684524..685366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0555"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_2079
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45451"
FT                   /db_xref="GOA:E4SEG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45451.1"
FT                   /translation="MRKAKTIKAFLFHLLTILFGYIMLYPLLWMFFSSFKENSEIFLNA
FT                   HELLPKKWLFKNYIDGWRGFAGYPFSVFFKNSFIVTIIGTVGAVISSAIVAYGFARCKF
FT                   KGKGFWFGCMIITMLLPYQVVMIPQYIMFQKMGWVNTFKPLLVPAFLGQPFFIFLMIQF
FT                   IRGIPNELDEAAKIDGCSKYSIFTRIILPLISPALITSAIFSFLWRWDDFLGPLLYLSK
FT                   PELYTVSLGLRMFSDPTAVSNWGAAFAMATLSLVPSFIIFIFFQRYLVEGIVTTGLKG"
FT   gene            complement(685467..686456)
FT                   /locus_tag="Calkro_0556"
FT   CDS_pept        complement(685467..686456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0556"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: ate:Athe_2078 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45452"
FT                   /db_xref="GOA:E4SEG5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG5"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADQ45452.1"
FT                   /translation="MKICIVGSSGHYVYALRGIKEDPHAQIVGISPGCEGENIERLYSQ
FT                   VNEMGFASVVYSNPIRMFEDLKPDIAVINTFFYKNSELAIEAMKRGIHVYMEKPVALSI
FT                   EKLEELKSVWRQTKVKLSSMLGLRYTPHFWTAYKLINENKIGRIRLIHAQKSYKLGTRP
FT                   DFYKHRKTYGGTIPWVGIHAIDWIYWLSGKKFKSVFARHSRLYNNDHGELETTAFCSFV
FT                   MEDEILATVNIDYLRPATAPTHDDDRVRIVGTRGILEVLNGKVYLLNDTTKEVSEVSLE
FT                   KPPIVFLDFLNEVRGTDKCLVSSEDSFYVTLASLLARESADDGKVIEF"
FT   gene            complement(686491..687213)
FT                   /locus_tag="Calkro_0557"
FT   CDS_pept        complement(686491..687213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0557"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ate:Athe_2077 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45453"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG6"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADQ45453.1"
FT                   /translation="MRIIEKIRQKNENYHSGPIPTIVFLGDSVTHGCFEVIEGTKRTLE
FT                   VVCDFEAVYHNQFKKILSMVFPFAPINIVNAGISGDTAQGGLQRLERDVLRFNPDLVVV
FT                   CYGLNDSNKGKEYLNEYLDGLAGIFIELKKHDIEVIFLTPNMKNTYISLAIKSLPLIEM
FT                   AKLNMESQINGTLDLYIDSAKELCKKEKVVVCDCYEKWKKLYHSGVDTTNLLSNFINHP
FT                   NRPMHKLFAWSLFETIMF"
FT   gene            complement(687251..690370)
FT                   /locus_tag="Calkro_0558"
FT   CDS_pept        complement(687251..690370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0558"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: ate:Athe_2076 glycoside hydrolase family 2 sugar
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45454"
FT                   /db_xref="GOA:E4SEG7"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR033400"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG7"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADQ45454.1"
FT                   /translation="MDINFKIKPFWFWNGKMENDEIAEQIKEMHEKGIGGFFIHPRQGL
FT                   EIPYLSHEWFEKVSVAIECAKKYNMEVWLYDEYPYPSGISAGEVIAQHPEFQAFILDYK
FT                   VFEAKENEDIYIELPMSEILLARAYKIGNCSILWNEYVELMDNIGVIYKEHIYQESGLT
FT                   FYNRKRYFVGDGAKALKWKVPKGEWKIFLFYQYPLKNFKYFGTFIDPLNKDAVRLFIQT
FT                   THEKYKKYLGHEFGKTIKGIFTDETAPVAGKLPWSKVLPKLFEQTYGENLIEKLPQIIC
FT                   TDIFDTACSKIKYQFWKLVVDTFIESYDKQILEWCHQNNLLYVGEKPILRSSQLAFMDI
FT                   PGIDAGHQKAGDIPQIVSENYRANPKIASSAAHFYKKERALCECFHSIGWSMTMQDMKW
FT                   IFDWLILQGIDMFVPHAFYYSADGLKKHDAPPSAFFQMPWWKHQKILSEYVENVTKMLK
FT                   NCKRKVDVLLVDPITSQWTCFNEREIKEKISKDFCRIQQILLEENVDYYVIDQSLVKNL
FT                   KCINQKIYYENEKFELLIIPPVTNLEKEAYTKIKELILNGCKIIFIGCLPFQNIEDFDV
FT                   AKDISNFLGVNPMDIAKAYTAGSKLNNTVFLNSCIFIGNIEDLATKIDEIYEKSVVISY
FT                   ESFNDHGILCAYFEDVDHDLLFIINPTKEKKSCKIHVGYKAGEIIRIYSVPLTLQDSEE
FT                   EINFENSLEKKQMAFSMNFEPFQSYLIKLEKSSSKKNHNKKNIEKRVSQYKIPLATVWE
FT                   FSIESLNPLRLGRWNLKLNFNNENEQYLASSKIPVTPKPIIDQIEEAKIAIPLKTKSFF
FT                   GCPKEITLPSFEAIYTTSFFVDAASQKFWLVIEDEGIKGEWVVLLNNHTILPRDFILKR
FT                   FYSHTNLAYDISNLIKLGENQLCVCVKISRSFDGLLTPIYIFSTAGVFKVDDSWHMGKL
FT                   PTQGYFGKDLENGIPFYAGFVKYEKELQMPSLESGIVEFFIEDNVDQCVSLYINNELIG
FT                   TRCWQPYRWKVDSDLLSSKKVKLTLEVSTSSLQLFEGEIIEPITHKIKTI"
FT   gene            690617..691630
FT                   /locus_tag="Calkro_0559"
FT   CDS_pept        690617..691630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0559"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: ate:Athe_2074 transcriptional regulator, LacI
FT                   family; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45455"
FT                   /db_xref="GOA:E4SEG8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADQ45455.1"
FT                   /translation="MVKIPATIKDIAKYTGLSIATISKYLNGGNVLEKNRILIEEAIKA
FT                   LDFEVNEIARGLRTNKTMTIGVLIPVFEVFFNTIVSSLENVLLETGYSIVVCDYRDDEK
FT                   LEKERLDFLYKKRVDALVVVPTYLKGSDIKKIIKRDIPIVAVDRPIDDFECDTILVNNF
FT                   EVSYQAVEKLILMGHKKIGIICGPQNIYTAQERLNGYVQAHTDFNIPLNEEYIKFGEFH
FT                   NMESGYKKMIELLEIQNPPSAVFVTNYEMTLGAIIAINEKDIKVPDELSVIGFDNLEMA
FT                   RIVKPSLSLVVQPMEEIGESVARLLLKRLKGDKSDFPLQKKLSAQVLIKNSIKRVD"
FT   gene            691809..692645
FT                   /locus_tag="Calkro_0560"
FT   CDS_pept        691809..692645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0560"
FT                   /product="5-dehydro-2-deoxyphosphogluconate aldolase"
FT                   /EC_number="4.1.2.29"
FT                   /note="KEGG: ate:Athe_1995 ketose-bisphosphate aldolase;
FT                   PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45456"
FT                   /db_xref="GOA:E4SEG9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEG9"
FT                   /inference="protein motif:PRIAM:4.1.2.29"
FT                   /protein_id="ADQ45456.1"
FT                   /translation="MAIISLKEVFDYSFVKSAICSFNFVNLEQLYGIVAAADELQTPVV
FT                   LMISQKTALKYGLEVMFNLAKSKVEKLHTPFVIHLDHAKNIELVEKAIDLGFSSVMFDG
FT                   SSLSFDENIKKTYEVVKKAHRYGIAVEGEINAIYGKEEDGTPSAIVYTKVKDAKKFSEE
FT                   TEVDFLAVSVGTKHGLYEGTPSLRYDLINEISNSIKSKLVMHGCSGLTAEQLRKSIQSG
FT                   IKKLNFGTEVMLTQINAIKKSLDNLSKPDIRPIMDSSIEEIKAYVKNTINSICISQ"
FT   gene            692688..693731
FT                   /locus_tag="Calkro_0561"
FT   CDS_pept        692688..693731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0561"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   cce:Ccel_1007 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45457"
FT                   /db_xref="GOA:E4SEH0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH0"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADQ45457.1"
FT                   /translation="MKAAVLHAKGDIRYEEVEDPKITEDEVLVKVRASGICGSDIPRVL
FT                   GDAAHFYPIILGHEFSGEIVEVGKNVKNLKIGDRVVGAPLLPCFKCSDCQKGWYSQCKN
FT                   YSFIGSRRQGSFAEYIAIPARNAIKFDESIPFEQAVFFEPSTVALHGLRCVDFKGGEDV
FT                   LVLGAGTIGIFTLQWARIMGARCICVVDIKDERLKLAKEFGADFVVNATEEKFTEKISE
FT                   LTKGRGFGYVFETAGSTETIKFSFEFVSNKGCVCLIGTPTKDIAFSPHLFEKINRKEFH
FT                   LTGSWMSYSAPFPGIEWELTSQYFSDKRLKFSNKLIYKTFHLKDIKEAFELFKSPENVK
FT                   GKVIILS"
FT   gene            693766..694935
FT                   /locus_tag="Calkro_0562"
FT   CDS_pept        693766..694935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0562"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   cth:Cthe_0394 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45458"
FT                   /db_xref="GOA:E4SEH1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH1"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADQ45458.1"
FT                   /translation="MVKSFNYYQPTRIIFGVGRRKELGIWAKRFGKKVLVVVDPNVEKF
FT                   LSQQYQEMLDSLHSEGIETIVFDHVIPNPTLDSIQEGAEVAKREKVDFVIGIGGGSSID
FT                   TAKAIAVAATHEGSAWDYLYFKKEPTEKTLPIIGVPTTAGTGTQTSRVSVLTNTEEKCK
FT                   SAIASDNIICKVAIVDPELTLTVPPAVTASTGFDVFTHCFESYINVNNQPYVDMLALEA
FT                   IGIVIKYLRKAYDNPGDLGARTKMAWADTLAGCCLANVGTTIPHALGQAIGGHFPHVSH
FT                   GQSLAVVYPAFLDYTVDWAIERFAKVARMFNPELEKVSDKEAAYALKQEIVSFLKSINL
FT                   YYTMEDFGIKKEDVKDLVKHAIEFPDNRVNPRVPDEKDLEELYLKSFRD"
FT   gene            694952..696457
FT                   /locus_tag="Calkro_0563"
FT   CDS_pept        694952..696457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0563"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="KEGG: cce:Ccel_1006 carbohydrate kinase FGGY; PFAM:
FT                   Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45459"
FT                   /db_xref="GOA:E4SEH2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH2"
FT                   /inference="protein motif:PRIAM:2.7.1.17"
FT                   /protein_id="ADQ45459.1"
FT                   /translation="MRELLLGIDIGTSACKLSVFDREGNVIFDTSKPYNIYFPQEGFVE
FT                   QDPNEWWDAVVNAINEMFAKNNIRPDEIKSIGIAGQSWSCIPVDKNGNVLSNTPIWMDT
FT                   RSSSILENICDRIDEKYIFEVSKNPLNPTYSTLKILWFKENKPDVYKNTYKFLQSNSFI
FT                   VFKLTNSFSQDLSQGYGYHFFNMEKGCYDEKAADMFKIELELLPQIYPCHEVVGYVSKK
FT                   AASITGLKEGTPVVAGGLDAACCTLGAGVIEVGQTQEQGGQAGGMSICLDRPVSNPKLI
FT                   LSYHVVPGRWLFQGGTVGGGSLRWFYEQFGYEEAETAKREGKSPFTIMDEKAERIPCGS
FT                   EGLIFLPYMAGERSPIWDRNAKGIFYGVSYKKTKAHFIRSIMEGCAYALRHNLEVAEKN
FT                   GVKIDRLYAVGGAANSKLWCQIKSDVTGKIIEVPVSDNATTLGAAILAGYGVGMFKDIS
FT                   NTIKEIVKSKAIYLPSFDNYKLYSRYYEQYLEIYERLKEIMSR"
FT   gene            696477..697766
FT                   /locus_tag="Calkro_0564"
FT   CDS_pept        696477..697766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0564"
FT                   /product="D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ"
FT                   /note="PFAM: D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ; KEGG: cce:Ccel_1008
FT                   D-tagatose-bisphosphate aldolase class II accessory protein
FT                   AgaZ"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45460"
FT                   /db_xref="GOA:E4SEH3"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH3"
FT                   /inference="protein motif:PFAM:PF08013"
FT                   /protein_id="ADQ45460.1"
FT                   /translation="MSPQNPLIGLFKNREKEFKGIISVCSSNEIVLEAVLKRMKDTNLP
FT                   IIIEATANQVNQFGGYSGLTPSQFKERVIKIAQKVDFPLERIILGGDHLGPFVWRDQEP
FT                   EIAMEYAKQMIKEYIKAGFTKIHIDTSMPLKGENSIDDEIIAKRTAVLCRIAEECFEKI
FT                   SINNPYITRPVYVIGADVPPPGGESSICQTITTKDELERSLEYFKEAFKKEGIEHVFDY
FT                   VVAVVANFGVEFGSDEIVDFDMEKVKPLKELLAKYNIVFEGHSTDYQTKENLKRMVECG
FT                   IAILKVGPALTFTLREALVALSHIEEEIYSNEKEKLSRFREVLLNTMLTCKDHWSKYFD
FT                   ENDKLIKSKLLYSYLDRWRYYFENESVKSAVYSLIGNLENVKIPPWLVSQYFPSQYQKM
FT                   RKKDLKNGAADLILDKIGEVIDHYVYAVKE"
FT   gene            698016..699068
FT                   /locus_tag="Calkro_0565"
FT   CDS_pept        698016..699068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0565"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   cth:Cthe_3208 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45461"
FT                   /db_xref="GOA:E4SEH4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADQ45461.1"
FT                   /translation="MVLTQEYTTLPRTFKHLTPYERGKICALLKEGFSPTQIAKKLGRH
FT                   RSTIYREIKRGTTTQRRTDLTTYEAYFPETGQAIYEKNRSFCGRKSKILQVESFLQYAE
FT                   QKILQDKWSPDAVVGAARREKLFDPSSMVCTKTLYNYIDRCLLKVRNIDLFIKTRRKPK
FT                   KNSLRKHKRLFGKSISERPDSIEKREEFGHWEIDTVLGRRSNDHVLLTLTERKTRYHLL
FT                   LPLASKTAEAVDEALKQLKSQYGLMFSRVFKSITADNGSEFANLNVHGIDIYYAHPYSA
FT                   WERATNERHNGLVRRLIPKGTAISELSLSQIERAQNWCNTLPRKILGYRQPAELFFREI
FT                   ERLTSEFQNS"
FT   gene            699733..702420
FT                   /locus_tag="Calkro_0566"
FT   CDS_pept        699733..702420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0566"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; KEGG: tex:Teth514_0635 magnesium-translocating P-type
FT                   ATPase; PFAM: E1-E2 ATPase-associated domain protein;
FT                   cation transporting ATPase domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45462"
FT                   /db_xref="GOA:E4SEH5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH5"
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /protein_id="ADQ45462.1"
FT                   /translation="MIKIAKKNGFTDTILTQLIEFAKKDVDEVLAQLGTDREGLTSEEA
FT                   EDRLEMYGLNEVAHEKPAPWYIQLIKAFINPFIGILVFLVIMSYITDVLFTAPQDRDWS
FT                   TIIIISIMVTVSGLLRFVQEYRSNIEAEKLKALVHMTAAVIRKDTGEREIKMEEIVPGD
FT                   IIHLTAGDMVPADVRVITSKDLFIDQATLTGESEPVEKYPDLKEEKRKAKDLNLSDLEN
FT                   ICFMGTNVVSGSAIAVVLSTGDRTYFGSMAKSLVGHRAMTSFEKGINNVSKVLIKFMAV
FT                   MFPIVFVINGLTKGNWLDALLFALAVAVGLTPEMLPMIVTTNLAKGAVTMAKHKTIVKR
FT                   LDAIQNFGAMDILCTDKTGTLTLNKIVVEKHLDIHGNEDDRVLRHAYLNSYYQTGLRNL
FT                   MDVAILEYGAEKGFNGLDKIYKKVDEIPFDFVRRRMSVVLESEGGKRQLVTKGAVEEVL
FT                   SICEYAEYKGEVVTLTDEIRQEVREMVRKLNEDGMRVLAVAQKNDVPPEGVFSVADESK
FT                   MVLMGFIGFLDPPKESAPYAIKALKEHGVDVKILTGDNEIVTKKICKEVGIAVENILLG
FT                   NEIENMTDEELAEVAEKTTIFAKLSPMQKSRIIKALQSKGHIVGYMGDGINDASALREA
FT                   DVGISVDSAVDIAKESADIILLEKSLTVLEEGVVEGRRIFGNIMKYIAITSSSNFGNVF
FT                   SVLVASAFLPFLPMQPLQLLFLNLTYDLSMTSVPWDTMDKEYIQKPRKWDAANIGNFMV
FT                   WFGPTSSIFDITTYALMFFVIGPLVIGGSYFLLPEALKLQFVSLFQTGWFVESLWTQTM
FT                   VVHMLRTEKIPFIQSIASWPLLLFTSAAVSVGTIVPFTSFGAKLGMTPLPAIYFLFLAA
FT                   TLLAYLTLAQYVKTRFVKKFGSLL"
FT   gene            702844..703895
FT                   /pseudo
FT                   /locus_tag="Calkro_0567"
FT   gene            704205..704336
FT                   /locus_tag="Calkro_0568"
FT   CDS_pept        704205..704336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0568"
FT                   /product="L-fucose isomerase 1 domain protein"
FT                   /note="KEGG: csc:Csac_1339 L-fucose isomerase; manually
FT                   curated; PFAM: L-fucose isomerase _1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45463"
FT                   /db_xref="GOA:E4SEH6"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH6"
FT                   /inference="protein motif:PFAM:PF07881"
FT                   /protein_id="ADQ45463.1"
FT                   /translation="MQNKRDEYTINFGEKRFVEDYPKVGVRSTIDGRYGGVRESLEE"
FT   gene            704460..705410
FT                   /locus_tag="Calkro_0569"
FT   CDS_pept        704460..705410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0569"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ate:Athe_0085
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45464"
FT                   /db_xref="GOA:E4SEH7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45464.1"
FT                   /translation="MESSINNNKGINWKNIWAQRYIMILVLPVVLWMIIFNYLPMLGLI
FT                   IAFKEYDPFLGPLKGFLESRWVGIDNFKEMFMDKYFWQAFWNTIYYSVLNLIVGFPFAI
FT                   LFAILLNEIQSMWYKRFVQTVSYLPYFISWVFVIGYIYIILADNGIVNDILLKLHIIDK
FT                   PIPFLVTPDFVPPIVVLSNLWKSFGWNAIIFIAAITNIDPTLFEAAIVDGAGRFARIRY
FT                   VTLPSIKPTIIILLIFNIAGIMTNYGMFEQMYLLSNGAIQDATEIIDTYTFKIGIVLSR
FT                   FSYATAVGLFRSVAAVVLLVCANSISKKLTGESLY"
FT   gene            705435..706316
FT                   /locus_tag="Calkro_0570"
FT   CDS_pept        705435..706316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0570"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_0861
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45465"
FT                   /db_xref="GOA:E4SEH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADQ45465.1"
FT                   /translation="MRIRRRSTGDIVFDILNNLFMLIIVIITLYPFYYIIISSFNDPID
FT                   LLKGPVYLWPRKFSVVNYIYIFQEKAILNATFITVARTVIGSATAVLFTAAFAYGISRK
FT                   WLIGRKLFIKMAIVTMYFSGGLIPTYLLITRFLNLAGNFLVFIIPNLFNAYNAFIMYSF
FT                   FKGIPVEIEESAKIDGANDIIIFFKLILPLSLPILATIALFNGVWHWNSWFDALLYGEG
FT                   KLETLPLYLVRAIQSATASAAEAGRFVSTTGITSTSIRLTTMVVTTFPITIVYPFLQKY
FT                   FVKGIMIGALKD"
FT   gene            706502..708184
FT                   /locus_tag="Calkro_0571"
FT   CDS_pept        706502..708184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Calkro_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_2552 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Calkro_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADQ45466"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E4SEH9"
FT                   /inference="similar to AA sequence:KEGG:Csac_2552"
FT                   /protein_id="ADQ45466.1"
FT                   /translation="MKNKYCKLISIILVFALIVSLVSIGYVYKYEVKAASSNKTTKNIK
FT                   VKYSWQKDTSPFKFDLYFFGAWGSFYRWNGTLVEKWITEATGVTPNIIVPTGDEKQYLN
FT                   VMIASNNLPDAMVLEWYAPETKRLIKAGKIYSVNELCQKYAPEFWDMIPKEVKEYHKFD
FT                   DGKLYYIPSFFTTKEEYEQGLEKHNARPLFIQRGIYKALGNPKINSTDDFLNLLRTIKK
FT                   KYPNLKPFAIEPPVDVNQWGLTGSLTLAFFAGIFAPETYGRDIYLDSKGNIKFIFENQN
FT                   FVEAVRFLNKIYREGLITSYELMMKHENYQDLVESAQYAVIARFPIDIWKQHNPKILKL
FT                   TKDEGRTYMPLPYFKYKGKNPQFAGGRGAGWVGSMVTKNAKNPGRIIRYFEYSWSDEGQ
FT                   LTNLFGKKDVTYYIDKNGMPRYKPEVLKELQEKPETLDTKYGFERRLLMWRSKWAGWQR
FT                   IAMAPKEYEDYLRSVARYGVDIWNLGLDNLDPDPTTKEGVFYAKIKNIWNKYLVQMVLA
F