(data stored in ACNUC7421 zone)

EMBL: CP002343

ID   CP002343; SV 1; circular; genomic DNA; STD; PRO; 4024382 BP.
XX
AC   CP002343;
XX
PR   Project:PRJNA43527;
XX
DT   30-DEC-2010 (Rel. 107, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Intrasporangium calvum DSM 43043, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Intrasporangium calvum DSM 43043
OC   Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae;
OC   Intrasporangium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4024382
RX   PUBMED; 21304734.
RA   Del Rio T.G., Chertkov O., Yasawong M., Lucas S., Deshpande S., Cheng J.F.,
RA   Detter C., Tapia R., Han C., Goodwin L., Pitluck S., Liolios K.,
RA   Ivanova N., Mavromatis K., Pati A., Chen A., Palaniappan K., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Rohde M., Pukall R., Sikorski J.,
RA   Goker M., Woyke T., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P., Lapidus A.;
RT   "Complete genome sequence of Intrasporangium calvum type strain (7 KIP)";
RL   Stand Genomic Sci 3(3):294-303(2010).
XX
RN   [2]
RP   1-4024382
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Chertkov O., Brettin T., Tapia R., Detter J.C., Han C., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Pukall R.,
RA   Gehrich-Schroeter G., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Intrasporangium calvum DSM 43043";
RL   Unpublished.
XX
RN   [3]
RP   1-4024382
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Chertkov O., Brettin T., Detter J.C., Tapia R., Han C., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Pukall R.,
RA   Gehrich-Schroeter G., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (17-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 535d32578391608b4612de7d486b1f95.
DR   BioSample; SAMN00713569.
DR   CABRI; DSM 43043.
DR   EnsemblGenomes-Gn; EBG00001133207.
DR   EnsemblGenomes-Gn; EBG00001133208.
DR   EnsemblGenomes-Gn; EBG00001133209.
DR   EnsemblGenomes-Gn; EBG00001133210.
DR   EnsemblGenomes-Gn; EBG00001133211.
DR   EnsemblGenomes-Gn; EBG00001133212.
DR   EnsemblGenomes-Gn; EBG00001133213.
DR   EnsemblGenomes-Gn; EBG00001133214.
DR   EnsemblGenomes-Gn; EBG00001133215.
DR   EnsemblGenomes-Gn; EBG00001133216.
DR   EnsemblGenomes-Gn; EBG00001133217.
DR   EnsemblGenomes-Gn; EBG00001133218.
DR   EnsemblGenomes-Gn; EBG00001133219.
DR   EnsemblGenomes-Gn; EBG00001133220.
DR   EnsemblGenomes-Gn; EBG00001133221.
DR   EnsemblGenomes-Gn; EBG00001133222.
DR   EnsemblGenomes-Gn; EBG00001133223.
DR   EnsemblGenomes-Gn; EBG00001133224.
DR   EnsemblGenomes-Gn; EBG00001133225.
DR   EnsemblGenomes-Gn; EBG00001133226.
DR   EnsemblGenomes-Gn; EBG00001133227.
DR   EnsemblGenomes-Gn; EBG00001133228.
DR   EnsemblGenomes-Gn; EBG00001133229.
DR   EnsemblGenomes-Gn; EBG00001133230.
DR   EnsemblGenomes-Gn; EBG00001133231.
DR   EnsemblGenomes-Gn; EBG00001133232.
DR   EnsemblGenomes-Gn; EBG00001133233.
DR   EnsemblGenomes-Gn; EBG00001133234.
DR   EnsemblGenomes-Gn; EBG00001133235.
DR   EnsemblGenomes-Gn; EBG00001133236.
DR   EnsemblGenomes-Gn; EBG00001133237.
DR   EnsemblGenomes-Gn; EBG00001133238.
DR   EnsemblGenomes-Gn; EBG00001133239.
DR   EnsemblGenomes-Gn; EBG00001133240.
DR   EnsemblGenomes-Gn; EBG00001133241.
DR   EnsemblGenomes-Gn; EBG00001133242.
DR   EnsemblGenomes-Gn; EBG00001133243.
DR   EnsemblGenomes-Gn; EBG00001133244.
DR   EnsemblGenomes-Gn; EBG00001133245.
DR   EnsemblGenomes-Gn; EBG00001133246.
DR   EnsemblGenomes-Gn; EBG00001133247.
DR   EnsemblGenomes-Gn; EBG00001133248.
DR   EnsemblGenomes-Gn; EBG00001133249.
DR   EnsemblGenomes-Gn; EBG00001133250.
DR   EnsemblGenomes-Gn; EBG00001133251.
DR   EnsemblGenomes-Gn; EBG00001133252.
DR   EnsemblGenomes-Gn; EBG00001133253.
DR   EnsemblGenomes-Gn; EBG00001133254.
DR   EnsemblGenomes-Gn; EBG00001133255.
DR   EnsemblGenomes-Gn; EBG00001133256.
DR   EnsemblGenomes-Gn; EBG00001133257.
DR   EnsemblGenomes-Gn; EBG00001133258.
DR   EnsemblGenomes-Gn; EBG00001133259.
DR   EnsemblGenomes-Gn; EBG00001133260.
DR   EnsemblGenomes-Gn; EBG00001133261.
DR   EnsemblGenomes-Gn; EBG00001133262.
DR   EnsemblGenomes-Gn; EBG00001133263.
DR   EnsemblGenomes-Gn; EBG00001133264.
DR   EnsemblGenomes-Gn; EBG00001133265.
DR   EnsemblGenomes-Gn; EBG00001133266.
DR   EnsemblGenomes-Gn; Intca_R0001.
DR   EnsemblGenomes-Gn; Intca_R0002.
DR   EnsemblGenomes-Gn; Intca_R0003.
DR   EnsemblGenomes-Gn; Intca_R0004.
DR   EnsemblGenomes-Gn; Intca_R0005.
DR   EnsemblGenomes-Gn; Intca_R0006.
DR   EnsemblGenomes-Gn; Intca_R0007.
DR   EnsemblGenomes-Gn; Intca_R0008.
DR   EnsemblGenomes-Gn; Intca_R0009.
DR   EnsemblGenomes-Gn; Intca_R0010.
DR   EnsemblGenomes-Gn; Intca_R0011.
DR   EnsemblGenomes-Gn; Intca_R0012.
DR   EnsemblGenomes-Gn; Intca_R0013.
DR   EnsemblGenomes-Gn; Intca_R0014.
DR   EnsemblGenomes-Gn; Intca_R0015.
DR   EnsemblGenomes-Gn; Intca_R0016.
DR   EnsemblGenomes-Gn; Intca_R0017.
DR   EnsemblGenomes-Gn; Intca_R0018.
DR   EnsemblGenomes-Gn; Intca_R0019.
DR   EnsemblGenomes-Gn; Intca_R0020.
DR   EnsemblGenomes-Gn; Intca_R0021.
DR   EnsemblGenomes-Gn; Intca_R0023.
DR   EnsemblGenomes-Gn; Intca_R0024.
DR   EnsemblGenomes-Gn; Intca_R0025.
DR   EnsemblGenomes-Gn; Intca_R0026.
DR   EnsemblGenomes-Gn; Intca_R0027.
DR   EnsemblGenomes-Gn; Intca_R0028.
DR   EnsemblGenomes-Gn; Intca_R0029.
DR   EnsemblGenomes-Gn; Intca_R0030.
DR   EnsemblGenomes-Gn; Intca_R0031.
DR   EnsemblGenomes-Gn; Intca_R0032.
DR   EnsemblGenomes-Gn; Intca_R0033.
DR   EnsemblGenomes-Gn; Intca_R0034.
DR   EnsemblGenomes-Gn; Intca_R0035.
DR   EnsemblGenomes-Gn; Intca_R0036.
DR   EnsemblGenomes-Gn; Intca_R0037.
DR   EnsemblGenomes-Gn; Intca_R0038.
DR   EnsemblGenomes-Gn; Intca_R0039.
DR   EnsemblGenomes-Gn; Intca_R0040.
DR   EnsemblGenomes-Gn; Intca_R0041.
DR   EnsemblGenomes-Gn; Intca_R0042.
DR   EnsemblGenomes-Gn; Intca_R0043.
DR   EnsemblGenomes-Gn; Intca_R0044.
DR   EnsemblGenomes-Gn; Intca_R0045.
DR   EnsemblGenomes-Gn; Intca_R0046.
DR   EnsemblGenomes-Gn; Intca_R0047.
DR   EnsemblGenomes-Gn; Intca_R0048.
DR   EnsemblGenomes-Gn; Intca_R0049.
DR   EnsemblGenomes-Gn; Intca_R0050.
DR   EnsemblGenomes-Gn; Intca_R0051.
DR   EnsemblGenomes-Gn; Intca_R0052.
DR   EnsemblGenomes-Gn; Intca_R0053.
DR   EnsemblGenomes-Gn; Intca_R0054.
DR   EnsemblGenomes-Gn; Intca_R0055.
DR   EnsemblGenomes-Gn; Intca_R0056.
DR   EnsemblGenomes-Gn; Intca_R0057.
DR   EnsemblGenomes-Gn; Intca_R0058.
DR   EnsemblGenomes-Tr; EBT00001724687.
DR   EnsemblGenomes-Tr; EBT00001724688.
DR   EnsemblGenomes-Tr; EBT00001724689.
DR   EnsemblGenomes-Tr; EBT00001724690.
DR   EnsemblGenomes-Tr; EBT00001724691.
DR   EnsemblGenomes-Tr; EBT00001724692.
DR   EnsemblGenomes-Tr; EBT00001724693.
DR   EnsemblGenomes-Tr; EBT00001724694.
DR   EnsemblGenomes-Tr; EBT00001724695.
DR   EnsemblGenomes-Tr; EBT00001724696.
DR   EnsemblGenomes-Tr; EBT00001724697.
DR   EnsemblGenomes-Tr; EBT00001724698.
DR   EnsemblGenomes-Tr; EBT00001724699.
DR   EnsemblGenomes-Tr; EBT00001724700.
DR   EnsemblGenomes-Tr; EBT00001724701.
DR   EnsemblGenomes-Tr; EBT00001724702.
DR   EnsemblGenomes-Tr; EBT00001724703.
DR   EnsemblGenomes-Tr; EBT00001724704.
DR   EnsemblGenomes-Tr; EBT00001724705.
DR   EnsemblGenomes-Tr; EBT00001724706.
DR   EnsemblGenomes-Tr; EBT00001724707.
DR   EnsemblGenomes-Tr; EBT00001724708.
DR   EnsemblGenomes-Tr; EBT00001724709.
DR   EnsemblGenomes-Tr; EBT00001724710.
DR   EnsemblGenomes-Tr; EBT00001724711.
DR   EnsemblGenomes-Tr; EBT00001724712.
DR   EnsemblGenomes-Tr; EBT00001724713.
DR   EnsemblGenomes-Tr; EBT00001724714.
DR   EnsemblGenomes-Tr; EBT00001724715.
DR   EnsemblGenomes-Tr; EBT00001724716.
DR   EnsemblGenomes-Tr; EBT00001724717.
DR   EnsemblGenomes-Tr; EBT00001724718.
DR   EnsemblGenomes-Tr; EBT00001724719.
DR   EnsemblGenomes-Tr; EBT00001724720.
DR   EnsemblGenomes-Tr; EBT00001724721.
DR   EnsemblGenomes-Tr; EBT00001724722.
DR   EnsemblGenomes-Tr; EBT00001724723.
DR   EnsemblGenomes-Tr; EBT00001724724.
DR   EnsemblGenomes-Tr; EBT00001724725.
DR   EnsemblGenomes-Tr; EBT00001724726.
DR   EnsemblGenomes-Tr; EBT00001724727.
DR   EnsemblGenomes-Tr; EBT00001724728.
DR   EnsemblGenomes-Tr; EBT00001724729.
DR   EnsemblGenomes-Tr; EBT00001724730.
DR   EnsemblGenomes-Tr; EBT00001724731.
DR   EnsemblGenomes-Tr; EBT00001724732.
DR   EnsemblGenomes-Tr; EBT00001724733.
DR   EnsemblGenomes-Tr; EBT00001724734.
DR   EnsemblGenomes-Tr; EBT00001724735.
DR   EnsemblGenomes-Tr; EBT00001724736.
DR   EnsemblGenomes-Tr; EBT00001724737.
DR   EnsemblGenomes-Tr; EBT00001724738.
DR   EnsemblGenomes-Tr; EBT00001724739.
DR   EnsemblGenomes-Tr; EBT00001724740.
DR   EnsemblGenomes-Tr; EBT00001724741.
DR   EnsemblGenomes-Tr; EBT00001724742.
DR   EnsemblGenomes-Tr; EBT00001724743.
DR   EnsemblGenomes-Tr; EBT00001724744.
DR   EnsemblGenomes-Tr; EBT00001724745.
DR   EnsemblGenomes-Tr; EBT00001724746.
DR   EnsemblGenomes-Tr; Intca_R0001-1.
DR   EnsemblGenomes-Tr; Intca_R0002-1.
DR   EnsemblGenomes-Tr; Intca_R0003-1.
DR   EnsemblGenomes-Tr; Intca_R0004-1.
DR   EnsemblGenomes-Tr; Intca_R0005-1.
DR   EnsemblGenomes-Tr; Intca_R0006-1.
DR   EnsemblGenomes-Tr; Intca_R0007-1.
DR   EnsemblGenomes-Tr; Intca_R0008-1.
DR   EnsemblGenomes-Tr; Intca_R0009-1.
DR   EnsemblGenomes-Tr; Intca_R0010-1.
DR   EnsemblGenomes-Tr; Intca_R0011-1.
DR   EnsemblGenomes-Tr; Intca_R0012-1.
DR   EnsemblGenomes-Tr; Intca_R0013-1.
DR   EnsemblGenomes-Tr; Intca_R0014-1.
DR   EnsemblGenomes-Tr; Intca_R0015-1.
DR   EnsemblGenomes-Tr; Intca_R0016-1.
DR   EnsemblGenomes-Tr; Intca_R0017-1.
DR   EnsemblGenomes-Tr; Intca_R0018-1.
DR   EnsemblGenomes-Tr; Intca_R0019-1.
DR   EnsemblGenomes-Tr; Intca_R0020-1.
DR   EnsemblGenomes-Tr; Intca_R0021-1.
DR   EnsemblGenomes-Tr; Intca_R0023-1.
DR   EnsemblGenomes-Tr; Intca_R0024-1.
DR   EnsemblGenomes-Tr; Intca_R0025-1.
DR   EnsemblGenomes-Tr; Intca_R0026-1.
DR   EnsemblGenomes-Tr; Intca_R0027-1.
DR   EnsemblGenomes-Tr; Intca_R0028-1.
DR   EnsemblGenomes-Tr; Intca_R0029-1.
DR   EnsemblGenomes-Tr; Intca_R0030-1.
DR   EnsemblGenomes-Tr; Intca_R0031-1.
DR   EnsemblGenomes-Tr; Intca_R0032-1.
DR   EnsemblGenomes-Tr; Intca_R0033-1.
DR   EnsemblGenomes-Tr; Intca_R0034-1.
DR   EnsemblGenomes-Tr; Intca_R0035-1.
DR   EnsemblGenomes-Tr; Intca_R0036-1.
DR   EnsemblGenomes-Tr; Intca_R0037-1.
DR   EnsemblGenomes-Tr; Intca_R0038-1.
DR   EnsemblGenomes-Tr; Intca_R0039-1.
DR   EnsemblGenomes-Tr; Intca_R0040-1.
DR   EnsemblGenomes-Tr; Intca_R0041-1.
DR   EnsemblGenomes-Tr; Intca_R0042-1.
DR   EnsemblGenomes-Tr; Intca_R0043-1.
DR   EnsemblGenomes-Tr; Intca_R0044-1.
DR   EnsemblGenomes-Tr; Intca_R0045-1.
DR   EnsemblGenomes-Tr; Intca_R0046-1.
DR   EnsemblGenomes-Tr; Intca_R0047-1.
DR   EnsemblGenomes-Tr; Intca_R0048-1.
DR   EnsemblGenomes-Tr; Intca_R0049-1.
DR   EnsemblGenomes-Tr; Intca_R0050-1.
DR   EnsemblGenomes-Tr; Intca_R0051-1.
DR   EnsemblGenomes-Tr; Intca_R0052-1.
DR   EnsemblGenomes-Tr; Intca_R0053-1.
DR   EnsemblGenomes-Tr; Intca_R0054-1.
DR   EnsemblGenomes-Tr; Intca_R0055-1.
DR   EnsemblGenomes-Tr; Intca_R0056-1.
DR   EnsemblGenomes-Tr; Intca_R0057-1.
DR   EnsemblGenomes-Tr; Intca_R0058-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002343.
DR   SILVA-SSU; CP002343.
DR   StrainInfo; 167656; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083316
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Intrasporangium calvum 7KIP, DSM 43043
CC   collection_date     :: 1967
CC   lat_lon             :: 55.753 37.604
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Russia
CC   environment         :: Air
CC   num_replicons       :: Missing
CC   ref_biomaterial     :: DSM 43043, ATCC 23552, CUB 430, IFO 12989,
CC                          IMET 7816, JCM 3097, KCC A-0097, NBRC 12989,
CC                          NCIB 10167
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemoorganotroph
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02320
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 90541
CC   Funding Program     :: DOE-GEBA 2007
CC   Number of Reads     :: 847906 pyrosequencing, 11758818 Illumina
CC   Gene Calling Method :: Prodigal 1.4, GenePRIMP
CC   Isolation Site      :: Air in a school dining room
CC   Isolation Comments  :: isolated by L.V. Kalakoutskii
CC   Motility            :: Nonmotile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 37C
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454-FLX, 454-Titanium, Illumina GAii
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4024382
FT                   /organism="Intrasporangium calvum DSM 43043"
FT                   /strain="DSM 43043"
FT                   /mol_type="genomic DNA"
FT                   /country="Russia"
FT                   /lat_lon="55.75 N 37.6 E"
FT                   /isolation_source="air in a school dining room"
FT                   /collected_by="L.V. Kalakoutskii"
FT                   /collection_date="1967"
FT                   /db_xref="taxon:710696"
FT                   /culture_collection="DSM:43043"
FT   gene            194..1933
FT                   /locus_tag="Intca_0001"
FT   CDS_pept        194..1933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterProIPR001957: IPR013317: IPR013159:
FT                   IPR003593: IPR 018312: IPR020591; KEGG: kra:Krad_0001
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; SPTR:
FT                   Chromosomal replication initiator protein dnaA; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46563"
FT                   /db_xref="GOA:E6SDW0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW0"
FT                   /protein_id="ADU46563.1"
FT                   /translation="MTGGDVDYGQIWQQTLASLGSSGVTAQERAFVRLCRLVGVLDQTA
FT                   VVKVPNAYTKDFLETRLRAQVVATLSELLGHPVHLAVSVDETLDQDDFDLITDEPTGQP
FT                   ALSESHRVAHAFGSGDPRLAQMAPLAPSGDPLKDLEASAPDLLAADFDTALPAPFAFPL
FT                   SPNGSPSDSLHLDHPHIDQMPRHLHPDQLRPDQLRYDQLRPDLRDAGQVHPLQVRGGES
FT                   GPLRQQRPEPAQASDTRLNPKYTFDTFVIGASNRFGHAAAIAVAEAPAKAYNPLFVYGE
FT                   SGLGKTHLLHAIGHYARTMFPNVRVRYVNSEEFTNDFINSIRDDKASAFQSRYRSVDVL
FT                   LIDDIQFLQGKLQTQEEFFHTFNTLHNANKQIVITSDLPPKELSGFEDRMRTRFESGLL
FT                   TDVQPPDLETRIAILRKKAIQERMSVPDDVLEYIASNFSTNIRELEGALIRVTAFSNLN
FT                   RQAVDLPLAEVVLKDVLPNETPNQVTAATIMAVTSAYYAVTIEDLCGSSRSRHLVTPRQ
FT                   IAMYLCREMTDLSLPKIGQHFGGRDHTTVMHADRKIRELMSERRAIYNQVTELTNRIRQ
FT                   QST"
FT   gene            2567..3694
FT                   /locus_tag="Intca_0002"
FT   CDS_pept        2567..3694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: kse:Ksed_00020
FT                   DNA polymerase III, beta subunit; PFAM: DNA polymerase III
FT                   beta chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III subunit
FT                   beta; TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46564"
FT                   /db_xref="GOA:E6SDW1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW1"
FT                   /protein_id="ADU46564.1"
FT                   /translation="MKFRVERDVLAEAVTWVARGVPARPPVPVLAGVLLEAAEDGTLTL
FT                   SAFDYEVSARITVPADVAEAGQVLVLGRLLAEISRNLPAKPIDISTDGTKLNVTCGSSR
FT                   FSLREMPVADYPTLPAAPEPSGTIAGDVFTQAVAQVSIAADRGDTLPILTGVRMEVEGD
FT                   KIVLLATDRYRLAMRELTWSPASPAASHVALIPARQLSETAKALGASGSVQIALGGGGD
FT                   GLIGFEAGQRQATTRLLDGEYPKVTSIFPSSVDTEAVIETAALEEAVKRVALVAERNTP
FT                   VLLKFTDGQVAIEAGTGDDAQASEAVEAVLHGPEIQIAFNPQYLLDGLHAVGQPWSRLS
FT                   FTQPSRPAVLTGQAEADSDTDASYRYVLMPVRFAS"
FT   sig_peptide     2567..2659
FT                   /locus_tag="Intca_0002"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            3881..5005
FT                   /locus_tag="Intca_0003"
FT   CDS_pept        3881..5005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="COGs: COG1023 6-phosphogluconate dehydrogenase;
FT                   InterPro IPR006115: IPR006114: IPR004849: IPR006183; KEGG:
FT                   kse:Ksed_00030 6-phosphogluconate dehydrogenase
FT                   (decarboxylating); PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase
FT                   domain-containing protein; SPTR: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; TIGRFAM: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; manually curated; PFAM:
FT                   6-phosphogluconate dehydrogenase, C-terminal domain; NAD
FT                   binding domain of 6-phosphogluconate dehydrogenase;
FT                   TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46565"
FT                   /db_xref="GOA:E6SDW2"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW2"
FT                   /protein_id="ADU46565.1"
FT                   /translation="MQLGLIGLGRMGGNMRERLRRAGHEVVGYDRNPDVSDAASLEAMV
FT                   EGLSAPRVVWVMVPSGDPTRDTVARLAELLEPDDLVIDGGNSRFTDDFENAKLLAEKQI
FT                   GYVDCGVSGGIWGLENGYGLMCGGDARWIERAMPIFDALRPEGPREEGFVHAGEVGAGH
FT                   YAKMVHNGIEYGLMHAYAEGFELLEAKDIVKDVPGTFQAWSRGTVVRSWLLDLMVDALE
FT                   ENPHLDDVSDYTNDSGEGRWTVEEAIALGVPVPVISASLFARFASRQQVSPAMQAVSAL
FT                   RGQFGGHQVMTVAEGVALREGSVPAEPSKQAKVTHDEQSFDEKGKASARAFQEASRANV
FT                   ETAGEAVEAGAPPKTQRTDAVDTALGTERSKQAD"
FT   gene            5015..6289
FT                   /locus_tag="Intca_0004"
FT   CDS_pept        5015..6289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR003395: IPR001238: IPR018078;
FT                   KEGG: kse:Ksed_00040 DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein; SPTR: DNA replication and
FT                   repair protein recF; TIGRFAM: DNA replication and repair
FT                   protein RecF; PFAM: RecF/RecN/SMC N terminal domain;
FT                   TIGRFAM: recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46566"
FT                   /db_xref="GOA:E6SDW3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW3"
FT                   /protein_id="ADU46566.1"
FT                   /translation="MHVRHLTLKDFRSYPGAEIAFSPGVTTLIGLNGQGKTNLVEAIGY
FT                   LATLGSHRVAADQPLVRFGASQAIVRGAVMSGGHETMIELEITPGRANRARLGRAPVSR
FT                   PRDVLGTLRTVLFAPEDLALVKGDPSERRRFLDDLLVQRQPRWAGVRADYDKIVKQRNA
FT                   LLKSAAPVLRPGRRGSGGGGRAAARSRPGDPPVDEARESALHTLDVWNEHLATVGSQLL
FT                   YARLRLLRDLRPDLSASYDAVSASEAGATAQYKSSLHEEAAARLAAGEVPEIPELRQSL
FT                   LDSLAAVRGAEIERGVGLVGPHRDDVVLTLGNLPAKGYASHGESWSFALGLKLAAYRLL
FT                   ARDLGDDPVLVLDDVFAELDSGRRERLAELIGDCEQVIITAAVGADVPVQLRERGHTYE
FT                   VELGQIHALPTPTPAGPAEEDGSDA"
FT   gene            6399..6932
FT                   /locus_tag="Intca_0005"
FT   CDS_pept        6399..6932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="COGs: COG5512 Zn-ribbon-containing possibly
FT                   RNA-binding protein and truncated derivatives; InterPro
FT                   IPR007922; KEGG: kra:Krad_0005 protein of unknown function
FT                   DUF721; PFAM: protein of unknown function DUF721; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46567"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW4"
FT                   /protein_id="ADU46567.1"
FT                   /translation="MPAGDAPADDTRIADAAASALARARAAARSKGLRPGMKPRRRPRA
FT                   DDPAQVRSGAGRDGRDPALLGEQLDRLLVDRGWQLDVAVGSVMGRWPEIVGPDIATHVE
FT                   PVSFADGILTVRADSTAWATQMKLLASSVLGRVEAEIGAGAVDQLRVLGPSAPSWSRGR
FT                   HRSPDSRGPRDTYG"
FT   gene            7081..8604
FT                   /locus_tag="Intca_0006"
FT   CDS_pept        7081..8604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0006"
FT                   /product="peptidase M4 thermolysin"
FT                   /note="COGs: COG3227 Zinc metalloprotease (elastase);
FT                   InterPro IPR013856: IPR001570; KEGG: cms:CMS_1343 putative
FT                   metalloprotease; PFAM: peptidase M4 thermolysin; Peptidase
FT                   M4 thermolysin; SPTR: Metalloprotease; PFAM: Thermolysin
FT                   metallopeptidase, alpha-helical domain; Thermolysin
FT                   metallopeptidase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46568"
FT                   /db_xref="GOA:E6SDW5"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW5"
FT                   /protein_id="ADU46568.1"
FT                   /translation="MHPATESPEPLASEARCSIVPPYILEALARSSEPAVADAARTSLA
FT                   HDEAIRRARRSGRRLAPPRDVNEPGPPAPSGPQAPTDPTQPTEPTEPSPPLGTGPRRTI
FT                   GDAQGKRTLPGETVRPEGDPATGDPAVDEAYDGLGATWGLWSAAYGRDSLDDKGMPLIA
FT                   TVHYGQRYDNAFWDGRQMVFGDGDGIVFDRFTKSLDVIGHELAHGVTEHTAGLLYQGQP
FT                   GALNESVSDVFGVLVKQRALGQTASEADWLVGAELLLPSVQGRALRDMRKPGTAYDDPE
FT                   LGKDPQPAHMDGYVVTDSDFGGVHINSGIPNRAFVLAALAMGGHAWEEAGAIWHAALTG
FT                   DGIRADCDFARFAELTVAAAAERHGYGSVQHSAVRDAWLEVGVPVGSDEPASSAEADEA
FT                   AGPPSGPAHGEVPGVDAEVLVRRTGGFAGRVRERTVTIGDLPERDARDWQHLLAAPTLQ
FT                   RIAATAGRSHPDAFCYDVVCPQAHVDVTVAEPHLPEAIHQLLERTLEDG"
FT   sig_peptide     7081..7197
FT                   /locus_tag="Intca_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(8714..10039)
FT                   /locus_tag="Intca_0007"
FT   CDS_pept        complement(8714..10039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ske:Sked_09010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46569"
FT                   /db_xref="GOA:E6SDW6"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW6"
FT                   /protein_id="ADU46569.1"
FT                   /translation="MNTTDPRLKDLFAERSQRVHVVGDLAERAIARDRANRRREVTTAV
FT                   AVGAVALAVAVPVGWNATRPDSVRPVPAVSTSGGLTSTEPAPSPSQSTSQSTTTDQPTD
FT                   RPTSIPTITLSGAPAPATLAPSADPSGPAGDTAVAYVIDGELHDGLSRITLPDALARPA
FT                   QVARLADRLVLLVTDDGVTVVDASGAVLTDLPGGRAVAVSSDRTHFILTGDTGDLTYHD
FT                   ARGRQLAQLPAATCKCGSDGGAPSAYQAAVGLVGTTAYAAKGYTGTTVAWDVETGATKD
FT                   LPGQFRMVDSERAVAVVQIGGATGENPCYDLRDLATNARRWRVCGPVLMQSFSLDGQYV
FT                   VGTGAVDGLRSSVTYPTVLVWRTTDGELLLESGDPTGPGPWSVSARAATGQDIAVQVGH
FT                   EDGTRSLQRCTLEGRCEVIAPARPRWQSDIPEGDDPYILATN"
FT   gene            complement(10036..10545)
FT                   /locus_tag="Intca_0008"
FT   CDS_pept        complement(10036..10545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0008"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014325: IPR014284; KEGG:
FT                   nca:Noca_3654 sigma-70, region 4 type 2; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   Sigma-70, region 4 type 2; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   RNA polymerase sigma-70 factor, sigma-E family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46570"
FT                   /db_xref="GOA:E6SDW7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW7"
FT                   /protein_id="ADU46570.1"
FT                   /translation="MDDAARSADFTAYVRAREQALARLAYLLTGDRDAAEDLLQNALAK
FT                   CYRHWDRIRAVEQPDAYVRRVMVNERNSRWRSLLRRRESAGSHLLEVFDPPATSVGLDP
FT                   GESLDLWRHVQTLPTQQRAVVVLRFYEDLTEAQTAAILGCTVGTVKSHTSRALAAMRLK
FT                   MSEAPA"
FT   gene            10916..13030
FT                   /locus_tag="Intca_0009"
FT   CDS_pept        10916..13030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0009"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR003594: IPR013506: IPR006171: IPR002288: IPR
FT                   011557: IPR001241: IPR018522: IPR000565; KEGG:
FT                   kse:Ksed_00060 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; PRIAM: DNA topoisomerase (ATP-hydrolyzing); SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein; SPTR: DNA gyrase subunit B; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46571"
FT                   /db_xref="GOA:E6SDW8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW8"
FT                   /protein_id="ADU46571.1"
FT                   /translation="MSDAAETTADSTNRPNVDHRPNGVDYDASAITVLEGLEAVRKRPG
FT                   MYIGSTGERGLHHLVYEIVDNSVDEALAGYADTIDITLLADGGVRVKDNGRGIPTDIHP
FT                   VEKMSAVELVLTQLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTTLKVAVRQKGYVHRM
FT                   SFTMGVPDGPLRREEATDETGTTITFWPNAEIFDSVDFDFETLRARLQQMAFLNKGLTL
FT                   NLVDERVDQRAEASEDVDLDGVESDLATVVEDGDNGHDVPTSGRKTLTAKTATYRYDGG
FT                   LVDYVNHLNSSKRSEPVHPEVIAIEVEDEARSLSLELAMQWTSAYSESVHTYANTINTH
FT                   EGGTHEEGFRAAMTKLINDFARKQNLLKEKDENLTGDDVREGLTAVISVKLGDPQFEGQ
FT                   TKTKLGNSEVKGFVQRAMTDEFGHWLETHPNEGKDIVRKSIQAAAARMAARKAREATRR
FT                   KGLLESGGLPGKLKDCQSKDPSLSEVFIVEGDSAGGSATQARNPHIQAILPIRGKILNV
FT                   EKARIDKILANQEVQALISAFGTGIGEDFDLAKARYHKIILMADADVDGMHIRTLLLTL
FT                   LFRFMRPLIEAGYVYLAQPPLFRLRWSNAPHQFAYSDRERDGLTELGKANGWRLPKDNP
FT                   VQRYKGLGEMNYQELGETTMDQSTRTLLQVTLDDAAKADEVFAVLMGEDVESRRTFIQK
FT                   NARDVRFLDI"
FT   gene            13179..15890
FT                   /locus_tag="Intca_0010"
FT   CDS_pept        13179..15890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0010"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit; InterPro
FT                   IPR002205: IPR006691: IPR005743; KEGG: kse:Ksed_00070 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: Putative DNA
FT                   gyrase subunit A; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   domain, beta-propeller; TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46572"
FT                   /db_xref="GOA:E6SDW9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW9"
FT                   /protein_id="ADU46572.1"
FT                   /translation="MSDDLPPVDGDDILGPDETQPTEVDESHEQGTAPIERDPDQHDRV
FT                   EPIDLNTEMQRSYIEYAMSVIVSRALPDVRDGLKPVHRRIVYAMYDGGYRPDRGYNKCA
FT                   RVVGDVMGHYHPHGDSAIYDALVRLVQDWSMRYPLVDGQGNFGSRGNDGAAAPRYTECR
FT                   MASIALEMVRDIEQDTVDFIPNYDGKTMQPSVLPSRFPNLLVNGSAGIAVGMATQIPPH
FT                   NLREVAEGAQYYLHHPEISREELLEALLGIIKGPDFPTGSLIMGHRGIEDAYRTGRGSI
FT                   IMRAIVNVEEIKNRQCLVVTQLPYQVNPDQLAVKIADLVKDGKIAGIADIADETSGRTG
FT                   LRIVITLKRDAVAKVVLNNLYKHTQLQTTFGANMLALVDDVPRTLPLDGFIRHWVDHQI
FT                   EVIQRRTTFRLRKAEAEIHLLRGYLKALDMLDEVIALIRRSQTVEDARDGLIQLLDIDE
FT                   TQAQAILNMQLRRLAALERERIQQQHDELQELIDEYQAILASEVRQREIVSEELQGIVD
FT                   KYGDERRTEIVPFDGDMSMEDLIPEEDVVVTITRGGYAKRTRTDLYRSQRRGGKGVKGA
FT                   QLRGEDVVEHFFTTTTHHWLLFFTNLGRVYRAKGYELPEGSRDSKGQHVANLLAFQPGE
FT                   QIAQVLAIHDYEAADYLVLATRAGLVKKTRLRDYDSPRSGGLIAINLREGDELVGARLV
FT                   AAADDLLLVSRKGMSVRFTATDSALRPMGRSTSGVTGMKFRPGDTLLSMSRVPAETDVD
FT                   VFVVFENGLAKRTPVSEYRVQGRGGYGIQVAKLSEKGGDLVGALTVTGNDEVMVVMEKG
FT                   KIVRSRVDEVRHTSRSTQGVRFAAPDKGDAIVAVARNAESVTEEELEEVGDLEGTAPTS
FT                   PITTVPSTDGVPSDGSDEPTTESSDGDTGGDA"
FT   gene            15887..16534
FT                   /locus_tag="Intca_0011"
FT   CDS_pept        15887..16534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_0008 hypothetical protein; SPTR:
FT                   Putative integral membrane protein; PFAM: Transmembrane
FT                   domain of unknown function (DUF3566)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46573"
FT                   /db_xref="GOA:E6SDX0"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX0"
FT                   /protein_id="ADU46573.1"
FT                   /translation="MSTPSSEGWGASRYGSDTDSLDYTGSGSADGESTLSRGAITSRTE
FT                   PTRAMGAQPTTATHPESVTTASQPAGDSTRAATAIAPARGKQATRSKKGPRRVRLAVAR
FT                   VDPWSVMKMSFLLSVALGIAGVILTAVLWMILSTMNVFTDIEGVLQSLQTAGSADNFSI
FT                   RDYVGFGRVVSLSIVIGVIDVILLTAIATVMAFLYNICSALVGGIQLTLTDD"
FT   gene            16630..16706
FT                   /locus_tag="Intca_R0001"
FT   tRNA            16630..16706
FT                   /locus_tag="Intca_R0001"
FT                   /product="tRNA-Ile"
FT   gene            16735..16920
FT                   /locus_tag="Intca_0012"
FT   CDS_pept        16735..16920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsa:RSal33209_0010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46574"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX1"
FT                   /protein_id="ADU46574.1"
FT                   /translation="MLKRLALIAGAVASVAFIRKKARQQQAEQDLWNQATDDVKAQAPA
FT                   PAPSPAADQDLTAATS"
FT   sig_peptide     16735..16857
FT                   /locus_tag="Intca_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            16944..17019
FT                   /locus_tag="Intca_R0002"
FT   tRNA            16944..17019
FT                   /locus_tag="Intca_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(17096..18301)
FT                   /locus_tag="Intca_0013"
FT   CDS_pept        complement(17096..18301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0013"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: fra:Francci3_4274 phage
FT                   integrase; PFAM: integrase family protein; SPTR: Integrase
FT                   family protein; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46575"
FT                   /db_xref="GOA:E6SDX2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX2"
FT                   /protein_id="ADU46575.1"
FT                   /translation="MARRHNGEGTIYPYRNGYAAQVWVYTPEGRRQRKTVYGKTREIVH
FT                   EKWLALHAQARRGPVSPRTPKVDEFATGWLRDVVTPNLAPATVANYELFVRHYISPAFG
FT                   SKRLDRLGVRDVQVWLNELKHTCQCCAQGKDAAREVPRCCAKGKCCGQVASEWTIHQAW
FT                   TVLRSLLSSAMREELVSRNVAGLVRVPVPRAKKPAVWTVDQARQFLESARRDDDPLYAG
FT                   YVLMLILGLRRGELLGLAWDDVDLELGEARIAWQVQRVKGQLLRRKTKTTSSDAPLPLP
FT                   EICVSALEQRRVVEAKWRLAAGEAWAGAGLVMTTRLGDPLDPRNFHRYFKARATKAGVP
FT                   VISVHATRRTCASLLVALDVHPRVAMAILRHSKIAVTMDIYSQVSSTSTREALKRLGEA
FT                   FG"
FT   gene            complement(18301..18504)
FT                   /locus_tag="Intca_0014"
FT   CDS_pept        complement(18301..18504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0014"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR010093; KEGG: saq:Sare_1579 DNA binding
FT                   domain-containing protein; SPTR: DNA binding domain,
FT                   excisionase family; TIGRFAM: DNA binding domain protein,
FT                   excisionase family; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46576"
FT                   /db_xref="GOA:E6SDX3"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX3"
FT                   /protein_id="ADU46576.1"
FT                   /translation="MTTYEIKRRWHTVAEVAEMLGYGETKVRMAIIAGDLKSVKDGKLR
FT                   RILPEWVDEYVALKVAESERNL"
FT   gene            complement(18510..20045)
FT                   /locus_tag="Intca_0015"
FT   CDS_pept        complement(18510..20045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0015"
FT                   /product="replication initiator protein"
FT                   /note="KEGG: fre:Franean1_5522 replication initiator
FT                   protein; SPTR: Replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46577"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX4"
FT                   /protein_id="ADU46577.1"
FT                   /translation="MKSSMFEPEVVQELALKEGVCVRPLLNRVTDRQTGDTTVVVMPCR
FT                   STRESRCPSCANAARRLRIQQCAEGWHLDQEPTGPEQEPEAATDELEEEEDVVDEEEVP
FT                   ERRVRSTRRRSDVADLPLKPTENRTIGAVFEGNLGRRYRPSMFVTLTLPSYGSIATGRG
FT                   VPIDPSSYDYRTAALDALHFTKLLDRWIQNLRRCAGFKVQYFGAIEAQRRLAAHFHVAL
FT                   RGAIPRSILRKVTRATYAQVWWPSCDEPVYVDRVPVWDGVDYLDPDTSIPLTTWEDAMA
FT                   ELDEDPHAKPAHTLSFGRQVDIKGLLGGTPDADRSVRYLTKYLTKAVAETYTQAEVFDA
FT                   EYEAHIDRLHDEVRYLPCTPSCANWLRFGIQPKQAGPGLQPGRCSSAAHDRENLGVGGR
FT                   RVQVSRGWSGKTLSDHRADRAAVVKKVLEEAGYTAPDADRMSAETLATDGEPRYLWQTV
FT                   HLPPQKASEAIITSVLERRRWRNEYDRAKAAQVSTGPPVENHSATDGEVEREE"
FT   gene            complement(20042..20422)
FT                   /locus_tag="Intca_0016"
FT   CDS_pept        complement(20042..20422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0016"
FT                   /product="transcription factor WhiB"
FT                   /note="InterPro IPR003482; KEGG: kra:Krad_4662
FT                   transcriptional regulatory protein WhiB-like WhiB2; PFAM:
FT                   transcription factor WhiB; SPTR: Regulatory protein; PFAM:
FT                   Transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46578"
FT                   /db_xref="GOA:E6SDX5"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX5"
FT                   /protein_id="ADU46578.1"
FT                   /translation="MRGQVNAGVFLHRYGRADDTINHGDGPSPDELLRAKWMRAGSCRG
FT                   DEKYRWFGQPNTLKSLRAAAICRECPVRQMCLASALVFGEEFGVWGGLNPVERRPLHRR
FT                   LALGETLGSVLRSVLNGERRAA"
FT   gene            complement(20419..21846)
FT                   /locus_tag="Intca_0017"
FT   CDS_pept        complement(20419..21846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0017"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="COGs: COG1674 DNA segregation ATPase FtsK/SpoIIIE
FT                   and related protein; InterPro IPR002543: IPR003593:
FT                   IPR000408; KEGG: fra:Francci3_4272 cell
FT                   divisionFtsK/SpoIIIE; PFAM: cell divisionFtsK/SpoIIIE;
FT                   SMART: AAA ATPase; SPTR: Cell divisionFtsK/SpoIIIE; PFAM:
FT                   FtsK/SpoIIIE family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46579"
FT                   /db_xref="GOA:E6SDX6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX6"
FT                   /protein_id="ADU46579.1"
FT                   /translation="MSTRGQARSALFDSDDLLAVALEAVVLGVLGVFRALWAALVMAVR
FT                   FPAAAVPLLLVVAAGVLLGSKGVALVLVMLAALLGAWRLKAPSSFSRHVSDRSAFMVRN
FT                   AIYRLRWTGVARRTDLVAHDGRLGRGRDPELVALLRVRPTTAGSDRLLLRLPTGLTPDD
FT                   VAGKADAIAHAFRSEAARIHPDRPGRVWLELRRADQLAAPILPLPQSDKLDLAALPVGH
FT                   AEDGSTWHLRLAGTHLLIAGATGAGKSSVLWSMLRALTRGIRQGLVEVWAVDPKGGMEL
FT                   RPGRALFARFEDSTPEDMCVVLEDLVVLKDSRAKQLAESGQRSHVAGAGSPHIIALLDE
FT                   LATLTAFADRAVTRRIDTALGLLLTQGRACGITVVAAVQDPGKDIVGWRDLFPTRVAMR
FT                   LDNPLQVAMVLGDGAREMGAKADEISELTPGVAFVRVEGTRQIKRVRAAYVNDNAIAEL
FT                   AAQISVSDEQNQREEVQ"
FT   gene            complement(21843..22097)
FT                   /locus_tag="Intca_0018"
FT   CDS_pept        complement(21843..22097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0018"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46580"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX7"
FT                   /protein_id="ADU46580.1"
FT                   /translation="MRANDVQAWCDFLEAPRDELHAEMVRLYREACDAQAVLERFAMRF
FT                   KDAPSTDLRVQHRILSHAMSAIVIEIGMQRRELWRARTP"
FT   gene            complement(22097..22345)
FT                   /locus_tag="Intca_0019"
FT   CDS_pept        complement(22097..22345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:508547 phosphodiesterase 4D interacting
FT                   protein; SPTR: PDE4DIP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46581"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX8"
FT                   /protein_id="ADU46581.1"
FT                   /translation="MRTVDTVAWTESLGVHPGLLERAMNERLRRMQDAEEDLRGLYNAM
FT                   KEAPDEEMVLSLRSANRSLTQAVECMEACIRLVRRAT"
FT   gene            complement(22375..22833)
FT                   /locus_tag="Intca_0020"
FT   CDS_pept        complement(22375..22833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_4843 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46582"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX9"
FT                   /protein_id="ADU46582.1"
FT                   /translation="MAIARKLKISHDEVFPHGAYLVSEVTPVVDYDRSTKDNKVQQLDK
FT                   ETGLPMWTVDVLDADPEATKKNRTVSVKLIAKVQPVPPASDGSSPFTRVVFDGLTATPW
FT                   TDTSKCKPPEPGRGHRCGAQNAWSLRADGMSAPGKSAPAPNPSPNKAA"
FT   gene            23320..23652
FT                   /locus_tag="Intca_0021"
FT   CDS_pept        23320..23652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1746 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46583"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDY0"
FT                   /protein_id="ADU46583.1"
FT                   /translation="MNIDRMLGIAVRTSADFGDGAWTPGMPLQQGWLWAGTVEGDTVLA
FT                   FELGPGRVLFGFTPDELRSVRKVASGFNTVVECVVAEENGSPRTFTLVGPRGRIKKAFQ
FT                   HIGKPI"
FT   gene            23708..24142
FT                   /locus_tag="Intca_0022"
FT   CDS_pept        23708..24142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbr:Tb11.02.3740 receptor-type adenylate
FT                   cyclase GRESAG 4; SPTR: Receptor-type adenylate cyclase
FT                   GRESAG 4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46584"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI3"
FT                   /protein_id="ADU46584.1"
FT                   /translation="MTIDCTNSRPALNDSKAPIVLKFHVPMRRDTLNILNIIYKNVEFV
FT                   RMGVSADVNRALVSAKEGQPIDGMRGAVVTNLVGDKDYESLRFLFKVATDTDLGKLLVA
FT                   LGVDPATDFDQYTRGVAADFAVFERLMANPPKKQGFFGKW"
FT   gene            complement(24198..25412)
FT                   /locus_tag="Intca_0023"
FT   CDS_pept        complement(24198..25412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0023"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: sro:Sros_4222 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Antibiotic transporter; PFAM:
FT                   Bacterial protein of unknown function (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46585"
FT                   /db_xref="GOA:E6SEI4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI4"
FT                   /protein_id="ADU46585.1"
FT                   /translation="MEREEAVEVPAGRGLGRLLASTSVSIAGQGMVLAAVPLLAARLTD
FT                   DPFQVSLTVAATYAAWLVVGLPAGALVDRWPRRRTMVVADLVRALIIGGLGLAVVAGVA
FT                   QIWLLILSVFLLGVASCFFDPAAQAAIPAVVGRDSKVLATANARIWSLDLMGRSLIGPP
FT                   AGAALFVVAAGLPFVANAATFILSAMFLAGLGSLQPATARDGRPRLLASVKEGIHYLAR
FT                   HRELRTLTIGMASFNFVYNTANATFVLFAMDQLGVSEQGFGLLLASAAVGGLVAGYVVP
FT                   KFKSKVSATNLYGVGLAVQGLGWLAVLAAPNPWVAAIAVAAVGGTSMAVTVLGAVARQR
FT                   LTPDLMLGRVSATTRVAGIGSGALGALTGGLVASQLYIDAALWAAFITACLISVTLWMS
FT                   KSAEH"
FT   sig_peptide     complement(25311..25412)
FT                   /locus_tag="Intca_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(25421..25642)
FT                   /locus_tag="Intca_0024"
FT   CDS_pept        complement(25421..25642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0024"
FT                   /product="protein of unknown function DUF397"
FT                   /note="InterPro IPR007278; KEGG: tbi:Tbis_0235 hypothetical
FT                   protein; PFAM: protein of unknown function DUF397; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF397)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46586"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI5"
FT                   /protein_id="ADU46586.1"
FT                   /translation="MKPDWNTAAWRKSVISDTGACVEVAHSAGMVGVRDSKARGQGSIL
FT                   EFTEAEWRAFTGGVRNGEFDYDELRKSG"
FT   gene            complement(25664..26587)
FT                   /locus_tag="Intca_0025"
FT   CDS_pept        complement(25664..26587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0025"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: fre:Franean1_0907
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: DNA-binding protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46587"
FT                   /db_xref="GOA:E6SEI6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI6"
FT                   /protein_id="ADU46587.1"
FT                   /translation="MTVQTDPLRGSQRLSSRFPVLAGYIVVLFITAWKDAMIEVGAELR
FT                   RIREAAGISGSAVARDLGWSQSKISRVETGRFGASVSEVAELLNYYGVAEEVRAEILGS
FT                   VARSSGLEGAWIVSAGGAPRRQAAVEAVETRVKRLRQYQASWIPGLLQTEAYTRGICEA
FT                   AGLNAEAVVGQRLERQRLLGERHGVRYDVVLDEAVLRRSPRTTGADMTSQLERLLERIE
FT                   EGYADLRVVPLGSTNATYVAGSFVLYEFKAGTPVVLVEAQTADLYLSAERDITAYERLF
FT                   EQLRKDALDVDESRRAIESARRDWAS"
FT   gene            complement(26584..27282)
FT                   /locus_tag="Intca_0026"
FT   CDS_pept        complement(26584..27282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_0838 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46588"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI7"
FT                   /protein_id="ADU46588.1"
FT                   /translation="MAENHANDFDAKFAALVAGLEPVCEALTPSAAGRPAILTDRLIPT
FT                   QPTPRGLRARFLMTSLDHEAGLTAYGWRDSLRVVSYAPPHAHGLDELGVVLQEEADFYS
FT                   GNSERRVVVGLSRVWIEKLVIIDEYAPTAAAPDAWLENAITDPNLSRIEPLQRVARQHH
FT                   LVGTRVTLDLEDGYFEEDLRAVSPVQLGSGGDLVVGVVTERDWYTWAQHSYGPGERVVR
FT                   VVPIERLWVQ"
FT   gene            complement(27275..28366)
FT                   /locus_tag="Intca_0027"
FT   CDS_pept        complement(27275..28366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0027"
FT                   /product="NLP/P60 protein"
FT                   /note="COGs: COG0791 Cell wall-associated hydrolase
FT                   (invasion-associated protein); InterPro IPR000064; KEGG:
FT                   sco:SCO3511 lipoprotein; PFAM: NLP/P60 protein; SPTR:
FT                   NLP/P60 protein; PFAM: NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46589"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI8"
FT                   /protein_id="ADU46589.1"
FT                   /translation="MPAPVALAATLAKKLLWRRIRRVAYIALPLVGSGLLGASNEQSGM
FT                   PSKGGACPGAELSDKDVPGLTGEQTRNARTIVAVGRDLNVPSYGWVIAVATAMQESSLV
FT                   NIPHGDRDSVGLFQQRAAWGSTADRMDPVQSARMFYTGGRGGEPGLLDIAGFESVRLTE
FT                   AAQAVQRSAFPSAYAKWEALAVQVVGEPSVIASACYSAASAMDGSAGGEAVRAALRWLG
FT                   TPYSWGGGTINGPGEGFGRGAGIVGFDCSSLTQYAWHQAGASIPRVASAQAAALPSVGL
FT                   DPAGWRAGDLVFFHAPGDPATFFHHVGMYDGQGGMIHAPRTGLTVEVVHDFLSQPYWRN
FT                   ELAYVGRPAVSQELPVVAGARHG"
FT   sig_peptide     complement(28214..28366)
FT                   /locus_tag="Intca_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(28368..28982)
FT                   /locus_tag="Intca_0028"
FT   CDS_pept        complement(28368..28982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1188 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46590"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI9"
FT                   /protein_id="ADU46590.1"
FT                   /translation="MSDNLNRALRWPLWSWRNLAITVVSLFVAIALIGRVSSALGGDGE
FT                   APIKAASTAVPEGTQSPPAVTPSTGPLVSPAQTPTADLAAGPGTDCLSNAAQFVDEWMQ
FT                   TKRSQQLWLARMAPYATPAFLEELRSVDPANVPATTVEGEPQLVGQDGDLPIARITTDG
FT                   GRLDLVLARSGSTCVVSDIRSSDDVPGAPTPVLTATPKAGG"
FT   sig_peptide     complement(28869..28982)
FT                   /locus_tag="Intca_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(28975..31014)
FT                   /locus_tag="Intca_0029"
FT   CDS_pept        complement(28975..31014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4736 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46591"
FT                   /db_xref="GOA:E6SEJ0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ0"
FT                   /protein_id="ADU46591.1"
FT                   /translation="MAGKRLVRTGPTRLVGRLLIVLFFSIVAGVAVGSEAIATPALPAA
FT                   PWDCKDAPIAAMPDSGLPGFFDPAPDPIPPQGDPFAATRSTTVYDQYGYAGLSWSTYDL
FT                   GCGGAVRDIEATTDTFLGNFFFSGATWMASATNGIHNKVAHPDEYMAPLDVVVGTVTQR
FT                   MHERIWSPWGMVAFLGVAALLLAYSLRGHLSSVMTAAAWALLVVAVLSGISQYPTRTAS
FT                   FFDETVTQSIASINQTSAGLTPSAGADPTRAQGALIVDDVLYQAWLRGQFGDPNSAAAQ
FT                   KWGPVLFRESTFSRTEAATASSTPDGIQKMTEQKANDWVTTTQEIQEQDPIAYAAVQGK
FT                   SKGRAGAGFMAFIGVLFTGLFRLVADLFMFAGLVMLRLLVMFFPAAAVFGVLAPMASIV
FT                   RRIGNIAGASVINVIAFGAGSAIHTVLIAAILFRADGAGMGVLSFVLCLVVTVAAFIML
FT                   MPLLSLTNVLGRPSSTQTLLRRAGRRVRRRHLRRGRHGEGDDDDDEEEDESEEDEDEEE
FT                   APRRRSGRRRRRSARRTRPPVEAFGRPATVPLSAPVSAGDPGVHTTDGRDAGHSLPAAS
FT                   RKSGVPVNAQGSADLRPPTESPAPSGGHGVHRPSTAETPHTRDRVVVGVLVDELPTEIR
FT                   ETPATRIHDSHTEVRPDGVGPRLYDPATKQTVLPEAHSRGVADE"
FT   sig_peptide     complement(30907..31014)
FT                   /locus_tag="Intca_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(31014..33530)
FT                   /locus_tag="Intca_0030"
FT   CDS_pept        complement(31014..33530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1595 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ1"
FT                   /protein_id="ADU46592.1"
FT                   /translation="MSGKSGLAIRRISGHCTITGDKLMAWYLLDPQGWSFRPDGVREQL
FT                   IVDGADVFGQLVRREIHLRVTTRPYPVARWAADHDANAPAPLPAWRDHLITDQRRLASL
FT                   SMADKEVYLGVEIPTRSPVYKALGSFWGSMSDREVAALSGHVRATDELMASPGIEAAPA
FT                   TPRQLEWLLHRSCSLGLPAPVTLGASDLEAWETEDLHEFTDHVRWFALPYGRTIRVVGE
FT                   HDDERIERHVCVLSVGRMTDLEIPPGIPWMQRTDQLPFPVEWSGRVRIEDAAKVGAALR
FT                   QNIQKIRAQRDHYEVEHQEPAPGALDRQAARALTVEDEISMGLSGLSTRTSGWYRIAVS
FT                   APTEDEAIQRAGVIRKLFAPQITIARPHDQYAVAREFIPGERLSTTAFRRRMPVTTLAA
FT                   AVPAATAKVGDRIGIHLGETSGTSSRVVTWEPWLATERGEESGLAVLCAGLGGGKSTAG
FT                   GNIIYRTVIQGVPWTVLDPSGRLTALCRLPELEQYSRAIDLLDAAPGSLGTYRVIAEPR
FT                   RDHYAEESEFRAAKEQAQDTRRLLTNSVLRAMLPRQLQEHVLTEVALLRAVGRVPANAW
FT                   SACDQVVTELATLEGDEALVRHAGYMADFLREAAKTSHGRLVFPAGKALDTSSEEPLLT
FT                   VYSLRGLALPDESTAGSEDLDERLSMCVMYLAAWLTQRGMYFGDINARKGIFIDEAWAL
FT                   STFSTGRRFIDRAARDSRKHNTRVLMASQNPSDLLKLDLANLSSAAFIGRLTGEEAQRD
FT                   ALRFIPGIRDGLGYEQIFGTLSRPSRDGLRGPREFVFSDGNGGIERIRMDLSAHPHLLD
FT                   ALNTTAEPLKARNRAARELDDEKASA"
FT   gene            complement(33527..33979)
FT                   /locus_tag="Intca_0031"
FT   CDS_pept        complement(33527..33979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0885 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46593"
FT                   /db_xref="GOA:E6SEJ2"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ2"
FT                   /protein_id="ADU46593.1"
FT                   /translation="MRLPVDDEIYNVNAVWLGPPNRTLPFRARYVAYAVGAVVFLLLQV
FT                   IERRLGIDLGFFSLAYSLLATVALTRLILSVVNPDRPLASVLGAFVHEVSAPRQESRVA
FT                   THTIRPARVRAVPARLSRAQRRLAKKSPAIAGVTATDLGDYQEVAT"
FT   sig_peptide     complement(33896..33979)
FT                   /locus_tag="Intca_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(33984..34235)
FT                   /locus_tag="Intca_0032"
FT   CDS_pept        complement(33984..34235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0884 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46594"
FT                   /db_xref="GOA:E6SEJ3"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ3"
FT                   /protein_id="ADU46594.1"
FT                   /translation="MHTLETLATAAGTTGLQGWIKANIIPLLLLLIATMLFVLAQRGDN
FT                   AKAMRVVSGVIIALAVLGLATSGKADSLGSWMASLITG"
FT   sig_peptide     complement(34092..34235)
FT                   /locus_tag="Intca_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(34616..35818)
FT                   /locus_tag="Intca_0033"
FT   CDS_pept        complement(34616..35818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0033"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="InterPro IPR003346; KEGG: mgi:Mflv_1197 transposase,
FT                   IS111A/IS1328/IS1533; PFAM: transposase IS116/IS110/IS902
FT                   family protein; SPTR: Transposase, IS111A/IS1328/IS1533;
FT                   PFAM: Transposase IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46595"
FT                   /db_xref="GOA:E6SEJ4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ4"
FT                   /protein_id="ADU46595.1"
FT                   /translation="MELFCGIDWAEHHHDVALVNAGGDVLATFRISDDPAGFARLVSRI
FT                   GRHTMVLGSVGVALETDRGLLVAALREIGVQVFSINPKSVDRYRDRFAVSGAKSDAGDA
FT                   LVLAHLLRTDARQHRQIANDSQQVLALSALSRAHQDAVRTRLRDAGRLRSHLREYYPAA
FT                   LTAFPCLTTRTALGVLWEAPTPMAARQLSADDLRRLGRMAGRVSMPATVVNRLLTVFAE
FT                   PQLRHPPAVEEAMGAATRTILATLRATEEAVQRAEDELVEAFARHPQAGIVASLPGVGP
FT                   ILGARLISEFGDDKTRYVNAAARRRYAGVAPVTRASGKSRVVLMRRARNDRLFDTCRMW
FT                   AFNAIGKSAGADAYYRARRAKGEHHEAALRRLGSKLLGQLHHCLEDVIPYSEELAWAPT
FT                   P"
FT   gene            36223..37614
FT                   /locus_tag="Intca_0034"
FT   CDS_pept        36223..37614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgo:TGME49_020220 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46596"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ5"
FT                   /protein_id="ADU46596.1"
FT                   /translation="MRHTRVGGLEVIHRLGQLGAALGYEVREEHRVGRSAAVDLSWTAA
FT                   ASNDAPLFVFEVESTPSTGLANNALKVYGSPLEELVKPLFFFHLVLSGGQDNERIRNAQ
FT                   RLFGQHNYRIYRLTDGTPAPDLALDILRQHRRVSRNLDLWSTATALMEPGWGGLATVFA
FT                   VLELAEQLRFESAYLCDYARLSMEDPAYVGLFARRVRTLSERPEANGPEGREASNPRPR
FT                   DGYGGGPGDYISGLLETGIRIYAGDLADEDGPAAFETWMTSCGFGQRMIEPSFGLSRDY
FT                   DGYVIGTAPIHYALTAALLKRHPRSHEWVIRDLANLLEGEFDRGLRPRFRLPAVLWLAH
FT                   ILAASPTEHDVATQRDPTFFDGLYARLGEHVREGGGLPAKLLLDPPRPFNPSEDVPEWI
FT                   DEEEVVSLPSREALRAKGLALRGPTVPSGHPTAIQACLSSLISYEVYADPGAVILPLLY
FT                   AEAAD"
FT   gene            complement(37935..39776)
FT                   /locus_tag="Intca_0035"
FT   CDS_pept        complement(37935..39776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0035"
FT                   /product="Integrase catalytic region"
FT                   /note="InterPro IPR002514: IPR001523: IPR001584; KEGG:
FT                   nml:Namu_1602 integrase catalytic region; PFAM: Integrase
FT                   catalytic region; transposase IS3/IS911 family protein;
FT                   paired box domain protein; SPTR: Integrase catalytic
FT                   region; manually curated; PFAM: Integrase core domain;
FT                   Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46597"
FT                   /db_xref="GOA:E6SEJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ6"
FT                   /protein_id="ADU46597.1"
FT                   /translation="MALVVLSVVEQRLDAVREVLSGAEVTEVACRYGVHRATLHRWVGR
FT                   YLTDQLAGLADRSHRPASCPHQVAPSVEVVVAEMRRAHPRWGAKRIRMELLRKPVEGVT
FT                   VPAVRTIVRVLHRQGLSQPRPRKRPRSSYRRFERPGPMQLWGIDIVGGIALIDVATGVV
FT                   REAKLVTGVDDHSRYCVMAAVVERATGRAVCLAFAQALGRFGVPEEVITDNGKQFTDRF
FT                   GRHGTRNGEVLFDKICRRNGITHRLTAPASPNQNGKVERFHGTFRPDFLDDAGPFTSVE
FT                   EAQAAVDAWVHDYNVDRPHQALDDKVPVTPVERFAPVPAEQRAVLPLWLPPAIEPVTVA
FT                   DPPSSQPDEHCATDQSVKTATPDQGRGPGDPVQLERVVGPSGNLSVRGQQFWLGPARVG
FT                   QLVRFWISCDFIHLSIGGTRVKTVRSHLSVNDLAILAAGAAIPAGPPPLPSSLEPDTVV
FT                   EVERAVARGGTVALGGHVILAAEILGGRQVGIRIEGATLMFFDLDTRELLRTRPNPIPV
FT                   AQWHHLRGVRPAGPPLRTSAEPITVQRRASNTGVITVCKQQVALGRAHAHHTVTVHVAE
FT                   TTLAIEVDGETRIVRRTTTLPVRNIKVDRPRTVPSIS"
FT   gene            complement(40045..41025)
FT                   /locus_tag="Intca_0036"
FT   CDS_pept        complement(40045..41025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0036"
FT                   /product="5-methylcytosine restriction system
FT                   component-like protein"
FT                   /note="COGs: COG4268 McrBC 5-methylcytosine restriction
FT                   system component; InterPro IPR019292; KEGG: nth:Nther_0806
FT                   McrBC 5-methylcytosine restriction system component-like
FT                   protein; PFAM: 5-methylcytosine restriction system
FT                   component-like protein; SPTR: McrBC 5-methylcytosine
FT                   restriction system component-like protein; PFAM: McrBC
FT                   5-methylcytosine restriction system component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46598"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ7"
FT                   /protein_id="ADU46598.1"
FT                   /translation="MHSLPELLTLAYRTLAPPPSSGVATVETTTPSEWLLVQLAREVHE
FT                   LLGRGLRNGYVERRERLPFVRGRTRPVLNPAQLPFLDCEYADFIVDTPENRLLRGVLEL
FT                   LAPAVRNRAVRRLYDDALSFLLNVEPVLPSLAQFDRISLTRLNRHYLPSLRLARLALEG
FT                   AGVVDSAGSSTAPSYFVLMWQIWENAVAAALRDAQILDVLEKPRYGSAFVHEQGQPNVS
FT                   VTLEPDLVLGRRLSPRMVIDLKWAPVLLPNRHGGLRLRNSHLYQMATYVTALDCDGLLL
FT                   YPLMDDAVNATYVFNGHRVTVRTVDLGQTGLTDLRNAAADIAAAL"
FT   gene            complement(41250..43049)
FT                   /locus_tag="Intca_0037"
FT   CDS_pept        complement(41250..43049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0037"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG1401 GTPase subunit of restriction
FT                   endonuclease; InterPro IPR011704: IPR003593; KEGG:
FT                   cfl:Cfla_3299 ATPase associated with various cellular
FT                   activities AAA_5; PFAM: ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; SPTR: ATPase
FT                   associated with various cellular activities AAA_5; manually
FT                   curated; PFAM: AAA domain (dynein-related subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46599"
FT                   /db_xref="GOA:E6SEJ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ8"
FT                   /protein_id="ADU46599.1"
FT                   /translation="MHSVNLDELIFDVLVDKARVTGPNTWRYKVLMAIADAGDYGATDH
FT                   ELVDLLQAPGGPSNIRPRRNELVESAYVEDAGVKRPTSSGSQATVWRIGSGDRPILTPA
FT                   FVEDDCLLAADVSAAATGGPQLTQADRLAGEMLRARFALLGRRARKAGAEIGVAVDASV
FT                   ARSGPIQLGLWRSGGDRARFTLGAELDGSGLRLSATLGPGDTGASEADARTQRFRAELA
FT                   SLTDEAIAPIERLVQAGWEVSTTSALGLATFSSARDWLRALVDDPTVAGHISATLAPPE
FT                   VAKLGEGVAARIGDLLQILSVDAAAETAMRDPVQALVNGLLWDEDRARNLIALARRSKQ
FT                   LLFAGPPGTGKTLAARILAGALADKSRIKLVQFHPTYAYEDFVEGIRPAMTDDREEGST
FT                   EEGMALRYNIRPGVFKTLVTSAQSAPGNAPHFLVIDEMNRANLARVLGELLFALEYRGP
FT                   ENEVELAYSGKPFHVPDNLWVIGTMNTADRSVALLDAAMRRRFKEVRFDVDYAVIRRWH
FT                   QRHTSAELGEEAAARLQRLNDEVIELLDDDRAIGHSFLVRSDLAEVGFETVWHEDLEPV
FT                   LRDHLLGRTDDLPSLREAFLGSL"
FT   gene            complement(43100..44020)
FT                   /locus_tag="Intca_0038"
FT   CDS_pept        complement(43100..44020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0038"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase; InterPro
FT                   IPR002941: IPR002052: IPR001091; KEGG: bph:Bphy_3423 DNA
FT                   methylase N-4/N-6 domain-containing protein; PFAM: DNA
FT                   methylase N-4/N-6 domain protein; SPTR: DNA methylase
FT                   N-4/N-6 domain protein; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46600"
FT                   /db_xref="GOA:E6SEJ9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ9"
FT                   /protein_id="ADU46600.1"
FT                   /translation="MTPFVFGHAELVHTDCLTWLRRRPEKSIHAVVTDPPYGATEYTHE
FT                   QQQKLRAGKGGVWRIPPAFDGHRRAPLPRFTTMSRADLDYMHDFFYAWAEVLRPTLVPG
FT                   AHVMVACNPLVSPYISMALTKAGLERRGEIVRLVMTMRGGDRPKNAHEEFVDATVMPRS
FT                   QWEPWLLYREPLECRTVADNLRKYKTGALRRISDAQPFGDVIKSHPTRKLERQIANHPS
FT                   LKPQSFLRAVVRASLPLGEGIILDPFAGSGSTLAAAEAIGYQSIGLERDAEYFEVARQA
FT                   IPQLARLVVAGVEQVSEPIPDDDDR"
FT   gene            complement(44017..44244)
FT                   /locus_tag="Intca_0039"
FT   CDS_pept        complement(44017..44244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0039"
FT                   /product="DNA methylase N-4/N-6 domain-containing protein"
FT                   /note="KEGG: bph:Bphy_3423 DNA methylase N-4/N-6
FT                   domain-containing protein; SPTR: DNA methylase N-4/N-6
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46601"
FT                   /db_xref="GOA:E6SEK0"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK0"
FT                   /protein_id="ADU46601.1"
FT                   /translation="MAERRKPGAIRDAILSAFEGPANRNAELTVADIRERVSAKLGEDV
FT                   PSSSVRSYLNINTPGQFIRTGRGTYRLVRR"
FT   gene            complement(44377..45447)
FT                   /locus_tag="Intca_0040"
FT   CDS_pept        complement(44377..45447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0040"
FT                   /product="protein of unknown function DUF262"
FT                   /note="InterPro IPR004919; KEGG: ote:Oter_2248 hypothetical
FT                   protein; PFAM: protein of unknown function DUF262; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46602"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK1"
FT                   /protein_id="ADU46602.1"
FT                   /translation="MDFSSTQETIGWFRDRYLEGTLTLKPPYQRNPVWMARQKNHLVES
FT                   VLMKMPIPEIFIQRSTDANGRTAYAVVDGQQRISALMQFIGSYSADGQEEFDQFPLDKL
FT                   TTESDWYNRCFADLTDPEKISFFGYELAVRYLNSSDEEQMKAVFRRLNSFTVPLKPQEL
FT                   RHATYIGPFSHLADKLAGDYGDFFAENRIITVGAIRRMADVEFVAELLIGTMHGPQGGS
FT                   AKIIDDYYSNYEDFEDEFPGQRKTRVKFEETMAAIERLFPDLRGSRWGNKSDFYSLFVA
FT                   LAAFLPRGSLSDRTASKLRGALREFEEEVEQRVGDEEAPVSKAAASYARGVVRAPNEKS
FT                   RRAARHASLLAVLEEA"
FT   gene            complement(45434..46099)
FT                   /locus_tag="Intca_0041"
FT   CDS_pept        complement(45434..46099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R0144 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46603"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK2"
FT                   /protein_id="ADU46603.1"
FT                   /translation="MDSAELRRRLAQCGRGELPSLVRELVMDRVPYCFAAEQSLFPKVQ
FT                   AHLGAGLKIDPAGVRLVGSGCVGFSVAPDTFPKPFHSGSDLDFAIVSKELFDTAWHGLL
FT                   SWGHPRRHTLPGQENQWFGRRKDEIFWGWIDVKYLHFRGLRFVDDLKPLQKLRAAWFDT
FT                   FQSIGAEFPGTEIAGREVSGRLYRSEEHLIQYQAEGLRKLRYRLAVAREKEASPHGLQ"
FT   gene            46314..46386
FT                   /locus_tag="Intca_R0003"
FT   tRNA            46314..46386
FT                   /locus_tag="Intca_R0003"
FT                   /product="tRNA-Ala"
FT   gene            46785..47054
FT                   /locus_tag="Intca_0042"
FT   CDS_pept        46785..47054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0042"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: rce:RC1_3111 DNA-binding
FT                   protein, putative; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein; SPTR: DNA-binding
FT                   protein, putative; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46604"
FT                   /db_xref="GOA:E6SEK3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK3"
FT                   /protein_id="ADU46604.1"
FT                   /translation="MLTTVRELGAALRDARRASGLSQEALAERAGVSRPWLSRLETAAN
FT                   PGAELRKVLDVLTALGLAVKLGPSPKPAFDDDTDPFADMFGDQT"
FT   gene            47051..48340
FT                   /locus_tag="Intca_0043"
FT   CDS_pept        47051..48340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0043"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="COGs: COG3550 conserved hypothetical protein;
FT                   InterPro IPR012894: IPR012893: IPR017508; KEGG:
FT                   mva:Mvan_1137 HipA domain-containing protein; PFAM: HipA
FT                   domain protein; SPTR: HipA domain protein; TIGRFAM: HipA
FT                   N-terminal domain protein; PFAM: HipA-like C-terminal
FT                   domain; HipA-like N-terminal domain; TIGRFAM: HipA
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46605"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK4"
FT                   /protein_id="ADU46605.1"
FT                   /translation="MNEMNVFLDGALAGRLEQTTGGSLSFSYDAAYTSRPSPTPLSLSM
FT                   PLSSARHSSRVVTAWLEGLLPDNAAVREEWGRRFQVSARNPFALLRHVGRDAAGGVQVL
FT                   PVDVDPPDAALRTGDVRRLSEEQLCSMLRELTVRDAGWEVGEGSGRWSLAGAQNKVALH
FT                   LLDDGTWGVPNDSTPTTHILKPTASGTRFGDLQVNEFVCLRAAAVLGLRVAHVELVDFG
FT                   GAKTLVSTRYDRRRDRNGTWLRLHQEDLLQAMTYPPSKKYQADKGPSVKNVAALLGSLG
FT                   LADRSPVRERFFDAFAFNTLVGGTDAHAKNYSLLLRGPRVALAPLYDAASYAPYLKPGE
FT                   VVHSSMKVGKAWQVRDVTVEDWVEVATALELAPDYALDRVEHLRTGMAGAVSEAADQAP
FT                   APFAKAARQVATAVAKQRHLRVPRLPRARR"
FT   gene            complement(48644..50131)
FT                   /locus_tag="Intca_0044"
FT   CDS_pept        complement(48644..50131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0044"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterPro IPR017442: IPR002290: IPR000719; KEGG:
FT                   kra:Krad_3232 protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; SPTR: Probable
FT                   serine/threonine-protein kinase; PFAM: Protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46606"
FT                   /db_xref="GOA:E6SEK5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK5"
FT                   /protein_id="ADU46606.1"
FT                   /translation="MEDHPRPGEFVTVRPGAAGAPWVADPLGEPSPPPLDGAPTLEDVV
FT                   QQTGGLTDGETIAVAGRVATALAAAHGAGVVHGALDPGVVVLSPEDGVVQVGGFGGSAG
FT                   SAGSAGSAGSAGGGSGSTAEDAPSPYLAPEQVAGDEADARSDLYALGCLMMTLLSGAPP
FT                   APATLVATGPDSSEPAAARTGAPWPSDAKPDVDPALNGLVHDLLAVSPDRRPTSAGEVV
FT                   SRLGRIEADLADRGVVVALPVAVGVGVAAAAADLPDDSEPTLMDSLIGEESGDESEDES
FT                   DDGSPSAAGSLATRPMAMVTTLPWPWVSGSLAAVALVLVILFMSFGRGGVDAPTGAPGT
FT                   IAPAPTSPTATEPATSNGTTTAGTSTTSRTTTTNLTSTTTTTSLTSAASPPAPSRTASP
FT                   PVASTAPRSLDEAISSLRSTVRSVVANGDVGAAAGQDLIAAADELTTWADRSSVQLRRR
FT                   VSDLDGYVDRLLSSGDITNAGYQQVSGAISAVQGQLG"
FT   gene            50318..50779
FT                   /locus_tag="Intca_0045"
FT   CDS_pept        50318..50779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0045"
FT                   /product="DoxX family protein"
FT                   /note="COGs: COG2259 membrane protein; InterPro IPR011637;
FT                   KEGG: kfl:Kfla_3391 DoxX family protein; PFAM: DoxX family
FT                   protein; SPTR: DoxX family protein; PFAM: DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46607"
FT                   /db_xref="GOA:E6SEK6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK6"
FT                   /protein_id="ADU46607.1"
FT                   /translation="MTSLLKPLAARDAVLLVARVLLGAIFLAHGWQKLTEWGLDGTGAA
FT                   FDQMGVPLPGIAATLAALIELVGGIALILGALTTVFSVLLVLDMVGAAVLVHIGNGVFI
FT                   TENGWELVAALGAGVLLLAATGAGAYSVDRMLSPRPQARVADRERALVY"
FT   gene            50983..51915
FT                   /locus_tag="Intca_0046"
FT   CDS_pept        50983..51915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_1866 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46608"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK7"
FT                   /protein_id="ADU46608.1"
FT                   /translation="MSARAVWPELPVASWEPTRDTLTLWLQVIGKIRIARTPLLNHWWN
FT                   APLYVTTRGLTTSPIPGDAGRSLAIDLDLLDHRLDVTTTRGERRSMALEPKSVKDFHAE
FT                   LHGLLGGVGLATEIWPVPVELPEAIRFDEDTTHHDYDPEAVTAFWRTLVEVQRVFEVFR
FT                   SRFLGKSSPVHLFWGALDLATTRFSGKGAPPHPGGMPNCGPHVMHEAYSHEVSSCGYWP
FT                   GAEGEGIFYAYAYPDPDGYRDLPPGPAGARWDDELGEFVLPYTAVRTAQDPDAVLLDFL
FT                   QSTYAAAATTAGWDRAALERPALERPARA"
FT   gene            52004..52522
FT                   /locus_tag="Intca_0047"
FT   CDS_pept        52004..52522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0047"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nca:Noca_3980 hemerythrin
FT                   HHE cation binding domain-containing protein; PFAM:
FT                   Hemerythrin HHE cation binding domain protein; SPTR:
FT                   Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46609"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK8"
FT                   /protein_id="ADU46609.1"
FT                   /translation="MTSPTTTPVERDEAAAATIRRHHEHLVAELETLVAALGTAPGTAP
FT                   GTAPGTRGTDPGEASGSAKARLVDWARTSLAPHAAGEETTFYRTAAGTEAGHLLVAALV
FT                   AEHGVILGIVDAIEASTEPAAAAAWAEALLRVFTSHAAKENDLVLPLLVADPGANLEAL
FT                   LEEMHHEVH"
FT   gene            complement(52573..54456)
FT                   /locus_tag="Intca_0048"
FT   CDS_pept        complement(52573..54456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0048"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="COGs: COG3004 Na+/H+ antiporter; InterPro IPR004670:
FT                   IPR001853: IPR017936; KEGG: nca:Noca_1867 Na+/H+ antiporter
FT                   NhaA; PFAM: Na+/H+ antiporter NhaA; DSBA oxidoreductase;
FT                   SPTR: Na(+)/H(+) antiporter nhaA 2; TIGRFAM: Na+/H+
FT                   antiporter NhaA; PFAM: Na+/H+ antiporter 1; DSBA-like
FT                   thioredoxin domain; TIGRFAM: Na+/H+ antiporter NhaA; TC
FT                   2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46610"
FT                   /db_xref="GOA:E6SEK9"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEK9"
FT                   /protein_id="ADU46610.1"
FT                   /translation="MATTTTAPRRHQLGGQLSAPLRRFLATESGGAVLLVVATLVALGW
FT                   ANSTWSETYSRIWSTELAVEVADWALRMDLHHWINDGLMAVFFLVIGLEVRRDLSVGEL
FT                   TDRRKLRLPLLAGLGGMVVPAVLYLLVNSSGEAANGWGVVIGTDTAFLLGTLALVGPAT
FT                   STQLRVFLLTLTVVDDIVAVSVIGLVYSDDLDAVALAVALAAVAVLVALGRSRVWRTWP
FT                   YALTILALWLATVASGLHASVAGMVAGLLVPSFAPRRQAVEQAARRFHAFRQSPLADVG
FT                   RSAQDALVRAVPVNERMQLVLHPWTSYFIVPVFALANAGVDLRGGVLGEALRSPVTWGI
FT                   VLGLVLGKFVGIGGVALLGSRLGVGRLPQGVGPGQILGGGALSGIGFTVSLLIVGLAFG
FT                   PELQDEATVGVLLALVLATLLGWLVFTLAAVLHGETTAGLPTVLDRPVDPERDHVRGSV
FT                   TAPLTLVEYADFECPFCGRATGVVAEVRAHFGADLRYVMRHLPLPDVHPHAELAALAVE
FT                   SAGAQGRFWEMHDLLFEHQGQLETEDLAGYASELGLDVERFLRDLDDEVHSDRIREDVR
FT                   SAEASGARGTPTFFVGDQRHVGPYDAQTLIAELEASRRDPAREERPRAGHA"
FT   sig_peptide     complement(54304..54456)
FT                   /locus_tag="Intca_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(54559..55689)
FT                   /locus_tag="Intca_0049"
FT   CDS_pept        complement(54559..55689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0049"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017: IPR012257: IPR017900: IPR017896; KEGG:
FT                   gob:Gobs_0251 protein of unknown function DUF224
FT                   cysteine-rich region domain protein; PFAM: protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46611"
FT                   /db_xref="GOA:E6SEL0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL0"
FT                   /protein_id="ADU46611.1"
FT                   /translation="MTDRGLFDKDLLAACISCGFCLPACPTYAMTQDERSSPRGRITLM
FT                   RALETGRLEEDDPTLQEQASFCLGCRACETVCPAGVQYGALLEQWRDHQWRGRHVPPAA
FT                   LALRAGMRATPLIEAAGRVRGAARPTGPARADAAAHLMLGCAERAMFPQLSRAVLRLLP
FT                   DVVDVPSGQGCCGALHAHNGDSTTAHRMAEDLGKVMPGVILTTAGGCGAHIAQVLGRDR
FT                   VRELSEFLLQYWGEHPDRLPPLGRVTVDGRPVRAALQDSCHLRNGLHVTAEPRELIARV
FT                   ADYVELPSAGTCCGAAGTYSILRPEDSQRVLDIHLDEIEAADLDYLIVVNMPCQRQMIN
FT                   GLKRRRSKVRVLHLAELLAAALDVGERERAPSQPPT"
FT   sig_peptide     complement(55603..55689)
FT                   /locus_tag="Intca_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(55686..57110)
FT                   /locus_tag="Intca_0050"
FT   CDS_pept        complement(55686..57110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0050"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterPro IPR006094: IPR004113: IPR016166; KEGG:
FT                   sen:SACE_4261 (S)-2-hydroxy-acid oxidase, subunit D; PFAM:
FT                   FAD linked oxidase domain protein; SPTR: (S)-2-hydroxy-acid
FT                   oxidase, subunit D; PFAM: FAD binding domain; FAD linked
FT                   oxidases, C-terminal domain; TIGRFAM: glycolate oxidase,
FT                   subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46612"
FT                   /db_xref="GOA:E6SEL1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL1"
FT                   /protein_id="ADU46612.1"
FT                   /translation="MSTQGTTPRLHPSGSGLPADVLVELRGIVGDQYVLSLDGDVEPFS
FT                   RDATPLFRARPDAVVLPGTTEEVSAVLTLASRRGIPVTPRGAGSNLAAATIPEHGGIVL
FT                   VLTRMNRVLEVSEGELLAVVQAGTTTVTLAEAAAAKGLLYAPDPGSRTVSTVAGNVAMC
FT                   AGGLRGLKYGVTRNYVLGLEVVLPTGEVMRTGGRLWKDVAGYDLTRLLTGSEGTLAVIT
FT                   EITVGLLPMPATAMTGLAYFDHLSDAGRAVARIIAEGTLPATLEFLDNRCVNAVEDYAQ
FT                   LGLDREAGALLLFGDDGGEEMVASSLQRMADVCTAVGARGVTLAQDIAGSEALLTARRC
FT                   SLPALARLAPITMLEDVTVPRPRLAEMVETIDAIATKHSVTCATFGHAGDGNLHPTIVF
FT                   DPDDGDARHRAEAAFDEIFHAAMALGGTITGEHGVGAAKRPWLAARLGPVQMALLQRIK
FT                   TAFDPAGILNPGKLGS"
FT   gene            complement(57107..58921)
FT                   /locus_tag="Intca_0051"
FT   CDS_pept        complement(57107..58921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0051"
FT                   /product="L-lactate transport"
FT                   /note="COGs: COG1620 L-lactate permease; InterPro
FT                   IPR003804; KEGG: nml:Namu_3729 L-lactate transport; PFAM:
FT                   L-lactate permease; SPTR: L-lactate transport; TIGRFAM:
FT                   L-lactate transport; PFAM: L-lactate permease; TIGRFAM:
FT                   L-lactate transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46613"
FT                   /db_xref="GOA:E6SEL2"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL2"
FT                   /protein_id="ADU46613.1"
FT                   /translation="MLATFPIVTGLAADDFTQSLAPVGGSLALSALVGLLPLVVVFLLL
FT                   GVLKTQAWVAALAGLGTAVLVAVLGYGMPASLALMSATQGGVFGVFPIMWIVLTALWLY
FT                   QLTVTSGRFEDLRATFNMVSEDPRIQAVLIAFCFGGLLEALAGFGAPVAITATMLIALG
FT                   VAPLRAAGTVLLANTAPVAFGAIAIPITTAATLTGIPESTIGAIVGRQAPLLAVVVPLL
FT                   LLLVVDGKRGLREVWPAALVTGLSFAVAQFLTSNFLSVALTDIVASLAGLGATVLFLRV
FT                   WTPVGAREAHERLEAGRHQEHAAAVAAGRTPAGSVAGSVAGSVAGSVAGSATTATATRA
FT                   RVDGTSGAGSDGGRLPTARIWMGLFPYLLVIAVFSVSKLVPPVKAFLAGTDQKIAWPGL
FT                   DGHVLSAAGKPISSTVYSFQWLSSPGTMLLLSGIVVAIAYRISARQAVRDFTGTVVKLR
FT                   WAILTVASVLALAYVMNFSGQTISIGTWIAGTGAFFAFLSPVLGWIGTAVTGSDTSANA
FT                   LFAKLQATAGSHAGINESLLVSANTTGGVVGKMISPQNLTIAASSAGLDGQESAILRRV
FT                   LPWSLGLLLFLCVLVFLQSTPILGWMLP"
FT   gene            59095..59838
FT                   /locus_tag="Intca_0052"
FT   CDS_pept        59095..59838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0052"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2186 Transcriptional regulators; InterPro
FT                   IPR000524: IPR011711; KEGG: sen:SACE_3508 GntR family
FT                   transcriptional regulator; PFAM: GntR domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH; SPTR: Transcriptional regulator, GntR family; PFAM:
FT                   Bacterial regulatory proteins, gntR family; FCD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46614"
FT                   /db_xref="GOA:E6SEL3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL3"
FT                   /protein_id="ADU46614.1"
FT                   /translation="MTGPDEARDGWEPVSRPRTYELVLDRIEEQIASGRLHVGDRLPAE
FT                   RELAAALGVSRVAVREAIRVLQAMGLISQATGSGRDAGTILTSAPAEALTRLIRLHVLV
FT                   ASVNSKDLVRARITLERESAALAATHATEQDLRHLAEALADMEDPASTVEQFNDADTAF
FT                   HVAIARASGNTLVAELTTALRNAMRSTLLTRLQGRPDYPEVAARLSGEHRRIYDAIAAR
FT                   DSQKAADEVAAHIEGFYPDLGSDPA"
FT   gene            complement(59909..62113)
FT                   /locus_tag="Intca_0053"
FT   CDS_pept        complement(59909..62113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0053"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="InterPro IPR011600: IPR018247; KEGG: amd:AMED_1757
FT                   caspase-related protein; PFAM: peptidase C14 caspase
FT                   catalytic subunit p20; SPTR: Putative uncharacterized
FT                   protein; PFAM: Caspase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46615"
FT                   /db_xref="GOA:E6SEL4"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL4"
FT                   /protein_id="ADU46615.1"
FT                   /translation="MSGTRRALIVANDTYDHASLGQLRAPAADAEALADVLGDPEVGGF
FT                   TVTVVHNEPSYEVQSRIEDAFADSRPDDLLLLHFSGHGLKSDTGELFVAARNTRPDRLG
FT                   STAVSADFIQRCMKTSRARSIVLFLDCCYGGAFGEGVTVRAAGPVNVMDSFPAERLGGG
FT                   RGRAVISASSAIEYAFEGTALAADQTVRPSVFTSAVVEGLRTGDADRDEDGLVSLDELY
FT                   DYVFDRVRAENPKQTPGRDVEMAGDLYVARSRRRRLRPAPIPEAVAAALKEANPTFRRG
FT                   AVSELRDRLLHDDPAAALGALEALRDVVRTDTKSVADDAAAALASARMTVVPVSIDLGG
FT                   GGVGSEPRTGMVEVHGPALVQELTVQADPPLEAHVEDDGRVAVELPPGVEAFAGQLTIT
FT                   SPLGSVVVPVTASPASVAGAAEQATEPGSDETVRTTPQAETLVERRLTPVAAGAAAPVE
FT                   KAPTAAVEPPRSTAATESPLLSSRARRLVAATSALGGLLILASFTAPWVYGGVAEAQFP
FT                   GPTAGLFIVAVAATVVAIAVIVDQPRGLVATGLGLGVALVAATSLLTPFGMLATDATSM
FT                   PTGLLLGVAGELLVVTAGIVTLASLLGSGQVSGAWAGLPDRRGLVGLGIVLVGSVTLML
FT                   YAGWLSDRPGSTWGAIMIVWAVTWLAAGAVATSTRPAALARAFLAGWAITALSQPVSDM
FT                   QYQYNGETFPAQPVVLLALLGLVVWAAVPSRERPAVSHRE"
FT   gene            complement(62110..62502)
FT                   /locus_tag="Intca_0054"
FT   CDS_pept        complement(62110..62502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1504 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46616"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL5"
FT                   /protein_id="ADU46616.1"
FT                   /translation="MNASLRLSLDEVGADRARLEVLHRQLRDELWHADALEVALLPAES
FT                   GAAPDGTRALGPAEIGALTVAVLGSGGLPTLLASLRGWLRRGAPSERSVRLEIDGDVIV
FT                   LEDADDLERHQLLQVFLDRHGIQGSA"
FT   gene            complement(62924..63904)
FT                   /locus_tag="Intca_0055"
FT   CDS_pept        complement(62924..63904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0055"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: bcv:Bcav_0018
FT                   mucin-associated surface protein (MASP); SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46617"
FT                   /db_xref="GOA:E6SEL6"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL6"
FT                   /protein_id="ADU46617.1"
FT                   /translation="MFRTKPTRSERLKMQVVEAREHAAATASELGHTAGERLAVMREQA
FT                   APVATDAAERVKLALDEAKLRAAPVAADLAERARPKVESAQSTLVDSLLPKVGAAIGVA
FT                   SAALAQGADEAKERMRDEPRVRHVRESARDHSDRVRDAYRVLSGEAVAKPVRHGRRTWL
FT                   IVIGLGAAAVAAVAAYRRQQADDPWATSSDGSLGGTGASTAFDASPSLKDKAAEKVGTA
FT                   KEAVTEAVTGAAAKAKDKATDLAAKGQAALADAKDRSSDDLVTDAEVEQASTWADEQLD
FT                   EPGATPWGNEGEVTAVDSTLGSDAIDGSVGTLPSETRGSTPKPKA"
FT   gene            complement(64023..64613)
FT                   /locus_tag="Intca_0056"
FT   CDS_pept        complement(64023..64613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1730 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46618"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL7"
FT                   /protein_id="ADU46618.1"
FT                   /translation="MSFIDKLKQKADELGLKEKADHLAEEAKKVAEQAREKAGDLAAEN
FT                   RDKVGSVLDKAGAKLDEKTEGKYADKIAKAKEQVAKGVDKLAEGGTHGSGGAPASGAGA
FT                   AAAGAAAGAGAAAAGGAAATPDDFDIIPDEEEVAEEVLSVEVDPEAPLDGPPEPDVSLG
FT                   AGRPERAYDETGEPIDDLPLEPDAPDVPGSGRW"
FT   gene            64801..65319
FT                   /locus_tag="Intca_0057"
FT   CDS_pept        64801..65319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0057"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="COGs: COG0652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family; InterPro IPR002130:
FT                   IPR020892; KEGG: kse:Ksed_00140 peptidyl-prolyl cis-trans
FT                   isomerase (rotamase) - cyclophilin family; PFAM:
FT                   peptidyl-prolyl cis-trans isomerase cyclophilin type;
FT                   PRIAM: Peptidylprolyl isomerase; SPTR: Peptidyl-prolyl
FT                   cis-trans isomerase; PFAM: Cyclophilin type peptidyl-prolyl
FT                   cis-trans isomerase/CLD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46619"
FT                   /db_xref="GOA:E6SEL8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL8"
FT                   /protein_id="ADU46619.1"
FT                   /translation="MKATLHTNHGDIVIELFPHHAPKTVENFVGLAKGDKEYKDDAGRT
FT                   NPTRFYDGLVFHRIIPNFMIQGGCPLGQGFGGPGYTFDDEIHPEKDFTQPYMLAMANAG
FT                   KRMGKGTNGSQFFITTAPTTWLQGKHTIFGEVADGPSREVVDKIGNIPTGANDKPREDV
FT                   VINSVTFED"
FT   gene            65326..66270
FT                   /locus_tag="Intca_0058"
FT   CDS_pept        65326..66270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0058"
FT                   /product="Rhomboid family protein"
FT                   /note="COGs: COG0705 membrane protein; InterPro IPR002610;
FT                   KEGG: xce:Xcel_0012 rhomboid family protein; PFAM: Rhomboid
FT                   family protein; SPTR: Rhomboid family protein; PFAM:
FT                   Rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46620"
FT                   /db_xref="GOA:E6SEL9"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEL9"
FT                   /protein_id="ADU46620.1"
FT                   /translation="MSDSGTGAQPPIAPGAGQQPAGPSVCPRHPDREAYVKCQRCGRPA
FT                   CPECQRPAAVGIQCVDCVREAARTAPTTRTVFGGRPTDGRPIVTQAIIGICVVVFLVQW
FT                   VSPGTTVDYAFAPSAGWIEPWRFVTAMFLHAPRSLLHIGFNLYALFILGSYLEPLMGRA
FT                   RLAALYLISGIGGQVSVLLFAGNPTIEGLFNGTDAAWATPVVGASGAIFGLFGALIVLN
FT                   RHLGRSAAGMYGVLLINGVLGFVIPNISWQAHLGGFVTGLACAGAIVLFRRQRVRHLTW
FT                   LALSAVLALLVVISVGKYLTVPVEIRDLTAFRR"
FT   gene            complement(66420..66671)
FT                   /locus_tag="Intca_0059"
FT   CDS_pept        complement(66420..66671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0059"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="InterPro IPR009619; KEGG: bcv:Bcav_0021 protein of
FT                   unknown function UPF0233; PFAM: protein of unknown function
FT                   UPF0233; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised protein family (UPF0233)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46621"
FT                   /db_xref="GOA:E6SEM0"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM0"
FT                   /protein_id="ADU46621.1"
FT                   /translation="MPESKGRDRKTAAYIPPPKSKATQPNPTWWAPAFVTLLVLGLLWI
FT                   VTYYITEYRYPISAIGVWNLAIGFALLMGGFIMTMRWR"
FT   gene            66739..67554
FT                   /locus_tag="Intca_0060"
FT   CDS_pept        66739..67554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0060"
FT                   /product="protein of unknown function DUF881"
FT                   /note="COGs: COG3879 conserved hypothetical protein;
FT                   InterPro IPR010273; KEGG: kra:Krad_0026 protein of unknown
FT                   function DUF881; PFAM: protein of unknown function DUF881;
FT                   SPTR: Putative uncharacterized protein; PFAM: Bacterial
FT                   protein of unknown function (DUF881)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46622"
FT                   /db_xref="GOA:E6SEM1"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM1"
FT                   /protein_id="ADU46622.1"
FT                   /translation="MVTDVRPDRGSDDAAPLNPVPSADDAQQPGGDRPRLGWRFLVPIV
FT                   TAGAGLMFAMSFQAAQGDDLRADRDLPSLIIEGNGRNEAKAKELDLLQQEVEALSKERG
FT                   PKDSRLEALNRESTKTAAAAAATALKGPSVEVVLDDSSLSLDQLPSRYTADDIVVHQQD
FT                   VQAVVNALWSSGAEAMMIQDQRVISTSAVRCVGNTLILQGRVYAPPYRIEAIGDVDSML
FT                   QGLDADPTISTYLDYVQAVGLGWAVHTHAEAELPAYSGSVDLDHATPIR"
FT   gene            67568..68212
FT                   /locus_tag="Intca_0061"
FT   CDS_pept        67568..68212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0061"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="COGs: COG0512 Anthranilate/para-aminobenzoate
FT                   synthase component II; InterProIPR000991: IPR006221:
FT                   IPR006220: IPR011702: IPR 001317: IPR017926; KEGG:
FT                   xce:Xcel_0017 glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; SPTR:
FT                   Para-aminobenzoate synthase component II; TIGRFAM:
FT                   glutamine amidotransferase of anthranilate synthase; PFAM:
FT                   Glutamine amidotransferase class-I; TIGRFAM: glutamine
FT                   amidotransferase of anthranilate synthase or
FT                   aminodeoxychorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46623"
FT                   /db_xref="GOA:E6SEM2"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM2"
FT                   /protein_id="ADU46623.1"
FT                   /translation="MSATTARRVLVVDNYDSFVYTIVGYLEQLGADCHVVRNDAVTASE
FT                   AARYDGVLVSPGPGTPEEAGVSVAIIEECARTRTPMFGVCLGHQALAVVFGATVDRAPE
FT                   LLHGKTSLVHHDATGVLQGLPSPFTATRYHSLTVDPSTLPAELVATGHTDSGIVMALRH
FT                   VELPLHGVQFHPESVLTQGGHRMLANFLAECGDEAAVDRSAGLSPLVTAAV"
FT   gene            complement(68219..70105)
FT                   /locus_tag="Intca_0062"
FT   CDS_pept        complement(68219..70105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0062"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR017442: IPR005543: IPR020635: IPR002290: IPR
FT                   017441: IPR008271: IPR000719; KEGG: kra:Krad_0072 protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   PASTA domain containing protein; SMART: serine/threonine
FT                   protein kinase; Tyrosine-protein kinase, catalytic domain;
FT                   PASTA domain containing protein; SPTR: Tyrosine protein
FT                   kinase:Serine/threonine protein kinase:PASTA; PFAM: Protein
FT                   kinase domain; PASTA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46624"
FT                   /db_xref="GOA:E6SEM3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM3"
FT                   /protein_id="ADU46624.1"
FT                   /translation="MTTTPRVLGGRYEVGQLIGRGGMADVHLGHDTRLGRQVAIKMLRS
FT                   DLARDANFLKRFRREAQSAAGLNHPSIVAIFDSGEDESWVEGPNGTLTTVPYMVMEYVD
FT                   GKTLRQQLTVHQKLAPAEAIRITEGILDALAYSHRMGIVHRDIKPANVMITETGHIKVM
FT                   DFGIARAIADSAATMTQTQSVVGTAQYLSPEQAQGQTVDARSDLYSTGCLLFELLTGRP
FT                   PFQGDSPVAIAYQHVGETPQPPSVYNAAVGGDLDAVTLHALVKDRTQRYQDADSFRADL
FT                   ENVRLGQPISAAARGALAAGAAGAASAAATQTMPAAGAAGAAATVVQPPVITSRRQRYE
FT                   NTAGMPAVGHDEVEERQQRGGAGRAALVTLLVLAVLGLIGWGAATWFGNQEPPVAMTTV
FT                   PNLRGLDEPAVERALAQRGLQGNRSEDSNEMEPGKVFEQSPAAGEAVQEGTVVRYTVST
FT                   GPASITIPDVRNFDRGDAEKALADAGLTNVGVETKDDPDTAKDKVIETNPPIGTQVGRD
FT                   TTVTLVVGSGKTVVPDDQVGRDWSLASNALAKAGLNPKRVDVESDKTPGTVLSVAKEGE
FT                   KVDIGTEIKVEVATSPAPKPTTETVTTTVIQTPSGTETSTTTSEPPADGGAG"
FT   gene            complement(70137..71444)
FT                   /locus_tag="Intca_0063"
FT   CDS_pept        complement(70137..71444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0063"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR017442: IPR020635: IPR002290: IPR008271: IPR
FT                   000719; KEGG: nca:Noca_0023 protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; SPTR: Protein kinase; PFAM: Protein
FT                   kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46625"
FT                   /db_xref="GOA:E6SEM4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM4"
FT                   /protein_id="ADU46625.1"
FT                   /translation="MSTAFRPGHVLGSRYTLGAPIASGGMGDVWSATDDVLGREVAVKI
FT                   MRESHDPGYRDRFRDEARHSAALHHPNIAAVFDSGDDNDSPYLVMELVPGRPLSEIIAA
FT                   SKGQGFEPDTVRSIVGQAALALAAAHESGVVHRDVKPANIIVTPGGQAKLTDFGIARAG
FT                   EGKGHTITGEVLGTPEYLSPEQALGETASGASDLYSLGIIAHEMLTGAKPFDCGTPVAT
FT                   AVAQVNDEPPPLPLTVPEDLRAVVEACLVKDPDQRPTDARSLADALLAPLGGMPLSSSP
FT                   TTLSPQPSPTRTLPALSVADADVTGPGRAVDPAPRPTRAELRKRAQRHTEERGRPSVAW
FT                   LAVPFVALLIWGAFALGSLMGGADPTATLQQQPTAPPAVSTTSPTATAAPTVSRATTST
FT                   ATSTRAQAKPEPTAKAEPTVDPTRPGKGNGRGKGNK"
FT   gene            complement(71441..72904)
FT                   /locus_tag="Intca_0064"
FT   CDS_pept        complement(71441..72904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0064"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR001460;
FT                   KEGG: kse:Ksed_00200 cell division protein
FT                   FtsI/penicillin-binding protein 2; PFAM: penicillin-binding
FT                   protein transpeptidase; PRIAM: Peptidoglycan
FT                   glycosyltransferase; SPTR: PbpA; PFAM: Penicillin binding
FT                   protein transpeptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46626"
FT                   /db_xref="GOA:E6SEM5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM5"
FT                   /protein_id="ADU46626.1"
FT                   /translation="MNTAIRRLSVLIAALFGALLVASTVIQFVQAGSMRGMAANKRTLL
FT                   DNYAQERGSILVAGQPIAKSVEVDDQYRWLRTYPDGRLYSQITGFYAYSVGNPFGLEDA
FT                   ADDLLSGKADRLFVRRVTDLLTGRETAGATIELTIDPKVQQAASDALGKNRGAVVALDP
FT                   RTGAILAMVSHPQYDPNPLSSHDLDKAASAWKKLSTDRSKPFTNRAISGDLYPPGSTFK
FT                   VVTAAAALEQGIVDDESSMVPGPAALDLPLTDQPLPNETRQPCGPDDRTTLLHALEISC
FT                   NTAFGSLGLELGGEQLRAQAAKFGFGDSIQIPMRVSPSTMPAEMNQPQAAQSAIGQYEV
FT                   RTTPLQMAMIAAGIANQGRVMTPYLIQSVRTADLDVIDGPPDPKELSQAVSTRTADILK
FT                   RMMVSVVDNGSGRRAQIPGVAVGGKTGTAQHDLEKSPHAWFISFAPADDARVAVAVIVE
FT                   ESGVSGNEVGGAAVAAPIAKAVMEAVIGR"
FT   sig_peptide     complement(72812..72904)
FT                   /locus_tag="Intca_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(72901..74292)
FT                   /locus_tag="Intca_0065"
FT   CDS_pept        complement(72901..74292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0065"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="COGs: COG0772 Bacterial cell division membrane
FT                   protein; InterPro IPR001182; KEGG: kra:Krad_0074 cell cycle
FT                   protein; PFAM: cell cycle protein; SPTR: Putative
FT                   FtsW/RodA/SpoVE family cell cycle protein; PFAM: Cell cycle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46627"
FT                   /db_xref="GOA:E6SEM6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM6"
FT                   /protein_id="ADU46627.1"
FT                   /translation="MTTTVEPVTPRTRRGVELVLLIVAIAVVLLAWVTVDLNRNGTVPA
FT                   EIIPVAGGLVVLAGVVHVVLRWKAPYADPVLLPITTALNGLGLVMIHRLDLAAGRLGAD
FT                   GNANQQIIWTALAVALTVAAIWTLRDHRLLRRYTFISLAVGFILLTLPLVPGLGREVNG
FT                   SRIWIAVGPFSFQPGEFAKIALAVFFAGYLVQTRDVLSLAGKRVLGFTFPRGRDLGPIL
FT                   VAWVLALLILVFEKDLGSALLFFGLFVAMLYVATERVSWIAIGLLLFGAAVAFALSAFA
FT                   HFQKRVDLWLDPFSTENLERSNQLANGLWGMAAGGLTGTGLGAGRPWLTPFAESDYIFA
FT                   SLAEELGLIGAVGILMLYLLFVERGVRTALGVRDGFGKLLAIGLTFSVAFQLFIVIGGV
FT                   TRLIPLTGLTTPFLSLGGSSLLANWIIMSLLLRISDQARRPVPALPIGVGADPATAEAT
FT                   QVVRL"
FT   sig_peptide     complement(74200..74292)
FT                   /locus_tag="Intca_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74289..75752)
FT                   /locus_tag="Intca_0066"
FT   CDS_pept        complement(74289..75752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0066"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045: IPR001932; KEGG: kra:Krad_0075 protein
FT                   phosphatase 2C-like; PFAM: Protein phosphatase 2C-like;
FT                   SMART: protein phosphatase 2C domain protein; SPTR:
FT                   Putative magnesium or manganese-dependent protein
FT                   phosphatase; PFAM: Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46628"
FT                   /db_xref="GOA:E6SEM7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM7"
FT                   /protein_id="ADU46628.1"
FT                   /translation="MAIALRYAARSDLGLGPKSRNEDSGYAGPNLLVLADGMGGHAAGD
FT                   VASSMIVGELAPLDDEDIGADQAIPLLERSLRSANARLTRAMRENSDLAGMGSTTIVML
FT                   RTGNKIAMAHIGDSRAFMLRGDSFSQITKDHSFVQQLVDEGRISKEEAGSHPQRSVVTR
FT                   VMTGQPDDDPDTSLREAKVGDRFLLCSDGLSDFVGADVIEEILAGAASPEEAADRCVEV
FT                   ALKAHTRDNVTVIVADVVDPDGDDLPTTVPQVVGAAARSLRDKTKAIPTTPAEKAAALS
FT                   REALGQKERVDPAPELAESTRRSRRSRGLRRALATLVVLGILVGGGYAAWAWSQQQFYV
FT                   GADAGQVAIFRGVDGEIGPIDLSGIEVRSDVVVTELPSDVQAAVSRTIPAADLADARAK
FT                   VDRLRAEALRCRGLATTGIPCGDTPVTTPTPTPTTPTSPSTPPSTAPIPTSSTTSTTPT
FT                   TAPAPNAAPTPGPSQPARAALGSSTEVVG"
FT   gene            complement(75756..76319)
FT                   /locus_tag="Intca_0067"
FT   CDS_pept        complement(75756..76319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0067"
FT                   /product="FHA domain containing protein"
FT                   /note="COGs: COG1716 FOG: FHA domain; InterPro IPR000253;
FT                   KEGG: sco:SCO3844 secreted protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein; SPTR: Putative membrane protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46629"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM8"
FT                   /protein_id="ADU46629.1"
FT                   /translation="MSELTLTLLRLGLLALLWIFVFSVVGVLRTDIYGTSVSRRSQRKA
FT                   LREQERQQQRAAKEARRAPAPAPLAGPDPTPQRARFGRGRSRGAPTKVVVTEGPLAGTS
FT                   LPLRGQAILIGRNPECALVLDDDYASGRHCRIFQDPATVGGWVVEDLGSTNGTFIGRDK
FT                   LTSPQPVEVGTTLRIGTTLLEFRD"
FT   sig_peptide     complement(76239..76319)
FT                   /locus_tag="Intca_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(76347..77129)
FT                   /locus_tag="Intca_0068"
FT   CDS_pept        complement(76347..77129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0068"
FT                   /product="FHA domain containing protein"
FT                   /note="COGs: COG1716 FOG: FHA domain; InterPro IPR000253;
FT                   KEGG: kra:Krad_0077 FHA domain containing protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF2662); FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46630"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEM9"
FT                   /protein_id="ADU46630.1"
FT                   /translation="MGIINRVEHGLAKAVHGAFARAFKSEVQPVEIASAIRRAMDDRAA
FT                   LLGHGRAMVPNLYTIELSATDYDRLGDYEDELSDDLVAAAQEHADSQGYQPGGPLEVIL
FT                   IEGEGLETGVFRVRPATAKRPGSDTPPPPRSAPPAPRPTPSGTLVDEQPPSRPARVNPS
FT                   ARPWLDISGDRYPLLGSLTTLGRDESADIVLDDPGVSRRHSEIRVTTDGPHLVTSIRDL
FT                   NSTNGTFVNGERITSVRLEDGDRLTLGRTSATFRAGRR"
FT   gene            77359..78924
FT                   /locus_tag="Intca_0069"
FT   CDS_pept        77359..78924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0069"
FT                   /product="chromosome partitioning ATPase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: bfa:Bfae_03240 chromosome partitioning
FT                   ATPase; SPTR: ATPase involved in chromosome partitioning;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN0"
FT                   /protein_id="ADU46631.1"
FT                   /translation="MSNDDSGGAKGQGIPGYSANNTIPGGFSLPLPTATNSAADAVAEA
FT                   PEPADPWSSTWDDTSWQLPEPDSSVSLYSRDELSQYAGTDHGDRSDWADSYDHGGDQAG
FT                   APRTGALSGWDAWEPSGASGFNPDTGHWSDLQHNDETAARSAEEYSGWTPAGSPAPAPL
FT                   NGLHHPGVHVAAVQAHAATPPIDPDVAAAAVELGHDPGSAAYGPEPLVHVDHERPNADD
FT                   LITVRSKGERQKVKASSGLRRAFGLGPGLRELLERDRIDRIARPLSGRKTIMVINTKGG
FT                   GGKTLVTLMLASYLGRYRSGSVLAWDNNETEGTLGMRAPSQSHHRTVVDLLGALPSIAA
FT                   DPNAGTSELEHWVREQRGLSFDVLASADDDEAMRVIGEQEFEDLHTQLSRFYRMIVVDT
FT                   GNNRLSPNWLAAAARADMLVFATSLKDDTSVVAAKNLDALVAMGRGDLVKNAVCVISHT
FT                   TAKGNDVGAGVHTREHFEQWVRAVVDIPYDPALAPGLHLDPLKISRKTHESCMEMTATV
FT                   VDGL"
FT   sig_peptide     77359..77472
FT                   /locus_tag="Intca_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            79054..79136
FT                   /locus_tag="Intca_R0004"
FT   tRNA            79054..79136
FT                   /locus_tag="Intca_R0004"
FT                   /product="tRNA-Leu"
FT   gene            79448..80131
FT                   /locus_tag="Intca_0070"
FT   CDS_pept        79448..80131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0070"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="COGs: COG2802 Uncharacterized protein similar to the
FT                   N-terminal domain of Lon protease; InterPro IPR003111;
FT                   KEGG: kra:Krad_3182 peptidase S16 lon domain protein; PFAM:
FT                   peptidase S16 lon domain protein; SMART: peptidase S16 lon
FT                   domain protein; SPTR: Peptidase S16 lon domain protein;
FT                   PFAM: ATP-dependent protease La (LON) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46632"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN1"
FT                   /protein_id="ADU46632.1"
FT                   /translation="MASLPLFPLGAVLLPGARLPLQVFEPRYVALLRDLIAAQDEHSPV
FT                   FGIIAIREGNEVGEGAVRSLYDVGCGALLTHVAALGGQRFFVIVEGTDRFRLGTVDRTA
FT                   GTRYTTAQVSWLDEPDGDPAAIAPLAGRLRAELEAFRELARVAQQRAGDPGAGEVVIPQ
FT                   VPRALAYAVPLIVSLDLADRQRLLECPDTESRLRLGLELTHRERELAHALGATLKAPQS
FT                   PFDLS"
FT   sig_peptide     79448..79504
FT                   /locus_tag="Intca_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(80224..80931)
FT                   /locus_tag="Intca_0071"
FT   CDS_pept        complement(80224..80931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3859 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46633"
FT                   /db_xref="GOA:E6SEN2"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN2"
FT                   /protein_id="ADU46633.1"
FT                   /translation="MDWMDQLVARLEPATGDVTLTAAAVWTVLAGSLLVVAVEPLWRVL
FT                   RIAVTLVHELGHAVVGMAVGRRFTGFVLRGDMSGHAVTVGRPRGPGRVVSTWAGYPAPA
FT                   LVGAAMAWLAGRGWAAAFIAGVIVVLLVALVRVRSALTLLVMLVALAATGALWWWRDDV
FT                   LQAQLLVGTGIVLVVGAWRHLAAVAGSRDRSSDPGVLASLTHIPGVVWTLSFALACAAG
FT                   SWLLAVEVLTALR"
FT   gene            complement(80964..81899)
FT                   /locus_tag="Intca_0072"
FT   CDS_pept        complement(80964..81899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0072"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG2267 Lysophospholipase; InterPro IPR000073;
FT                   KEGG: chy:CHY_0890 alpha/beta fold family hydrolase; PFAM:
FT                   alpha/beta hydrolase fold; SPTR: Lysophospholipase L2;
FT                   PFAM: Putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46634"
FT                   /db_xref="GOA:E6SEN3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN3"
FT                   /protein_id="ADU46634.1"
FT                   /translation="MRSSTDTLTTTDGTPLFVRRWLPDGPGRAVVQLAHGMAEHSARYE
FT                   RFAERLTREGYAVYAADHRGHGQTASSATPDHGYLADRAGFDTVVADLHAVTEMARRQH
FT                   PDLPVVLFGHSMGSFLARAYVLTWGHELAGLVLSGTAGDPGALGRVGRVVALAQARARG
FT                   RRHPSGLMNTLTFGQYNAPFKPNRTAFDWLSRDPEEVDKYVADLECGNVFTAGFYADLL
FT                   EGLARVNADGEVSRVSKDLPILLVSGDMDPVGGMGKGVARVAAQYERLGVRDVTMKVYP
FT                   EARHELLNETNRDEVMDDIVAWLAERLPAH"
FT   gene            82087..83142
FT                   /locus_tag="Intca_0073"
FT   CDS_pept        82087..83142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0073"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000843: IPR001761; KEGG: sro:Sros_7934 putative
FT                   LacI-family transcriptional regulator; PFAM: regulatory
FT                   protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   SPTR: Putative LacI-family transcriptional regulator;
FT                   manually curated; PFAM: Bacterial regulatory proteins, lacI
FT                   family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46635"
FT                   /db_xref="GOA:E6SEN4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN4"
FT                   /protein_id="ADU46635.1"
FT                   /translation="MTAESRDRTTSRPTMADIAAEAHVSVKTVSRVVNHEPGVRPDTAE
FT                   RVRGVIERIGFRRGDSGSTLRHGRTFTIGLVVEDLADPFYSQISAAVEREARIHRYLLV
FT                   TASAEGSPTRERSVLKGLVARRVDGLVVVPAGETPVADPTVISSRTPVVYLDRPVLSET
FT                   PVDTVLSDNLGGIRSAVEHLVAHGHRRIGFLGDSPDVWTARQRREGFITTLRDLRLPGT
FT                   PLVAMGPHTPETVRTALTRWTSGADPVTAVITGNTRVTIPALTSLHHWATQLSYVAYDD
FT                   FELSDVVEPAVTVVHQDPAAMGQKAAQQLFARLLGDEGPAQVVVLPTRLIVRASGVPRH
FT                   PGRDVRTVSAS"
FT   gene            83226..84536
FT                   /locus_tag="Intca_0074"
FT   CDS_pept        83226..84536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0074"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   pak:HMPREF0675_5030 bacterial extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Bacterial extracellular solute-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46636"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN5"
FT                   /protein_id="ADU46636.1"
FT                   /translation="MRNRSVATVAIATIAALGLAACGSSNEPTPTPGGDTSSLATTSGG
FT                   AGGEVGVFTWWAAGSEKKGLDELEKLFKEKYPNDTFVNLAVAGGAGSNAKAKLASDLQN
FT                   NQPPGSFQGHAGAELLDYIDAEQIEPVNDVIAALGGDKVFPKSLLDRLTVDGNIYSVPS
FT                   NIHRANVVWANTEVLKNAGINAVPTDIKGWIADMEKVKASGVATPLSVAGTWTQLQLFE
FT                   TVLISDLGVDKYNGLFDGKTAWDSPEVKQAAADYKTLLTYANTASDGDDWPVATDMVID
FT                   GKAAYNVMGDWAVAEFAAKGKKEQTDYQYFAVPGQEGVFDFLADSFTLPKGTKNPGGTK
FT                   DWLMLIGSAEGQKAFNLAKGSIPARTDVPATDFPPYQQSAMEAFKTNDIVSSIAHGAAV
FT                   SLAWNADMSTAISKFYTTKDDAGLVTDLTAAAKKYLP"
FT   sig_peptide     83226..83327
FT                   /locus_tag="Intca_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            84635..85549
FT                   /locus_tag="Intca_0075"
FT   CDS_pept        84635..85549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0075"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: pac:PPA1965
FT                   binding-protein-dependent transport permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   permease; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46637"
FT                   /db_xref="GOA:E6SEN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN6"
FT                   /protein_id="ADU46637.1"
FT                   /translation="MRTATKVRDWLPGFLLVLPSVIVVGIFVYWLILQNVLTSLDRTVT
FT                   RATKRVTNPGGVENYTNLLGDDGYQHALFNLLVLTVVFVAGTMVFGLLWAVLLEKGVNA
FT                   EGVFRSVYLLPMAISFIAAGIVWRWLLSPGKGEQAVGLNQLLAMMGLERFQSSWWQSPN
FT                   TLSMAAMAIPAIWQLSGYVMALFLAGFRGISDDQREAARIDGATERQIYRHVLFPQLSP
FT                   IALSALIIIGHMSMKMFDLIYAIAGQNSYKASVPATLMWTQMFQQNNPTAAAANATILL
FT                   VLVALVVVPYLIYTNKTEKETRG"
FT   gene            85546..86472
FT                   /locus_tag="Intca_0076"
FT   CDS_pept        85546..86472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0076"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG:
FT                   pak:HMPREF0675_5028 ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: Binding-protein-dependent
FT                   transport permease; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46638"
FT                   /db_xref="GOA:E6SEN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN7"
FT                   /protein_id="ADU46638.1"
FT                   /translation="MTTATAQTAPVAPGTDALGVRVSTGKAPGTEGTALGRTLRYALLI
FT                   LFVILILIPLYVLFVTSFKRSGDVNASQAWTFPSAWSIDGWRAAWDSLSPALFRSVILA
FT                   TSVAVLSASLGSLNGFVFAKWRFPGATTIFTLFLFGMFIPYQAVMIPLQGMLLDVQGTP
FT                   GFSWFDGIAKLIAVHVIFGIPICTLIFRNYYATALPNEILEAAKVDGAGMLRTFRSIVL
FT                   PISAPGFVVTMIWQFTSAWNDFLFALFLTNRNTGPVTYALNELAGGQNPDYPSIMAGVL
FT                   LASLPTLLVYILLGRYFIGGLMSGSVK"
FT   gene            86575..87111
FT                   /locus_tag="Intca_0077"
FT   CDS_pept        86575..87111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_3009 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46639"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN8"
FT                   /protein_id="ADU46639.1"
FT                   /translation="MDDSRTSASTTTELLIDGFGRIAEGVPGVVAGLSAEQLLWRPDPE
FT                   ANHIAWLVWHLSRQQDEQLAGLGHVRSAWRSGDWAARFDLPYAPDAHGYGMSAAEVGAF
FT                   TVPDPAHLVGYHEAVHEVTLTVLRGLGADDYGTVIDRSWDPPVTVSVRIVSVLDDAAKH
FT                   LGQAQYVRGMVLRRS"
FT   gene            87199..87957
FT                   /locus_tag="Intca_0078"
FT   CDS_pept        87199..87957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0078"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675: IPR015837; KEGG: sna:Snas_2427
FT                   abortive infection protein; PFAM: Abortive infection
FT                   protein; SPTR: Abortive infection protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46640"
FT                   /db_xref="GOA:E6SEN9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR015837"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEN9"
FT                   /protein_id="ADU46640.1"
FT                   /translation="MNATLEPMTVAAATRPVPPRRRPGLWATVVVVLVLVGLNLANHVF
FT                   GWGSLWLGPTGAVALLAFARFSGLTWRQLGLSRRTHASGLRWGLGVIGVVALVYLVGVL
FT                   VPQTRTAFLDARYHLPPASALLTAFVIIPVGTILLEEVAFRSVLWGFLSRHARVWQVAL
FT                   GSSLLFGLWHVLPASAAVTANPALGAVMVGLGAWQQVVSVAGTVLFTALGGLVAGELRR
FT                   RSGSILASVGMHWATNALGVLFGLVAWQLA"
FT   sig_peptide     87199..87321
FT                   /locus_tag="Intca_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(87966..89321)
FT                   /locus_tag="Intca_0079"
FT   CDS_pept        complement(87966..89321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_36620 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46641"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP0"
FT                   /protein_id="ADU46641.1"
FT                   /translation="MLVPPTATFDDFGLGVDLALGRWDITRPRSFRTGWHGRHERRGAG
FT                   PGDLPPDRLVHVAVAKGTQFEYLFDDDEKWIHECVVEELVGRRLTDGRPPIPVPLLGWG
FT                   SVPDQFGRTSPEEVGLLGPEGSATDPATHPAADAATDPATDAANDSATGPQTGSAATPE
FT                   GESAPPRGRPTRAGKGSAPATGTPGATGGIERAPEPGSAGGPAAEGQRRHRGAAKPLDL
FT                   AAVRSGSRSADVGALLSSIEGRDLGPALQQVGDALLRTYRSAGTVDQRRLVGSLREIET
FT                   LLGDRGWEGDDVLAEEIGALLSGSERRGRTLNVDIEELSEVMGNGGADPGGYLHLDTGE
FT                   VVHAFLHHSMEDLDTPGLQEKEEAGREVDNLWIYVDHDTEAAYADMEAFAQAVSDRFAG
FT                   ILTVAIRGKGAFARFRRTVDELDLWGEWQVFSDDRAFGRARALLRSQGIRPV"
FT   gene            complement(89441..90604)
FT                   /locus_tag="Intca_0080"
FT   CDS_pept        complement(89441..90604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0080"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611; KEGG: art:Arth_2897 ribokinase-like
FT                   domain-containing protein; PFAM: PfkB domain protein; SPTR:
FT                   Putative carbohydrate kinase; PFAM: pfkB family
FT                   carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46642"
FT                   /db_xref="GOA:E6SEP1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP1"
FT                   /protein_id="ADU46642.1"
FT                   /translation="MKGMPQNAYDPLASRRSPDAPEVDVFVWGTVFLDLVFAGLPTAPK
FT                   PGTEVWSEGLASCPGGIANLAVATRRLGLRTSLAAAFSDDDYGDFCWRTLEEQEGIDLC
FT                   RSRQFPEWHSPVTVSMAFGGDRAMVSHGHPPPVSSLELIGDPPRSRAVMVDLAESGLFE
FT                   PGDGTRGLGSAARAGESWVDAARRRGALVFADVGWDRDERWEPSVLDRLSHCDAFLPNA
FT                   IEAMAYTATSSPQEALFALADRVPIAVVTNGAEGALGIDARTGEEAQVPSLRVHEVDAT
FT                   GVGDVFAAAMLVGTLGEWPLADRMSFASLAAALALQQYGGSLAAPGWGDVADWWTGLCS
FT                   DACGDAYHRSLRRRYAFLDDIVPRVPVTACRRATATIARRADVDDLP"
FT   gene            90606..91670
FT                   /locus_tag="Intca_0081"
FT   CDS_pept        90606..91670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0081"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2951 Membrane-bound lytic murein
FT                   transglycosylase B; KEGG: sgr:SGR_1028 hypothetical
FT                   protein; SPTR: Lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46643"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP2"
FT                   /protein_id="ADU46643.1"
FT                   /translation="MAQPGREVPWFSGFGPPGRLSPGNRAMAYAAGPEVSAAIPEQSDR
FT                   PPRIVDEVGVGSSRTKRAAGGAGGVAVLLCSVLTAPALAADTSPVPRPSPGAPVASQGV
FT                   ADPVAPVPPVAPIDPLGSGAGESLLRLYDVVKVTAGYVAATRLEPGGGSSRPGRDSAWQ
FT                   PPADLQTPPVTPGTAAGPGRRMTKYDVLGAAYQKAADALADSCQLPFAVLMAIGEVESG
FT                   SLRGRTLDVRHNVVPPIIGPALSGSGFAAIRDSDRGRLDGDPVWDRAVGPMQFIPGTWR
FT                   LWGADGNGDGVADPQNVEDAALSAGRYLCAGGRDLARQADLERAILSYNHSRRYLETVL
FT                   DLYDSVMGGAVAGP"
FT   sig_peptide     90606..90695
FT                   /locus_tag="Intca_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            91765..93507
FT                   /locus_tag="Intca_0082"
FT   CDS_pept        91765..93507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0082"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="COGs: COG0155 Sulfite reductase beta subunit
FT                   (hemoprotein); InterPro IPR005117: IPR006067: IPR006066;
FT                   KEGG: xce:Xcel_0718 sulfite reductase (ferredoxin); PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; PRIAM: Sulfite reductase
FT                   (ferredoxin); SPTR: Sulfite reductase (Ferredoxin); PFAM:
FT                   Nitrite and sulphite reductase 4Fe-4S domain;
FT                   Nitrite/Sulfite reductase ferredoxin-like half domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46644"
FT                   /db_xref="GOA:E6SEP3"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP3"
FT                   /protein_id="ADU46644.1"
FT                   /translation="MTVTEIPGATTPARPAARPPRADRSNGQWKVDGLEPLNANEVWKQ
FT                   EEGGLAVRERIEKTYAKEGFGAIPAQDLTGRFRWWGLYTQRKPGIDGGRTAQLSDDELS
FT                   DTYFMLRVRTDGQALPPEALRVLGGISVDFARGSADITDRQNIQYHWIAIEDVPEIWRR
FT                   LESVGLETTTACGDTPRGFLGSPVAGIAADEIIDPTPVILEIKRRWIGNPELANLPRKF
FT                   KTAITGHPSLDVVHEINDISLVGVVHPELGPGYDLWVGGGLSTSPRLAERLGVFVSEDE
FT                   AAEVWHGVIQIFRDYGFRRLRNKARLKFLLADWGVEKFRHVLETEYLGHALPDGPAPKP
FT                   ATGPGDHVGVHLQKDGRYYVGAAPVVGRVGGPVLSGLADLIDEVGAGRVRLTAHQKLVI
FT                   LDVPEAGVERLVEGLEGLGLTARPSPFRRTTMACTGIEFCKLAIVETKDTAAAAITELE
FT                   RRLADVVADGSLDEPIQLNVNGCPNSCARIQTADIGLKGQIVTVDGPDGPVQQAGFQVH
FT                   LGGGLSTVERDEAGLGRTVRGLKVTAAELPDYVERVIRSFIARRSEGETFAAWALRAED
FT                   GELL"
FT   gene            93504..94265
FT                   /locus_tag="Intca_0083"
FT   CDS_pept        93504..94265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0083"
FT                   /product="phosphoadenylylsulfate reductase (thioredoxin)"
FT                   /EC_number="1.8.4.8"
FT                   /note="COGs: COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase; InterPro
FT                   IPR002500: IPR004511; KEGG: jde:Jden_0661 phosphoadenosine
FT                   phosphosulfate reductase; PFAM: phosphoadenosine
FT                   phosphosulfate reductase; SPTR: 3'-phosphoadenosine
FT                   5'-phosphosulfate reductase; TIGRFAM: phosphoadenosine
FT                   phosphosulfate reductase; PFAM: Phosphoadenosine
FT                   phosphosulfate reductase family; TIGRFAM:
FT                   phosophoadenylyl-sulfate reductase (thioredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46645"
FT                   /db_xref="GOA:E6SEP4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP4"
FT                   /protein_id="ADU46645.1"
FT                   /translation="MSAGSLRTPTVPRRRRTDEELKTVIAEFDARLAARLAADPTDEPT
FT                   ADEVAAWAAEHFAGSLAVACSMADAVLPHVVAQHAPGVDVLFLDTGYHFSDTLVTRDIV
FT                   AADLPITLVNVTPAQTVAEQDAEYGPRLYERDPALCCQLRKVEPLARTLPLYEAWVTGV
FT                   RREEAPTRAGTPLVTWDGKNGLVKINPLAAWTFDELQTYAVDHQVEVNSLLSDGYPSIG
FT                   CEPCTRRVEPGEDPRAGRWAGFTKTECGLHT"
FT   gene            94318..95556
FT                   /locus_tag="Intca_0084"
FT   CDS_pept        94318..95556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0084"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="COGs: COG0007 Uroporphyrinogen-III methylase;
FT                   InterPro IPR000878: IPR006367: IPR006366; KEGG:
FT                   aau:AAur_3076 uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; SPTR: Uroporphyrin-III
FT                   C-methyltransferase, C-terminal:Siroheme
FT                   synthase,N-terminal; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; siroheme synthase; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; siroheme synthase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46646"
FT                   /db_xref="GOA:E6SEP5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP5"
FT                   /protein_id="ADU46646.1"
FT                   /translation="MKSALPLVVDLTGRLVVAVGGGPVSARRVRAFVDEGAVVRVVSPW
FT                   VCEDLRDLVLDGTVEWQARDYTGAGDLDGAWLVHTAVGEPEVDRRVAGDAERLRIWCVD
FT                   ATDASARSASVAARTDVATPDGRVTISTYAAGDPGLATSLRDGVAEAVTQGRLDLRRTR
FT                   ERVSADAKPSGWVALVGGGPGSDGLLTARGHELLRSADVVVVDRLAPRGLLERLPASVR
FT                   VVDVGKTPGHHAVPQWRINEILVEEASRGLGVVRLKGGDPYVLGRGGEERQACEAAGLA
FT                   VEVVPGVTSAVSVPAAAGIPVTHRGVARGFTVVTGHEAIPGLPTGGDHTLVLLMGVSLL
FT                   EQTVTALVAQGRSLDSPVAIVERGFSPTQRTTVGTLSSIAELAREREVGSPAVIVVGDV
FT                   VRLSPEWPGDPAG"
FT   sig_peptide     94318..94395
FT                   /locus_tag="Intca_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(95588..96565)
FT                   /locus_tag="Intca_0085"
FT   CDS_pept        complement(95588..96565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0085"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG0510 choline kinase involved in LPS
FT                   biosynthesis; InterPro IPR002575; KEGG: scb:SCAB_38761
FT                   putative phosphotransferase; PFAM: aminoglycoside
FT                   phosphotransferase; SPTR: Putative phosphotransferase;
FT                   PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46647"
FT                   /db_xref="GOA:E6SEP6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP6"
FT                   /protein_id="ADU46647.1"
FT                   /translation="MAAAVVTVAEPRMLSTADAEAVAAAFGLGPDAVLDGPVARGQLGR
FT                   IWRLRADGTSWAVKEWFAPPDVTAVEAHHEFSEAALAAGVFTPRSRPSVHGTVLADVSG
FT                   TPVRVTEWVDLAPRSRRLDPAEVGRTVAHLHRAGGPTDERVGNWFATGVGAVGWHDMHR
FT                   RLVAARAPFADELEELLPDLVAVESVIEPHEQPRVCHRDLWADNVLASADGRVCIIDFE
FT                   NMGPADPAQELAMVLFEFGDDDPERARLVHAAYVDAGGPARVSRRGHFTMLVAEQAHIT
FT                   TYACARWIGESDVAERARLEAWFRETPEDPVTLARIDRVLAAVT"
FT   gene            complement(96547..97086)
FT                   /locus_tag="Intca_0086"
FT   CDS_pept        complement(96547..97086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0086"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006311; KEGG: scb:SCAB_25881 putative
FT                   integral membrane protein; SPTR: IucA/IucC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46648"
FT                   /db_xref="GOA:E6SEP7"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP7"
FT                   /protein_id="ADU46648.1"
FT                   /translation="MTSVRRGGSEVTEPADEEFEVTIPRLREEPAAPHPGPADHTERVP
FT                   TEEWRTRSLTPMPGGDAVAAVGRRPEPASRVTRFGAALFWMAVGWWLFAAVRLADAVAR
FT                   SGFADGALRQVSGETLRDAARAATTTSGRTELVALVALSVLAAVVLLVSRRRALGLLAF
FT                   GLAAAAAGVAGWQLLS"
FT   gene            complement(97121..97774)
FT                   /locus_tag="Intca_0087"
FT   CDS_pept        complement(97121..97774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0087"
FT                   /product="von Willebrand factor type A"
FT                   /note="KEGG: cai:Caci_5577 von Willebrand factor type A;
FT                   SPTR: Gp207"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46649"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP8"
FT                   /protein_id="ADU46649.1"
FT                   /translation="MTNPNLTHIAFLLDRSGSMQSIKDDTEGGFDAFISEQRQQGGDCR
FT                   VTLAQFDNEYEEVYRDLPLGEVPPLHLAPRGSTALLDSVGRLVTTTGERLAALPEDERP
FT                   GMVIIGIMTDGHENASREWTHPAVKALIEQQTKAYGWQFLFMGADQDAIEVGTSIGVAA
FT                   THAMTYSRGRVHAMMSATSRNIGRTRAAMASGATAAEAAKLIAFDDEQRAASRE"
FT   gene            complement(97861..98313)
FT                   /locus_tag="Intca_0088"
FT   CDS_pept        complement(97861..98313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_6437 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46650"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEP9"
FT                   /protein_id="ADU46650.1"
FT                   /translation="MGCLLRSRSYCVYAVTMSPKSPSPVALALAAVEDALRHVDPDRPS
FT                   AALPHLRAAQDHLTRAIDEAMATAVLAEGSTIRTAGSLAGLSENAVGPRLARTSLLSAY
FT                   AGPDSGRVTASGVERARYDLEEGRHRRTDPGADPSRPMRFRARRPT"
FT   sig_peptide     complement(98224..98313)
FT                   /locus_tag="Intca_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(98442..99167)
FT                   /locus_tag="Intca_0089"
FT   CDS_pept        complement(98442..99167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0089"
FT                   /product="Anti-sigma K factor RskA"
FT                   /note="InterPro IPR018764; KEGG: nca:Noca_4536 hypothetical
FT                   protein; PFAM: Anti-sigma K factor RskA; SPTR: Putative
FT                   uncharacterized protein; PFAM: Anti-sigma-K factor rskA"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46651"
FT                   /db_xref="GOA:E6SEQ0"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ0"
FT                   /protein_id="ADU46651.1"
FT                   /translation="MTDDIHALSGAYAVDALDELERVQFEQHLAGCPACRAEVAGLREA
FT                   AAQLAAGVELPPPPALRGRLMSAIAEARPLPPVRAAAPATEAANVAASPARPWRRVLVA
FT                   AAAAAVLGVTGVGIWQAREGTPAPTVAEQVLDAPDAMRTSQSFTGGATATVVRSPSLGR
FT                   AVLVTSRMPAAPDGKVYQLWLQDSTGHMVSAGVMPAGPDQVVVLQGDARTATAAGISVE
FT                   PTGGSQQPTTDPIALFAFT"
FT   gene            complement(99164..99814)
FT                   /locus_tag="Intca_0090"
FT   CDS_pept        complement(99164..99814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0090"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014284; KEGG: nca:Noca_4535 RNA
FT                   polymerase sigma factor SigK; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2; SPTR: RNA
FT                   polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70
FT                   region 2; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46652"
FT                   /db_xref="GOA:E6SEQ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ1"
FT                   /protein_id="ADU46652.1"
FT                   /translation="MARFSVVPSGDASSPGAATGPVAPVEPVEPVEPFEPIELGDLLGR
FT                   AATGDEGAFGEFYDRTSARVHGLVRRVVRDPAQSEEVTQEVFLELWRQSARYDSGKGSV
FT                   LAWVMTIAHRKAVDRVRSSESARGRDAAYGAATVDVAHDHTSEVAVQRLEGERVRRALG
FT                   SLTEAQRRAVELAYLSGYTHTEVAGLLDLPLGTAKTRIRDGLIRLRDTLGVTS"
FT   gene            complement(99870..100511)
FT                   /locus_tag="Intca_0091"
FT   CDS_pept        complement(99870..100511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0091"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="COGs: COG2335 Secreted and surface protein
FT                   containing fasciclin-like repeats; InterPro IPR000782:
FT                   IPR017909; KEGG: nca:Noca_4534 beta-Ig-H3/fasciclin; PFAM:
FT                   beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin; SPTR:
FT                   Beta-Ig-H3/fasciclin; PFAM: Fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46653"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEQ2"
FT                   /protein_id="ADU46653.1"
FT                   /translation="MNTRRTALALALVLPLGLAACGSAEPEAPTAAPAMTSSAPTTTGS
FT                   SSATSAATTDPAAQVFGSACSAVPSDGKGSFSGMATDPVATAASNNPLLSTLVTAVTEA
FT                   GLVDTLNSAPDVTVFAPVNDAFAKIPEADLKAVLADKPTLTKILTNHVVAGSLSPDELA
FT                   GTHETLAGTTLTVEPSGDSFTVGKERATVLCGNVPTANATVYIIDTVLMP"
FT   sig_peptide     complement(100359..100511)
FT                   /locus_tag="Intca_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(100594..102114)
FT                   /locus_tag="Intca_0092"
FT   CDS_pept        complement(100594..102114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0092"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572:
FT                   IPR005066: IPR006311; KEGG: nca:Noca_4533 oxidoreductase,
FT                   molybdopterin binding; PFAM: oxidoreductase molybdopterin
FT                   binding; Mo-co oxidoreductase dimerisation domain; SPTR:
FT                   Oxidoreductase, molybdopterin binding; PFAM: Mo-co
FT                   oxidoreductase dimerisation domain; Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46654"
FT                   /db_xref="GOA:E6SFB6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB6"
FT                   /protein_id="ADU46654.1"
FT                   /translation="MGRTNHAGIGVLAASAGLAAGHLSASVDEPAASPLVAVGTAVIDA
FT                   APTPLKELAVATLGTADKPVLIGSVLAITLAVAGLIGILARRRLWVAGALLSALVMVGG
FT                   LAALARPTATARDAVPALAALVVGVGVLVGLTELSRRTVPAGTRPGPAAGRGVSRRAVV
FT                   GASVGVAVGSVLAGVGGQVRATARAARDLVLPRPLVPAAPLPTGLDASVRGISPLQTPT
FT                   DRFYRVDVNLTVPRIDHDSWSLDIDGMVERPLRLTYADLTRMRLVERDITLTCVSNEVG
FT                   GGYVSSGRWLGVLVSDLLEAAGVSGPAEQVLSTAVDGFTISTPLRALTDGRHALVAIGL
FT                   NGAPLPDEHGFPARLVTPGLYGFVGATKWLRRLTVTTYAAEQAYWTRRQWATEAPVKTS
FT                   ARIDTPAPLSTVPSGRVAIGGVAWAQHRGVAAVEVRIDDGLWQPARLGPDIGVDCWRQW
FT                   YLPWDAKPGLHRLAVRATDRTGDVQTADRAAPFPDGSSGIQEVVVTVS"
FT   sig_peptide     complement(101980..102114)
FT                   /locus_tag="Intca_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(102172..102615)
FT                   /locus_tag="Intca_0093"
FT   CDS_pept        complement(102172..102615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6177 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Polyketide cyclase
FT                   / dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46655"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB7"
FT                   /protein_id="ADU46655.1"
FT                   /translation="MATFRVWVSSAVPPDEAWRRVLDLRAHDRVIPLTRVTTGRSAAAD
FT                   LTAGSRFVARTGMGPVGFDDAMVVESITPPRAAEPGSARIRKEGKVVRGSIDLHVQATP
FT                   GGSAVSWTQDIDVRGVPRALGWLTVGASRAAYGWALRRLLRGD"
FT   gene            102732..103565
FT                   /locus_tag="Intca_0094"
FT   CDS_pept        102732..103565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0094"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR000639; KEGG: nml:Namu_1402 alpha/beta hydrolase fold
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Alpha/beta
FT                   hydrolase fold protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46656"
FT                   /db_xref="GOA:E6SFB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB8"
FT                   /protein_id="ADU46656.1"
FT                   /translation="MSTRTTTLHGHRLAYVDRGAGPAVLFIHGLLGTNANWSHLVTRLE
FT                   TTHRVVVPDLFGHGASDKPRGDYSLGAHAATLRDLLDRLDIDRVTLVGHSLGGGIALQL
FT                   CYLFPERVDRLVLVSSGGLGRSVSPILRAATLPGAEVVIPVIASGWVRTRLEGLGSALG
FT                   RLGLRPPADVREAWHGFTSLSDADSRRAFLATTRAVIDPGGQTVTAHDHLPMDEDIPTL
FT                   VVWGTHDRMIPAWHATTAHQAIPSSRVELFHGAGHFPHLEEPDRFAALLRDFISR"
FT   gene            103797..104177
FT                   /locus_tag="Intca_0095"
FT   CDS_pept        103797..104177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0095"
FT                   /product="YCII-related protein"
FT                   /note="COGs: COG3795 conserved hypothetical protein;
FT                   InterPro IPR005545; KEGG: amd:AMED_2012 hypothetical
FT                   protein; PFAM: YCII-related; SPTR: YCII-related protein;
FT                   PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46657"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFB9"
FT                   /protein_id="ADU46657.1"
FT                   /translation="MRYLMIHKLDESLPEAWNPSPEFIDKMGAFMGEVQASGALLAAEG
FT                   VHQSKEGALIRKDTTGLTVTDGPFTEAREVIGGFALVEVADKAEAIQLGQRFADLFPQV
FT                   SVEVRRVFEEEDFGAVADSQDA"
FT   gene            104241..105464
FT                   /locus_tag="Intca_0096"
FT   CDS_pept        104241..105464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0096"
FT                   /product="ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp"
FT                   /note="COGs: COG0439 Biotin carboxylase; InterPro
FT                   IPR003135: IPR011761; KEGG: gau:GAU_1512 hypothetical
FT                   protein; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; SPTR: Putative uncharacterized
FT                   protein; PFAM: Carbamoyl-phosphate synthase L chain, ATP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46658"
FT                   /db_xref="GOA:E6SFC0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC0"
FT                   /protein_id="ADU46658.1"
FT                   /translation="MNIIFVEPAFPANQRRFVHALASVGANVYGIGESDETHLGPDLRG
FT                   AMRGYYRVGSVTNVQQLIDAVRHFQAQVWVDGLEATIEAHTMPAAQAREATGVPGTNVR
FT                   TTWLCRDKPSMKEALRAAGVPTAASAAIDSSAEAKEFADRVGYPLIVKPRTGAGAQGTV
FT                   RVDGDDELADVLHQFGEEGATSLAIEEFVEGHEGFYDTITLDGRVTHDWVTHYYPNVLE
FT                   AMRHRWISPQFVTTNRVDGNDFYAEVRELGRRVVDALGIETSATHMEWFYGPKGLRFSE
FT                   IGCRPPGVGAWDLYSAANEIDVYREWAHVVVHGRPEHQMKRSYAAGLVALRPDRDGVVT
FT                   GYDGIDAVESRYGDWVIDAHFPPPGQPTQPVEAGFMANAWVRLRHPDYDTLRGMLDDVG
FT                   RTVKVHAG"
FT   gene            105454..106443
FT                   /locus_tag="Intca_0097"
FT   CDS_pept        105454..106443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:pRL90043 putative transmembrane transport
FT                   protein; SPTR: Putative transmembrane transport protein;
FT                   manually curated; PFAM: Peptidase family S51"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46659"
FT                   /db_xref="GOA:E6SFC1"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC1"
FT                   /protein_id="ADU46659.1"
FT                   /translation="MPDDPPGPPVTTVLLGPQRFTTTVQTVLRSLPVDGPVAMVNAGWE
FT                   EREADDAELAGLLDHRGVNLRLYQRAVEVLASDRALRRVALEHRTAHAELRAFYGIRLQ
FT                   AAWDTVLAVRRRTSRPSTPGVAEGALRSALQALRDVDDWYAFEVGRIVAATAASDAVRS
FT                   SAVLARHRGEVAETLAGASVVVLAGGHVGVLMDTVRLLEVALPAGTPVIAWSAGAMAVC
FT                   DPVVLFHDFAPQGVTAPEVHDRGLGRLRGVIPLPHARRRLALDHHERMAVFAERFAGHR
FT                   LVPLDDGTVLRFVAPADGSGHGPGGVMDPPEGARVLGRDGTVRTWAAS"
FT   gene            106440..107585
FT                   /locus_tag="Intca_0098"
FT   CDS_pept        106440..107585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0098"
FT                   /product="esterase"
FT                   /note="COGs: COG2382 Enterochelin esterase; InterPro
FT                   IPR000801; KEGG: ppd:Ppro_1478 putative esterase; PFAM:
FT                   esterase; SPTR: Putative esterase; PFAM: Domain of unknown
FT                   function (DUF3327); Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46660"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC2"
FT                   /protein_id="ADU46660.1"
FT                   /translation="MSTRLAINRLRDREPLDDEAVDRFITRYGSPIVEGERATFLWRGH
FT                   ADEARVRHRVVGLPDPLPLAPLPGTDLWFVTTVLPAGSRVEYQIEVRRGEAWEQFNDPL
FT                   NPRLAHSPLGSSSVCASHGYQVPDWVSFDPEARPGTIVEDSIRSKALRREQPISVYLPA
FT                   RFNRALRYPLLVVHDGTDYLGFAAMRTVLDNLIHRLDVDPLVAVFVPPGDRLREYANHA
FT                   PHARFIARELVPLLTERLPLVDAPEARCLMGSSFGGIASLSTAVRYPGYFGSLLLQSAS
FT                   LVFTDIGFAHGGGPAFDPVVSFVNRYRAKPTAVVERIYQSCGVYEPLITPNRSMVPVFR
FT                   QTGMQVRYTEARDGHNWENWRDRLGDGLSWLFPGPQKFVYE"
FT   gene            107605..108330
FT                   /locus_tag="Intca_0099"
FT   CDS_pept        107605..108330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0099"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4947 conserved hypothetical protein; KEGG:
FT                   dfe:Dfer_4768 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46661"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC3"
FT                   /protein_id="ADU46661.1"
FT                   /translation="MKTTDRWYSDRLQTDLTLARWGTYGVPVLLFPSAGGDAEEVERFE
FT                   MVAHLRPLIDAGRAKIYSCDSVAGRAMMDRVGTPDHRLALFNAFHQAVAEEVIPAIHSD
FT                   SGGKLPVVVAGASIGAFNSLALICRYPHLIDSAVCMSGTYAIEKFIGGRFTDDLYFSSP
FT                   LHFLPGLDGPVLEALRQRMVIFASGSGEWEDVGESWRAAEVLGAKGVPHRVDDWGPDYK
FT                   HDWPTWWEMLPMYLDDLLP"
FT   gene            108500..110347
FT                   /locus_tag="Intca_0100"
FT   CDS_pept        108500..110347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0100"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   sro:Sros_5772 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR:
FT                   Extracellular solute-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46662"
FT                   /db_xref="GOA:E6SFC4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC4"
FT                   /protein_id="ADU46662.1"
FT                   /translation="MRRPTVPRLGVGATLLTALATTLVLGACTGPAATPGPASPSATTA
FT                   TATGRGTPASTTTSAERAPLVVETVFDFTSLDPRVLVERSGLLVADAAYETLTTLDPED
FT                   PTTVLPGLAEWTMSPERNWLTLRLRPDATFSDGTRVTSDDVVFTLARARGLGGTAAQLL
FT                   GPVGFTKVDDRTLTVITPGPNFALPAVLANPAFGILNADVVKQHGGAVGDGDTAGTWLS
FT                   WNSAGSGPYVVAEADAGRSITLQPNPHWSGPSPVFTEIVVRNAPPAQQVRDIESGAADV
FT                   VLDLPPDHADAMKLRPTVSSVAITSQTSPALAFLLLNDDQTVNRWTGNPDFVAAVRLGL
FT                   DLEAVTRRAGPGAVPALGLVPRGLPGAFEPPVPAATTPPTPTGRATGTAAPSPTSAPAS
FT                   VATSAPTSVPTSVPTSAATPTPSGTAAPIPTATPTTPRAGDLAAARAALARSGYRGEPI
FT                   RLSYASDRPLNGLDLRVVAAAIRDQLRPVGIRVVLAPAPMVKALSDYEKGLDVMGLWAW
FT                   TPEYAEPEAALAFAPGGHLAHRARWVRGVSSAMDALTAATRTSYGDERPGAFARWQLQM
FT                   EQFGPFVPLFQPAAHLAHGERVTAVPRTSIGSVDLAGIR"
FT   sig_peptide     108500..108640
FT                   /locus_tag="Intca_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            110361..111044
FT                   /locus_tag="Intca_0101"
FT   CDS_pept        110361..111044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0101"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2068 Uncharacterized MobA-related protein;
FT                   KEGG: nca:Noca_3976 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46663"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC5"
FT                   /protein_id="ADU46663.1"
FT                   /translation="MPLSPLPHVRGLLLAAGSGRRMGRPKALLRPAEGGRTLAERAVAV
FT                   LLEGGCDGVTVVVGAASDEVTAAVRASFPEEDVVDVVRCADWSEGMGASLRAGLTAMRP
FT                   HAQVQAVLVSLVDLPDLPAGAVHRVGRSGVGASSVEVSGVGVSGVAVGAGCLSRAAYGG
FT                   VPGHPTLIGRDHWAGVVAGARGDRGARDYLAVHDHVVVECGDLATGRDVDSPAGARRAG
FT                   LDASG"
FT   gene            111125..112132
FT                   /locus_tag="Intca_0102"
FT   CDS_pept        111125..112132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0102"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003959:
FT                   IPR003593; KEGG: nca:Noca_3975 ATPase; PFAM: AAA ATPase
FT                   central domain protein; SMART: AAA ATPase; SPTR: ATPase;
FT                   PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46664"
FT                   /db_xref="GOA:E6SFC6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC6"
FT                   /protein_id="ADU46664.1"
FT                   /translation="MDTVSGLTAGPNAGQTAGQTAGQSTVQTKGQTTGSPPADSFADTF
FT                   ASPGDVAAALSRTGYLADDALATVTFLAIRLGRPILLEGEPGTGKTALAEALAEALGLQ
FT                   LIRLQCYEGIDATQALYDWDFPRQILHLRAVEALSRDDHRDPGQLETELFDERFLLARP
FT                   VLRALREAPCVLLIDEIDRADDEFEAFLLEVLSTWQVTIPEVGTLAATTPPIVVLTSNR
FT                   TRELHDALKRRCLYHWIDHPGLARELEIVRTRLPEVPAALAEQVVGVIQRLRTDVGLIK
FT                   PPGVAETLDWARALVALGAAALDPEVAAASLGSAVKYREDAERVRAMLDRLLTP"
FT   gene            112129..113283
FT                   /locus_tag="Intca_0103"
FT   CDS_pept        112129..113283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0103"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="COGs: COG3552 Protein containing von Willebrand
FT                   factor type A (vWA) domain; InterPro IPR008912: IPR011195:
FT                   IPR002035: IPR005829; KEGG: nca:Noca_3974 VWA containing
FT                   CoxE family protein; PFAM: VWA containing CoxE family
FT                   protein; SMART: von Willebrand factor type A; SPTR: VWA
FT                   containing CoxE family protein; PFAM: VWA domain containing
FT                   CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46665"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC7"
FT                   /protein_id="ADU46665.1"
FT                   /translation="MTAAPGDSSGSEIAPRWAADEWLLGFARALRAAGLPVTADRERTF
FT                   LVALREVGLGERRHVYWTGRATLTSSPADVERYDQVFTSWFSAEQPTQTRRPEREAPRA
FT                   TRASLEEVEGSSGPADGAEDAVQARASGLEVLRHRDVAALGIEERQGLARLFGRLRPRP
FT                   PRRRARRHVRSRTGEVDGPGTLREQLRRMGEPGRIHHRVRGSRPRRVVLLIDVSGSMSA
FT                   YADSLLRLAHTYVQAAGPRGPVEVFTMGTRLTHVTRALRVRDADRALIAAGEAVPDWSG
FT                   GTRLGESIAAFLDRWGRRGMARGAVVVVFSDGWERQGPELLGEQMRRLAALAHRVVWSN
FT                   PHRGKDGYLPVQQGIIAALPHVDDFVAGHSLAAFEELIEVVARA"
FT   sig_peptide     112129..112182
FT                   /locus_tag="Intca_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            113276..114532
FT                   /locus_tag="Intca_0104"
FT   CDS_pept        113276..114532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0104"
FT                   /product="protein of unknown function DUF182"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; InterPro IPR003777;
FT                   KEGG: nca:Noca_3973 hypothetical protein; PFAM: protein of
FT                   unknown function DUF182; SPTR: Putative uncharacterized
FT                   protein; PFAM: XdhC and CoxI family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46666"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC8"
FT                   /protein_id="ADU46666.1"
FT                   /translation="MREVLRELTRWWEAGDVVGVGTVVGTWRSAPRQPGASMLVGPGGE
FT                   AVGSVSGGCVEGAVYELGQEVVASGVPVLHRYGISDDDAFAVGLTCGGILDVFVEKVSK
FT                   ETFPELGAVAADIEAGRPVAVATVIEHPDPSWLGRRIVVHPEAVDEEATRVAGVVDDGA
FT                   ARGSVDAGASPAAYGLRMSLGSERADAAVRDDARGLLAQGRTATLGYGPDGERRGEGMR
FT                   VFVQSHAPKPRMLVFGAIDFAAAVARVGSFLGYHVTVCDARPVFATRSRFPDADEVIVR
FT                   WPHDYLTEEVEGGRVDPRTVVAVLTHDPKFDVPVLEVALRLPEVAYIGAMGSRRTHEDR
FT                   LRRLREAGLTDEELARMSSPIGLDLGARTPEETAISIAAEIIALRWGGQGERLSELGGP
FT                   IHHHEHLDVHADHPDVPSP"
FT   gene            complement(114597..115325)
FT                   /locus_tag="Intca_0105"
FT   CDS_pept        complement(114597..115325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0105"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; KEGG: cwo:Cwoe_4749 NAD-dependent
FT                   epimerase/dehydratase; SPTR: NAD-dependent
FT                   epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46667"
FT                   /db_xref="GOA:E6SFC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC9"
FT                   /protein_id="ADU46667.1"
FT                   /translation="MPRGPPRRASPALNRAPATAPCSGLASAGASGALGRTLTPALVAA
FT                   GHDVFGTTRTGNPGPITAAGATPLTMDGLDRTSVLQAVEEAKPDVIIHQLTALRTGIDP
FT                   KHFDTGFATTNRLRTEGTDHPLEAARTFGVGRVLAQSFTGFTNPRTGPGLADETSGYDP
FT                   DPAPEARQTLVSKWLPALAEALGATPPRRLPLCLSRPLLGEHGVNLMTKIRGSSNAKAK
FT                   RELAWTLQYPTWRVGFATGL"
FT   sig_peptide     complement(115221..115325)
FT                   /locus_tag="Intca_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            115297..115524
FT                   /pseudo
FT                   /locus_tag="Intca_0106"
FT   gene            complement(115559..117214)
FT                   /locus_tag="Intca_0107"
FT   CDS_pept        complement(115559..117214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0107"
FT                   /product="HNH nuclease"
FT                   /note="InterPro IPR003615; KEGG: art:Arth_1274 HNH
FT                   endonuclease; SMART: HNH nuclease; SPTR: HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46668"
FT                   /db_xref="GOA:E6SFD0"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD0"
FT                   /protein_id="ADU46668.1"
FT                   /translation="MLPEPASAGSVRVPAALAACDVVALLPRLSETDGSGLGASELVDL
FT                   LDTLERAKAACAAAQAKVTAAFVDAQAVEAAHWTDRARECLDANDFEGYRAAKDEVRRR
FT                   DFTPAALNGRGPGDERASTSRGRRTGAHDKAGIAAQVGLARHESPHRGARLATTALALV
FT                   RDLPHTLDALTTGELNERRAELVARLTSHLTAEDRTAVDAEVVGAHRSDPTDPGLTGIA
FT                   TWGDRQLEGAVRAAADRIDAAGAVARARTAESERRVTIRPIPDTMALVTAVLPVRQAVA
FT                   LYAALTAAASTAQATGDVRSKGQVMADTLVDRVLSGAAGEPGILGDVPVEVQVVITDRA
FT                   LFDGDDTPAQVPGYGPVPAGWVRELLTADLGPPGGDRSGAHGPEWSPRARTWLRRLYTH
FT                   PASGTLVAMDSKRRLFPPGLRRFLVARDGVCRMPWCDAPIRHADHVTPFAVGGPTTAEN
FT                   GQGLCVRCNQVKEQPGWRARVVHPGPLPMPVPAHPVPAHTVRLTTPTGHQHTSVAPPVL
FT                   PAHREPTEGSALDLAHLDEPLSPLEQLLTDRLAG"
FT   sig_peptide     complement(117119..117214)
FT                   /locus_tag="Intca_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(117450..118493)
FT                   /locus_tag="Intca_0108"
FT   CDS_pept        complement(117450..118493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0108"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395; KEGG:
FT                   kfl:Kfla_0935 aldo/keto reductase; PFAM: aldo/keto
FT                   reductase; SPTR: Aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46669"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD1"
FT                   /protein_id="ADU46669.1"
FT                   /translation="MTHHVDDYQAARTRYDSMTYRRCGASGLDLPAVSLGLWHNFGDDV
FT                   PMDRQRAILRRAFDLGVTHFDLANNYGPPYGSAERNFGTIFAQDLRRYRDELILSTKAG
FT                   YDMWPGPYGQGGGSRKYLLASLDQSLERMGVDYVDIFYSHRFDDTTPLEETMGALDTAV
FT                   RSGKALYAGISSYSPQRTQEAIEILGEMGTPMLIHQPSYSMLNRWIEEDLLDTLGEEGV
FT                   GCIAFSPLAQGMLTDKYLGGIPDGSRASQGKSLSPDLLTDESLRHVRALNEVAQSRGQS
FT                   LAQLALAWALRDDRVTSVLIGASSVAQLENSLGALDRLEFTQEELDRIDEHAVEAGINL
FT                   WKRSSTH"
FT   gene            complement(118545..119807)
FT                   /locus_tag="Intca_0109"
FT   CDS_pept        complement(118545..119807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0109"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: kfl:Kfla_6439 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Bacterial protein of unknown function
FT                   (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46670"
FT                   /db_xref="GOA:E6SFD2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD2"
FT                   /protein_id="ADU46670.1"
FT                   /translation="MKELLRIRDARIALGARALSQLGDAMTLIALSILIAQTGQPLDLT
FT                   VLLVAFAAPVVALSSWAGRLVDTRDSRHLLTAAALVQVAGSAGLLASTSLGWQVGCILV
FT                   IQSGQAVAGPGWGALLPRIVGEEKVGRAIGLQQALGSAAWLAGTALGGLAFAAVGFHGV
FT                   ILIDTLAFGSLVGAALAVRTHRAGAGAGCPAPTPAPTPAPALESGWRILHRDRVSGLVV
FT                   AGLVLFVVALEGTNVVEAFLVIDVLGAGPAAYGLLGLCLGTGVTVGSVLCTRIDGDRRR
FT                   IAVLSAAAGTLGLTIAAAGLVGSVAWLYPLFVVAGLANGFINGLGFALVVGRTADAARG
FT                   RVLAAAMGTIRGGSVVSLLVAGVAAGWYGPRAVFVGAGLLTVTVAPVLLLARGRRAWAG
FT                   HGEPADASPGVTEVGAVEPAA"
FT   gene            119875..120465
FT                   /locus_tag="Intca_0110"
FT   CDS_pept        119875..120465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0110"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: aau:AAur_3335 hypothetical
FT                   protein; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46671"
FT                   /db_xref="GOA:E6SFD3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD3"
FT                   /protein_id="ADU46671.1"
FT                   /translation="MATLRRPTEALEVDDPRALRALAHPARQRIINELLAGRVMTATEA
FT                   AELVGLSPSAVSHHLRALERYGIAERAETGGDARTRPWRSRFTELSYVPRSPGGVQVAN
FT                   AVVRGELAKLARNIAVVVEANEAAQQAGERPAPRDSVGISVSERWLTDEERRDVVARIE
FT                   ELLRTLPERHSGNAPEGSVRMSLVLSFVPVAGD"
FT   gene            120591..121106
FT                   /locus_tag="Intca_0111"
FT   CDS_pept        120591..121106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0111"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041: IPR002888; KEGG: gob:Gobs_4925 (2Fe-2S)-binding
FT                   domain protein; PFAM: [2Fe-2S]-binding domain-containing
FT                   protein; ferredoxin; SPTR: Hypothetical dehydrogenase;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; [2Fe-2S]
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46672"
FT                   /db_xref="GOA:E6SFD4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD4"
FT                   /protein_id="ADU46672.1"
FT                   /translation="MTRITVKVDGVEYSDDIEPRTLLVHYLRETVGKTGTVVGCDTSNC
FT                   GACTVHLDGRSVKSCNVLAVQVDGHEVTTIEGLADTAGTDGTLHPMQVAFHEAHGLQCG
FT                   YCTPGMIMQACDLLKENPDPTEAEIREGLEGNLCRCTGYHNIVKAVQQAAAAMAGSRPE
FT                   PTREEVTS"
FT   gene            121103..123592
FT                   /locus_tag="Intca_0112"
FT   CDS_pept        121103..123592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0112"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674: IPR008274; KEGG: nca:Noca_3969 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein; PFAM:
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding; aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead; SPTR: Nicotine dehydrogenase chain C; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase;
FT                   Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead
FT                   domain; TIGRFAM: carbon-monoxide dehydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46673"
FT                   /db_xref="GOA:E6SFD5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD5"
FT                   /protein_id="ADU46673.1"
FT                   /translation="MTMTEDTPTTEAPTGEVGRARKRKEDQRLITGRTRWTDNITLPGM
FT                   LHIAMVRSPFAHARVTAIATAEAKAARNVVAVLTGEDLKEVQGVNANAWPIATDQVTPT
FT                   HLPMAVDHVACAGEIVACVVARSAAEARDAAELVDVDYDELPAVLDMKEALKDEVLAHP
FT                   DLGTNKSAFWQLDSKEAGSGDDVDEAIEAARSDGIVIEREFRQQRLIPAFMEPRSVVVD
FT                   PTGEQITMWSATQIPHILRFLLAATTGVSESKIRVIAPDVGGGFGGKLQTTPEEFVAFA
FT                   AARRLGKPVKYTETRSESLVSGHHGRDQWQKLTLSARRDGTVTGLKVELLADLGAYVAL
FT                   VGGGVPVLGAWMFNSIYKFPAYRFNVQTILTNKTWVDAYRGAGRPEATFGIERMMDELA
FT                   AELGRDPLEVREQNWITHEEFPFTTVAGMTYDSGNYEAATARARELFDYDALRAEQQRR
FT                   REANDPVQLGIGVSTFTEMCGLAPSRVLGSLSYGAGGWEHASIRMLPTGKVEVVTGTSP
FT                   HGQGHETAWSQIVADRLGVPFEDVEVLHGDTQISHKGLDTYGSRSLVVGGEALVLAADK
FT                   VIEKARPIAAHLLEASADDLEFSAGRFGVKGTDQGLTMAEIALASFAAHNLPDGVEPGL
FT                   DSDATYDPVNFSFPHGTHLCAMEVDTETGASRMRSYVCVDDIGVVVNPLIADGQIHGGL
FT                   VQGIAQALWEGAEYDENGTLVTGSFVDYTLPTAADTISFVTDYTVSPSTTNTLGTKGVG
FT                   EAGTIASTPAVVNAIVDALRPMGVHDVPMPCTPERVWRAIQSGGSDRQVESSGDAQPHF
FT                   DPAAPNQDTPETEGGAR"
FT   gene            123589..124446
FT                   /locus_tag="Intca_0113"
FT   CDS_pept        123589..124446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0113"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR002346: IPR005107: IPR016166; KEGG: nca:Noca_3968 carbon
FT                   monoxide dehydrogenase, medium subunit; PFAM: molybdopterin
FT                   dehydrogenase FAD-binding; CO dehydrogenase flavoprotein
FT                   domain protein; SPTR: Molybdopterin dehydrogenase; PFAM:
FT                   FAD binding domain in molybdopterin dehydrogenase; CO
FT                   dehydrogenase flavoprotein C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46674"
FT                   /db_xref="GOA:E6SFD6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD6"
FT                   /protein_id="ADU46674.1"
FT                   /translation="MIPASFDYVAPTTVAEALAALAEHGDEAKVLAGGQSLLPILRMRL
FT                   NAPSVVIDLGRIAELQGISEEGDVIVIGAMTPYAAVLASEVVSTHAGLLSKAVATVADP
FT                   QIRHRGTVGGALVHADPAGDVGAPVLALGAQVVVAGAGGQTRTVAADDFFEDLFTTAVG
FT                   EGELLTQIRIPKHTGWGSHYEKFVRVSHQWSIVAVAAAVRVEGGSIAEARVGLTNMGAT
FT                   PLRARSVEAALVGQAPTDEAVRAAVAQVADGTNPPSDLNGGADYRRHLATVLTRRAVLA
FT                   AAGA"
FT   gene            124454..125284
FT                   /locus_tag="Intca_0114"
FT   CDS_pept        124454..125284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0114"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="COGs: COG3427 conserved hypothetical protein;
FT                   InterPro IPR010419; KEGG: nca:Noca_3967 carbon monoxide
FT                   dehydrogenase subunit G; PFAM: carbon monoxide
FT                   dehydrogenase subunit G; SPTR: Putative uncharacterized
FT                   protein; PFAM: Carbon monoxide dehydrogenase subunit G
FT                   (CoxG)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46675"
FT                   /db_xref="GOA:E6SFD7"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD7"
FT                   /protein_id="ADU46675.1"
FT                   /translation="MELTHSFTVPTSVDEAWVLLTDLRRVGDCFPGATVTEVTGDEFTG
FT                   TVKVKLGPISLVYGGSGSFVARDDENHRAVIEAKGKDKRGNGTAGATVTVELTPDGDGA
FT                   RADVVTDLAVTGKPAQFGRGVMQDVSDKLLGQFIACIEKQLGGGAPVVTEADAAPVPQA
FT                   TVQDAGEAAQRPEIVTDAVPDQVHDTGEPLTLPEEVERSKSAAAEAAAAAAALRGPTPG
FT                   ARSAAPSGGESADDALDLGATVLPVLIQRYSGFAVAAVAGAVVGWLLGRRQSHR"
FT   gene            complement(125338..126273)
FT                   /locus_tag="Intca_0115"
FT   CDS_pept        complement(125338..126273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0115"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="COGs: COG2423 ornithine cyclodeaminase mu-crystallin
FT                   homolog; InterPro IPR003462; KEGG: krh:KRH_11610 ornithine
FT                   cyclodeaminase/mu-crystallin family protein; PFAM:
FT                   ornithine cyclodeaminase/mu-crystallin; SPTR: Ornithine
FT                   cyclodeaminase/mu-crystallin family protein; PFAM:
FT                   Ornithine cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46676"
FT                   /db_xref="GOA:E6SFD8"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD8"
FT                   /protein_id="ADU46676.1"
FT                   /translation="MEAPRWIDAAHIRRALSPEQARRLIREALEGDFDPAGDPARLAPV
FT                   VPGGQLLIMPSSTGDSVGVKVLSVAPGNPVRGLERIQALYVLFDADTLAPSVILDGSAI
FT                   TSLRTPAVSAVAVDALAPPTTRTLTVFGGGPQALGHVEAVLAVRQPERVVIVTRHLDGA
FT                   RATARRIDELGVETTALAAEDVRVRTAVGGSEVVVTATSAGTPVLDGSWVADGACVVAI
FT                   GSHEPDRRELDAALLGRSLVVVEDIGTALREAGDVVLAMGEGVLSTADLHPLKDLVTGA
FT                   VGRATDRPNVFKSVGMSWEDLVIAAGVARA"
FT   gene            complement(126273..126575)
FT                   /locus_tag="Intca_0116"
FT   CDS_pept        complement(126273..126575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_2334 putative cyclase/dehyrase; SPTR:
FT                   Putative cyclase/dehyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46677"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD9"
FT                   /protein_id="ADU46677.1"
FT                   /translation="MPQVSADAHVPLPPDAAAAVAESFPPARPRVPPHVRSVRAAWRFR
FT                   PEGAGALAIHTISYAAGPAWLARLAHEPTQWLLRHQAVRQVERLAEVARSRVRDA"
FT   gene            complement(126593..127324)
FT                   /locus_tag="Intca_0117"
FT   CDS_pept        complement(126593..127324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0117"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="InterPro IPR005754; KEGG: nml:Namu_4659 peptidase
FT                   C60 sortase A and B; PFAM: peptidase C60 sortase A and B;
FT                   SPTR: Peptidase C60 sortase A and B; PFAM: Sortase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46678"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE0"
FT                   /protein_id="ADU46678.1"
FT                   /translation="MTPTPRSVTALVAAALVLVVAAWVFLAQPFQPEPAQGGTGARVAG
FT                   TTGAADVAPADRAPPSSRAGSPSSTPSRASTCRAGEPARLVIPALGVDAPFERIGLDQT
FT                   AEPDTEGRRPLGNPKDRTRAGWYADGPRPGTGTGTVLTNGHTYRDNSAIFKEDFAERIA
FT                   VGQLIHVRQRNGSTCSYSVSRVWREVDAARDYPRIVVSEHLYDFEGPERLFLTTCGGSW
FT                   NSVTQNYDDISLLVATPVRRG"
FT   sig_peptide     complement(127214..127324)
FT                   /locus_tag="Intca_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(127414..128121)
FT                   /locus_tag="Intca_0118"
FT   CDS_pept        complement(127414..128121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_0885 proline-threonine-rich
FT                   repeat-containing protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46679"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE1"
FT                   /protein_id="ADU46679.1"
FT                   /translation="MTTTIGMRRRAVWLITSVAFAATGALALSSATSATADEHNQWVYV
FT                   CKYVGTPGVDERLQTGQNPILVSVNAIDGPPVIGAPFQDAQGRSVVIGYGEPGGGQEGE
FT                   PEPVCPPELPPPPTETTTPPPTETTTPPTTETTTPPTTETTTPPTTETTTPPTTETTTG
FT                   TTPPEQPPGTTPPGAGGGVTPGPGAPDTGGGPAGGAGDSVPVNGLIGTGLLLGAAGILT
FT                   SEAVRRRRVVADG"
FT   sig_peptide     complement(128014..128121)
FT                   /locus_tag="Intca_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(128328..129668)
FT                   /locus_tag="Intca_0119"
FT   CDS_pept        complement(128328..129668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0119"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2271 Sugar phosphate permease; InterPro
FT                   IPR011701: IPR005829; KEGG: gob:Gobs_1377 major facilitator
FT                   superfamily MFS_1; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1; PFAM:
FT                   Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46680"
FT                   /db_xref="GOA:E6SFE2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE2"
FT                   /protein_id="ADU46680.1"
FT                   /translation="MTSPMTTPTEVGPRPTRSERLDRLPFNAQHRRLLVGSGIGWALDA
FT                   MDVGLISFVMAALAKQWLISPTELSWVASIGFVGMAIGASLGGLLADRIGRRNVFALTL
FT                   LVYGLATGAAGLSTGLAMLIGLRFVVGLGLGAELPVASTLVSEYAPARIRGRVVVILEA
FT                   FWAVGWILAALVGYFVVPASDDGWRWALFIGIVPALYALYVRARLPESVRFLEGRGRTA
FT                   EAEQAVRTFEAPSGVAAVESPEAPPAPRPRWSDLWSDGLRTRTAALWAAWFGINFSYYG
FT                   AFIWIPSLLVSQGFSLTRSFGFTLIITLAQLPGYGVAAFLIEAWGRRATLATFLVGSAV
FT                   SAYAFGQAGSEGAIIAAGCALSFFNLGAWGALYAVTPEVYPTFLRGTGSGSAAAFGRIA
FT                   SILAPLSVPWLLDLGGSGLVFTVFGVAFALAAVASLALPEWRGRSLA"
FT   gene            complement(129640..130113)
FT                   /locus_tag="Intca_0120"
FT   CDS_pept        complement(129640..130113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0120"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nml:Namu_3671 hemerythrin
FT                   HHE cation binding domain protein; PFAM: Hemerythrin HHE
FT                   cation binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding domain protein; PFAM: Hemerythrin HHE cation
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46681"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE3"
FT                   /protein_id="ADU46681.1"
FT                   /translation="MCSYCGCRDISLIGRFMTEHEEIVNVAGVLHRAVEGHGPDSVAEA
FT                   LGHTLAHLHPHTTAEERGLFAVLRRNPDFTEHIDGLCAEHARLDDLAERIRGGDTALVN
FT                   TFYDELRDHIDKEDNGLFPAAAIEMDGPDWVEAIQLTPDEGPHTHDEPHDDTH"
FT   gene            complement(130146..130523)
FT                   /locus_tag="Intca_0121"
FT   CDS_pept        complement(130146..130523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0121"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4309 conserved hypothetical protein; KEGG:
FT                   pak:HMPREF0675_3286 hypothetical protein; SPTR: Conserved
FT                   protein; PFAM: Uncharacterized conserved protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46682"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE4"
FT                   /protein_id="ADU46682.1"
FT                   /translation="MYLAAGRSAKRRPPPGLSTIDWNPLNQEHPVTELSLTEKSQHSCG
FT                   CGCSDEGVPTLDVTVIPHAIRHATVFGAFSAIPAGGAMDLVAPHNPLPLLAQLQQQFGE
FT                   IGIEYLVEGPEAWTLRLTRPA"
FT   gene            130532..131254
FT                   /locus_tag="Intca_0122"
FT   CDS_pept        130532..131254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0122"
FT                   /product="putative transcriptional regulator"
FT                   /note="COGs: COG2345 transcriptional regulator protein;
FT                   KEGG: mgi:Mflv_3487 putative transcriptional regulator;
FT                   SPTR: Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46683"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE5"
FT                   /protein_id="ADU46683.1"
FT                   /translation="MINVEKDEGWGPRPSRRSAADAVAGLSAQRRRVFEVLEAEPRSIA
FT                   TVAQTLDLHVNTVREHLDGLVDAGLAQRSRLTPAGRGRPGWGYSSRPGVAAPSIGEYAS
FT                   LAAVLADHVAAQGGDVAADMAKLGVGWGRGLVESHGEVDDPNRAMLGVLETLGFDPDER
FT                   GDVVRLRQCPMLDVARRHPEVVCQVHLGLVRGALEAAGGTAEGVGLEAFAEPDACVLHL
FT                   SRGAEAVRGARADVTTGN"
FT   gene            131275..132492
FT                   /locus_tag="Intca_0123"
FT   CDS_pept        131275..132492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0123"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR005110: IPR001453: IPR005111: IPR020817; KEGG:
FT                   bcv:Bcav_1229 molybdenum cofactor synthesis domain protein;
FT                   PFAM: molybdopterin binding domain; MoeA domain protein
FT                   domain I and II; MoeA domain protein domain IV; SPTR:
FT                   Molybdenum cofactor synthesis domain protein; TIGRFAM:
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   Probable molybdopterin binding domain; MoeA N-terminal
FT                   region (domain I and II); MoeA C-terminal region (domain
FT                   IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46684"
FT                   /db_xref="GOA:E6SFE6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE6"
FT                   /protein_id="ADU46684.1"
FT                   /translation="MGVGQNEPVPHTSVAEHRIALRHVIGAAATEVIPVDRHALGRRLA
FT                   EPLLAIDDLPRFDSSAMDGYAAVPETPDQRVFLVVGDVAAGDAAGFVLEPGQAARVMTG
FT                   ARLPTGAVGVVPVEQTDAERTGPAPRQVTFAAPVAPGRHVRKQAEDIAAGVPVAGTGAP
FT                   LTAAVIALARSAGCTEAVVHVPTRVAVVATGAELTVPGVDPGRGGIHESNSEMVAALAS
FT                   AAGCSVTRVATCTDDPGALEGLLTELSAAPDVDLVITTGGVSAGAYEVVRQVCEPRESF
FT                   SFVHLAMQPGGPQGLGRWDGMPVVCLPGTPVGAFVSFEMLVRPALDERHGAPARGASSA
FT                   AYVGRPRHTRAGMVQFISGVVAPDGTVSAPDARHLSALAGSNALIEVPETVEQIVPGDI
FT                   VTVHPL"
FT   gene            complement(132595..132933)
FT                   /locus_tag="Intca_0124"
FT   CDS_pept        complement(132595..132933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0124"
FT                   /product="YCII-related protein"
FT                   /note="InterPro IPR005545; KEGG: cfl:Cfla_1953 YCII-related
FT                   protein; PFAM: YCII-related; SPTR: Putative uncharacterized
FT                   protein; PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46685"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE7"
FT                   /protein_id="ADU46685.1"
FT                   /translation="MAIFAIQYTYPEDMTEQLKIRPDHRDWLTGLPGLRAAGMYQAGHD
FT                   EFSEGEVTVEEPPNGALIIVEADSLADVLATFEEDPYWAGGYVLRRVVREWNPPLGPWV
FT                   ADASQGNA"
FT   gene            complement(132947..133801)
FT                   /locus_tag="Intca_0125"
FT   CDS_pept        complement(132947..133801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0125"
FT                   /product="formate dehydrogenase subunit FdhD"
FT                   /note="COGs: COG1526 Uncharacterized protein required for
FT                   formate dehydrogenase activity; InterPro IPR003786; KEGG:
FT                   msm:MSMEG_0165 formate dehydrogenase accessory protein;
FT                   PFAM: formate dehydrogenase subunit FdhD; SPTR: Formate
FT                   dehydrogenase family accessory protein FdhD; PFAM:
FT                   FdhD/NarQ family; TIGRFAM: formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46686"
FT                   /db_xref="GOA:E6SFE8"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE8"
FT                   /protein_id="ADU46686.1"
FT                   /translation="MGRVTQRTKVTVVDVSGDRPTSRSRTDTVTVEEPLELRVGGTPLT
FT                   VTMRTPGHDIELVHGFLLTEGIIRDAADVSLARYCEGAVVSGESGFEENTYNVIDVTLA
FT                   PGVAQPAAELARNFFTSSSCGVCGKASIEQLRARTQWPVRDDATRWPAAVITAMPERMR
FT                   SEQRSFDKTGGLHAAGLFGPGGELLAVREDVGRHNAVDKVLGWALLSGRLPATGCVLMV
FT                   SGRASFELTQKALMGGVPCLAAVSAPSSLAVETASDAGMTLLGFVRGATLNVYSRGDRL
FT                   RFP"
FT   gene            133827..134447
FT                   /locus_tag="Intca_0126"
FT   CDS_pept        133827..134447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0126"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="COGs: COG0746 Molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: nml:Namu_2297
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A;
FT                   SPTR: Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46687"
FT                   /db_xref="GOA:E6SFE9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE9"
FT                   /protein_id="ADU46687.1"
FT                   /translation="MQPSLARAAAVVLTGGASSRMGRHKPAIHVAGRAIVERVVGAVGG
FT                   WPLVVVGSGAAVPEGTRVVSEEPPGGGPVAGIAAGWAALTTGTDAAGLAPSGPDVVLVL
FT                   AGDLPFLTRAHLEALVAAAEGSVAVTWSSTGPNWLCAAWPAELLRERLAAVGSPAGVSV
FT                   RRLLGDVPRVEVRDEADVATDVDTPEDLEAARRRADGSEAPGS"
FT   sig_peptide     133827..133883
FT                   /locus_tag="Intca_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(134497..135102)
FT                   /locus_tag="Intca_0127"
FT   CDS_pept        complement(134497..135102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5608 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46688"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF0"
FT                   /protein_id="ADU46688.1"
FT                   /translation="MGRTGLAVVAMSLAVGLGGCAGADRGSSGTPAPIDSQPATRTFAG
FT                   GPIGDSTEPLTTPLFPLTLRRTGGIAGYDDTVVLHADGKVLVDTRSVHGRVCQLTGPEQ
FT                   KHLLSLLNTLRLVDASVPTAGSTAATVPLPPEGDDQTSNDAILINITDHKLRPLDLRDP
FT                   SLGEVAGLVGALVADVTLSSPATTRCTTPTSPVPAPAT"
FT   sig_peptide     complement(134971..135102)
FT                   /locus_tag="Intca_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(135221..137155)
FT                   /locus_tag="Intca_0128"
FT   CDS_pept        complement(135221..137155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0128"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR007887:
FT                   IPR001460: IPR002137; KEGG: nca:Noca_4600
FT                   penicillin-binding protein, transpeptidase; PFAM:
FT                   penicillin-binding protein transpeptidase; NTF2 domain
FT                   protein transpeptidase; SPTR: Penicillin-binding protein,
FT                   transpeptidase; PFAM: Penicillin binding protein
FT                   transpeptidase domain; NTF2-like N-terminal transpeptidase
FT                   domain; Penicillin-binding Protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46689"
FT                   /db_xref="GOA:E6SFF1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF1"
FT                   /protein_id="ADU46689.1"
FT                   /translation="MRRGTSTRRTISAAVSLVLATSLTAGCSLFESDPDPADTATALAR
FT                   GLARGDLTGVTLSGTTAQQATAFLKGVYEDLGDLRPSVAVAGVVPDEEGTSATATLRTT
FT                   WDVSASAQDWTYETQVPLTLAENTWQVRWAPSVVAPELAADETLDIVRTWPRRADIVDR
FT                   RGGRLMTEREVAHIGIDKTKVSGATATRSARALAEVVGVDGTAFADRVAAAGPKAFVAA
FT                   ITLRVTDPTLADNVDRIDSVDGALRVPAMQVLAPTRTWAAPILGRVAEATAEQIEKSGG
FT                   VLEVGDVVGQNGLQLRYDERLRGKPGVAVHAVQRGKDGSAIDKRELFAEPSEKAEPLAV
FT                   TLDAKAQTAAEAALAEQTKRPTALVAVKVSTGEVLAAAVGPGAEQAPLALAGKEAPGST
FT                   FKIASALALIRKGATAETKLPCTDTLTVNGRVFGNYSRYPSSQLGDIPLERAVAYSCNT
FT                   AFISQHEKVSQDELIAAAESLGMGEELDLPFTGFLGSVPPTDDVVERAASFIGQGRVEA
FT                   SPLTMALVIASVMRGETVRPRLVVTDTALPAPATPLRQEEAEVLRRALRAVVTEGSGTV
FT                   LRTVGVEYAKTGTAEFGTTNPPRTHAWMVAGRGDLAIAAYHEEGPSGTTHAAPFIIDFL
FT                   RSYDAEDAG"
FT   sig_peptide     complement(137039..137155)
FT                   /locus_tag="Intca_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            137209..138303
FT                   /locus_tag="Intca_0129"
FT   CDS_pept        137209..138303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0129"
FT                   /product="Protein of unknown function DUF2183"
FT                   /note="COGs: COG4850 conserved hypothetical protein;
FT                   InterPro IPR019236; KEGG: kfl:Kfla_5428 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2183; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2183)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46690"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF2"
FT                   /protein_id="ADU46690.1"
FT                   /translation="MSRPHAAAIIEDAFNEQVERLLRGRGWGNRVVTHIGYGTSTYVRV
FT                   FARIVLGRRGEAGPPERQDATGALVPRRYDRGWRVFVTAPAAGVPVVVTIGDREVYGRS
FT                   DRGGYIDVVAHDHGLGPGWQQVVVAAQGTDPVPADIFVVGDDVTFGIVSDIDDTVITTM
FT                   LPRPMIAAWNTFVRSGKSRRAVAGMAPMYRRLLAAHRGAPIVYLSTGAWNTTPTLTRFL
FT                   VEAGYPLGPFLMTDWGATNTGWFRSGQEHKRSALHRLARDFPHITWLLVGDDGQHDPQI
FT                   YAEFAEARPDRVGAVCIRQLTPTEQVLSHPMGRAEGPHRGWASRTAPTFLAPDGDGLLR
FT                   MLDEAGMVGEPVAADEQPSRPPVT"
FT   gene            138440..139300
FT                   /locus_tag="Intca_0130"
FT   CDS_pept        138440..139300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0130"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase;
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterPro IPR012319: IPR015886: IPR000214; KEGG:
FT                   sna:Snas_1400 DNA-formamidopyrimidine glycosylase; PFAM:
FT                   DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; PRIAM: DNA-(apurinic or apyrimidinic site) lyase;
FT                   SPTR: Putative formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46691"
FT                   /db_xref="GOA:E6SFF3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF3"
FT                   /protein_id="ADU46691.1"
FT                   /translation="MPELPEVQALVDFLAERTAGLAVTKVELASISALKTFNPPPQSLE
FT                   GAPIDGVHRHGKFLDIDCDGTHLVFHLARAGWLRWSDQLPTTVLRPGKSPIALRVRLSD
FT                   GSGFDLTEAGTKKSLAAYIVRDPKEVPGVARLGPDPLADDFTLERFRELLTGRRTQIKG
FT                   LLRDQEVIAGVGNAYSDEILHVAKVSPFAIAGSLPPDVVDRLYAALRETLSSAVHAASG
FT                   KPAKELKDAKRAGMRVHARTGQACPECGDVVREVSFADTSLQYCATCQTGGKPLADRRM
FT                   SRLLK"
FT   gene            139346..140203
FT                   /locus_tag="Intca_0131"
FT   CDS_pept        139346..140203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0131"
FT                   /product="Pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="COGs: COG2240 Pyridoxal/pyridoxine/pyridoxamine
FT                   kinase; InterPro IPR013749: IPR004625; KEGG: nca:Noca_4006
FT                   pyridoxamine kinase; PFAM: Phosphomethylpyrimidine kinase
FT                   type-1; PRIAM: Pyridoxal kinase; SPTR: Pyridoxal kinase;
FT                   TIGRFAM: pyridoxal kinase; PFAM: Phosphomethylpyrimidine
FT                   kinase; TIGRFAM: pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46692"
FT                   /db_xref="GOA:E6SFF4"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF4"
FT                   /protein_id="ADU46692.1"
FT                   /translation="MTSVKILSIQSHVAYGHAGNSAAVFPLQRLGHDVYPVLTVTFSNH
FT                   TGYGATRGPLIAPDDIAEVLLGIEERGAFPHIDAVLSGYQGAESVGAVILDAVARVKAA
FT                   NPSALYCCDPVMGDVGRGFFVREGIPEFIRDEVVPRADIITPNHFELEFLVGRPLATQQ
FT                   AVVAAAEELGARGPQVVLVTSTLTEDTPGDCIQMTCVAHAGAWVVTTPLLPMTVKGGGD
FT                   VTAALFLAHYLTDGPRLALVRTAATMHAILEGTHAAGSEEMLLVAGQDAIAQPGETVEI
FT                   SQIR"
FT   gene            140432..141694
FT                   /locus_tag="Intca_0132"
FT   CDS_pept        140432..141694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0132"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829: IPR009056; KEGG: kse:Ksed_01160
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46693"
FT                   /db_xref="GOA:E6SFF5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF5"
FT                   /protein_id="ADU46693.1"
FT                   /translation="MDPITNPYAPGAGQRPPELAGRDEQLRTFDVVLERIARGRSERSI
FT                   VLTGLRGVGKTVLLNALRSSAVRADWGTGKLEARPDQRLRRPLAAAAHQAVRELGHPRG
FT                   DEVDQVLGIIKSFALRDAASGSKLRDKWQPGIDVPAVPGRADSGDIEIDLVELFTDIGG
FT                   LAADLGKGVAFFVDEMQDLGPEDVSAVCAACHEISQSGLPVIVVGAGLPHLPAVLSASK
FT                   SYSERLFRYQRIDRLPRDAADQALVGPAAEEGCAFTDEALEAMYSVTAGYPYFIQAYGK
FT                   VVWDVSPSSPISAQDIRVAAPEAESELAVGFFGSRFERATPAEREYLRAMADAALVRGP
FT                   GDQATTEGHGDAGASPAAYGIVDELDAVATSAVADLLGRKPQSLSPARDALIKKGLIYS
FT                   GERGQIAFTVPHFGRYLRTQA"
FT   gene            complement(141787..142146)
FT                   /locus_tag="Intca_0133"
FT   CDS_pept        complement(141787..142146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0133"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001607; KEGG: rop:ROP_38800 hypothetical
FT                   protein; SPTR: Zinc finger domain protein; PFAM: Zn-finger
FT                   in ubiquitin-hydrolases and other protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46694"
FT                   /db_xref="GOA:E6SFF6"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF6"
FT                   /protein_id="ADU46694.1"
FT                   /translation="MAVPPGDLPDIDPTAPPSGTGCADCVAAGGWWVHLRRCAACGHVG
FT                   CCDTSPAQHATRHFRMTGHPVVRSFEPGETWFYDYRTQEFVEGPPLAPPDHHPEDQGVP
FT                   GPRDRVPPDWGDHLH"
FT   gene            142246..142485
FT                   /locus_tag="Intca_0134"
FT   CDS_pept        142246..142485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_28560 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46695"
FT                   /db_xref="GOA:E6SFF7"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF7"
FT                   /protein_id="ADU46695.1"
FT                   /translation="MNAELHDRPETVVPGFWMTILGSILAVIAPLAGFLGGSSTGAVAR
FT                   EGQLGTWLLVGLVIGGLGVLVAFVGAQRWWRATH"
FT   sig_peptide     142246..142377
FT                   /locus_tag="Intca_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            142562..143134
FT                   /locus_tag="Intca_0135"
FT   CDS_pept        142562..143134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0135"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR007627: IPR013249: IPR014284; KEGG: ace:Acel_0379 ECF
FT                   subfamily RNA polymerase sigma-24 factor; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46696"
FT                   /db_xref="GOA:E6SFF8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF8"
FT                   /protein_id="ADU46696.1"
FT                   /translation="MIGADFQTVLADAQGGDEYAFARLWRDLNPALLRYLSLGGEMAEE
FT                   VAAETWTTVVRGLARFEGDETAWRAWVFTTARRRAVDAGRKRAREAGLGWRANTWAAEV
FT                   SPDSAEAVIEAATTEDMLRLVRTLPASQAEAVLLRVVAGLPVAEVAELLGRSPGSVRVA
FT                   CHRGLESLAKKLSKQDVTDGALRALRG"
FT   gene            143106..143900
FT                   /locus_tag="Intca_0136"
FT   CDS_pept        143106..143900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_3793 protein tyrosine phosphatase,
FT                   receptor type, F -like protein; SPTR: Protein tyrosine
FT                   phosphatase, receptor type, F (Predicted)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46697"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF9"
FT                   /protein_id="ADU46697.1"
FT                   /translation="MAPCGRFGGDMSNEKQSEGFPDRAGSHDDLLDEVAANPELARVAF
FT                   LLSARPSDRELSGLDGPLDAFRAQVTAPKPQRRRPSMISTLAGAKLGATIAGIAVGLGG
FT                   AATVAYVSASTPATPETHATAATTPSQADAAADARENGKGEGKKDKATPVGPDATGWAA
FT                   FGLGTAWKGVAGNGKAMESVAFQNLVTAAGGEDEVEAFCAEVDAPGSSGDHATGKPEIA
FT                   PTGKPDSVPSATPSQRPEMTPTPPAKPDTVPTASPSHPTGRS"
FT   gene            complement(144053..149638)
FT                   /locus_tag="Intca_0137"
FT   CDS_pept        complement(144053..149638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0137"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005481: IPR005479: IPR005482:
FT                   IPR000089: IPR 000022: IPR011761: IPR011764: IPR011763;
FT                   KEGG: kfl:Kfla_3307 carbamoyl-phosphate synthase L chain
FT                   ATP-binding protein; PFAM: Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   carboxyl transferase; SPTR: Carbamoyl-phosphate synthase L
FT                   chain ATP-binding protein; PFAM: Carboxyl transferase
FT                   domain; Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Biotin carboxylase C-terminal domain; Acetyl-CoA
FT                   carboxylase, central region; Carbamoyl-phosphate synthase L
FT                   chain, N-terminal domain; Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46698"
FT                   /db_xref="GOA:E6SFG0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG0"
FT                   /protein_id="ADU46698.1"
FT                   /translation="MISRIAIVNRGEAAMRLIHAVRDLNAQHAVEGRSDQRIETIALHT
FT                   EGERRAMFVRESDHAYDLGPAANRPYIDHAVLERALRETGADAAWVGWGFVAEDPAFAE
FT                   LCERIGVIFIGPSAEAMRQLGDKIGSKLIAEEVGVPVAPWSRGGVDTLEEATEAAARIG
FT                   YPLMLKATAGGGGRGIRKVESDAELTEAYERTRDEAARAFGSGVVFLEKLVTGARHIEV
FT                   QVIGDGQGTAWAVGVRDCSVQRRNQKVIEESASPVLSADEAAEVRTAAERLAVAVGYAG
FT                   AGTVEFLYHPAEKFFAFLEVNTRLQVEHPITEATTDTDLVKLQIHVANGGRLEGARPVE
FT                   RGHAVEARLNAEDPDRDFAPAPGRIALLDFPSGPGIRVDTGVGEGDSIPADFDSMIAKI
FT                   IAYGRDRDEALARLRRAMAETTVVIEGGATNKSFILDLLDQPEVIDGSADTGWIDRVRG
FT                   EGRLMSQRHSGIALVAAGIEAYEEAEAIERARLLETARGGRPQAHHQVGRGVDLKLRGT
FT                   IHKVNVLRIAPHRYRVTVGSGASGDDGQVVEAQLDRIDDYQSRIVVGGQNHRLITALHG
FT                   PVLLVEVDGVTHRVSRDEGGVLRSPAPALVVAAPVQVGDEVAAGAPVLVLESMKMETVL
FT                   AAPFAARVKEILVGVGGQVETGAALVRLEPTGDEDEPGAGASPAPTVDLDLPDCTVADE
FT                   TLRDRIARGVSELSAGVLGFDNDDNGTHRSLTAYLSARDEAAADGTSPIAEEIILLELV
FT                   ADFAELSRNRPAEEERHTELLVHTPREHFHTYLQSLDADRAGLPAAFRDKLARVLRHYG
FT                   VTELDRTPDLEEAVFRIFLAQQRTSPEIALATSLLQRWLGEPTPEARNAAAARDTLDRL
FT                   VLATQLRFPVIGDLARSVRFRWFEQPMVDAERQSVLAGVRDQLESLTAEAERVGDEGGA
FT                   TPETVSPDYAAGIDELAAIPEQIVRFLAERLDRPDDSIPRHEPMIEVLIKRHYHEHDLH
FT                   GPHRFHAGDRPFAVADYTLDGRPTHLTSTIGDVAELAPGSDLDVSVGNDVWSRAEQHHA
FT                   VVDLYLRWRDQPADPEEVSATLATRLKALDWTRDVRRVAVAVTGNHDQPVGYFTFRPQG
FT                   EELVEDRLVRGVHPMVGRRLQLWRLRDFEVTRLEAPEDVFLYECVARDNADDRRIVASA
FT                   QVRQLVVVRDDDGRVSGLPQAERAIANCLDAIRRVRASRGSAGSRLDMNYVWVTIWPII
FT                   EADLEQLTALQAKIAPLTVGAGVEEVLVQARVVLDPEEGPVTIAGRFSYQPGSGVVGTV
FT                   GQPPAEPLKPLDDYASKVVRARRRGLVYPYELQSMIAGDGGTVVEHDLDDAGRLVPVDR
FT                   PFGLNKAGIIVALVTSPTERHPQGVQRVVLSGDPLRSLGSVAEAECARVIAALDLAEER
FT                   GIPVEWYSLSAGARISMDSGTENMDWVARALKRIIEFTQAGQEINIVVAGINVGAQPYW
FT                   NAEATMLMHTKGILVMTPDSAMVLTGKQSLDFSGGVSAEDNFGIGGYDRVMGPNGQAQY
FT                   WAKDLAAARDILMTHYDHAYVAPGEGGPRRVATSDPIDRDVTSYPHSLPDSGFTTVGDI
FT                   FSAEKNPDRKKPFDIRTLMRALTDQDHATLERWAGMADAETAVVQDAHLGGIPVCLIGI
FT                   ESKSVPRRGFPPTDGPDTYTAGTLFPRSSKKVARAINAASGNRPVVILANLSGFDGSPE
FT                   SMRSLQLEYGAEIGRAIVNFDGPIVFTVVSRYHGGAFVVFSKALNPRMTVLAIEGSFAS
FT                   VIGGAPAAAVVFARDVDARTAADSRVAELAARVDASEGVERAQLATELADLRATVRAEK
FT                   LGAVAAEFDSVHSIHRAVAVGSVDEVIEASDLRPRIISALEAGLTP"
FT   gene            complement(149823..150323)
FT                   /locus_tag="Intca_0138"
FT   CDS_pept        complement(149823..150323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg8735 hypothetical protein; SPTR:
FT                   Predicted CDS Pa_2_8850"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46699"
FT                   /db_xref="GOA:E6SFG1"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG1"
FT                   /protein_id="ADU46699.1"
FT                   /translation="MPRSRRRGYGPYEPLGEGPGRRRPWLRTAQLNVRGWSALIGLCAL
FT                   AGLAGTLLARAIDVPAWAGSPLALLPLGAVILVDRRRWAAMETSYGWGGSVADVSRMVE
FT                   ELRAYGVAAAVRPDPRYEQPWWDRIDSPADPEPTASLVYANRDEAAVRTVLRGHGVDLP
FT                   DLP"
FT   sig_peptide     complement(150156..150323)
FT                   /locus_tag="Intca_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(150355..150810)
FT                   /locus_tag="Intca_0139"
FT   CDS_pept        complement(150355..150810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0139"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COGs: COG1522 Transcriptional regulators; InterPro
FT                   IPR019887: IPR019888: IPR000485; KEGG: nca:Noca_1625 AsnC
FT                   family transcriptional regulator; PFAM: Transcription
FT                   regulator AsnC-type-like; SMART: Transcription regulator
FT                   AsnC-type; SPTR: Transcriptional regulator, AsnC family;
FT                   PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46700"
FT                   /db_xref="GOA:E6SFG2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG2"
FT                   /protein_id="ADU46700.1"
FT                   /translation="MMGAVDRVDWHILSELQADARLSFNELSRRVKLSAPAVADRVRRL
FT                   EEAGVIVGYHAQVDLERAGRPVRAVVVMDCYGPTCLLRDPEVAAWPEVQELYRVTGPGC
FT                   SVLVVATASMDAFEDLIDRLARYGRPSSSMILADQLPWSPVQPVPSP"
FT   gene            complement(150862..151098)
FT                   /locus_tag="Intca_0140"
FT   CDS_pept        complement(150862..151098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0140"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4309 conserved hypothetical protein; KEGG:
FT                   nca:Noca_2100 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Uncharacterized conserved
FT                   protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46701"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG3"
FT                   /protein_id="ADU46701.1"
FT                   /translation="MTTDPQLDVRSEPPARRHTLILDTYHALTPGAGFELVNDHDPKPL
FT                   YYQFDAEYKDQFTWDYLEEGPDVWRVRIGRPAA"
FT   gene            151319..152701
FT                   /locus_tag="Intca_0141"
FT   CDS_pept        151319..152701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0141"
FT                   /product="tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro IPR001597:
FT                   IPR011166; KEGG: nca:Noca_1624 tryptophanase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; PRIAM: Tryptophanase; SPTR: Tryptophanase; PFAM:
FT                   Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46702"
FT                   /db_xref="GOA:E6SFG4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG4"
FT                   /protein_id="ADU46702.1"
FT                   /translation="MDDAPFTTIIEPFRIHSVEPLTMTTRAERQDHLRTAGYNLFQLRA
FT                   QHVLIDLLTDSGTGAMSRDQWAAIQHGDESYAGSPSYYVFVDAVRELFPFEHVIPVHQG
FT                   RAAEKILFSALGGAGKVVPNNTHFDTTRANVEASGASAVDLVIAEGRDPVSDHPFKGNM
FT                   DLAALEALLAARADDVPCVMVTITNNSGGGQPVSLENLRGVREICDRYGKPLYLDACRF
FT                   AENAWFIREREEGQGDRDVSDIVREISGLADGMTMSAKKDPMGNIGGWLAMNDDDLAQR
FT                   CRNTLILTEGFPTYGGLAGRDLEALAQGLREVVQHDYLRYRIRSTAYLGEALVKLGVPV
FT                   LTPIGGHAVYIDARALAPHLSPLEYPGQAVAVALYELGGIRSCEIGTVMFGRQADGTEQ
FT                   PASMELVRLAIPRRTYTQSHIDYVIEVCERLAAVAPSLPGYRITSEPPVLRHFTASFEP
FT                   LR"
FT   gene            complement(152767..154188)
FT                   /locus_tag="Intca_0142"
FT   CDS_pept        complement(152767..154188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0142"
FT                   /product="tyrosine phenol-lyase"
FT                   /EC_number="4.1.99.2"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro IPR001597:
FT                   IPR011166: IPR013441; KEGG: sth:STH2842 tyrosine
FT                   phenol-lyase; PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; PRIAM: Tyrosine phenol-lyase;
FT                   SPTR: Tyrosine phenol-lyase; TIGRFAM: tyrosine
FT                   phenol-lyase; PFAM: Beta-eliminating lyase; TIGRFAM:
FT                   tyrosine phenol-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46703"
FT                   /db_xref="GOA:E6SFG5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013441"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:E6SFG5"
FT                   /protein_id="ADU46703.1"
FT                   /translation="MPAIAEPYRIKMVEPITMTTREQREAAIRAAGYNTFLLRSDDVYI
FT                   DLLTDSGTSAMSDRQWSAMMMGDEAYAGARSFDHLVESVRENYGFPLVCPTHQGRGAEH
FT                   LISKILITPGQHVPGNMYFTTTRVHQELAGGTFHDVIIDEAHDPASRHPFKGNVDLDKF
FT                   QALIDEVGADQIAYINVAVTVNMAGGQPVSMANIRAVREICDRYGIILWSDATRLAENA
FT                   WFIQEREDGYAGRPVAEIVREMLSHFDGITMSGKKDCLVNIGGFLAMRDEAILTKAREL
FT                   VVVYEGMPTYGGLAGRDLDAMAVGLREALDDDYLTHRIGQVRYLGERLQAAGVPIVEPI
FT                   GGHAVFIDAAAFLDHLSQDELPAQTLAAEIFLDSGVRSMERGIVSAGRDADGNNRYPKL
FT                   ELVRLTIPRRVYTNSHMDVVADSVIRVFQRRREIQGLTFVYESPTLRFFTSRFEPLAAE
FT                   AALEEGRPEPALAGA"
FT   gene            complement(154352..157309)
FT                   /locus_tag="Intca_0143"
FT   CDS_pept        complement(154352..157309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0143"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG3899 ATPase; InterPro IPR000792; KEGG:
FT                   nca:Noca_4382 regulatory protein, LuxR; PFAM: regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; SPTR:
FT                   Putative LuxR-family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46704"
FT                   /db_xref="GOA:E6SFG6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG6"
FT                   /protein_id="ADU46704.1"
FT                   /translation="MPFTTGALVGRGSELARLAGAVGLVDSLDGTRGGVAIVSGDAGIG
FT                   KSRLLLQLTTDADRAGWLTATGHCVGQAGSALAYLPFVELIGLLDRMTPDVVTQVLGSH
FT                   PSLARLLPRRDGVTGTGGGADSAKEASPGLVAESVHALLTAFGAVRPTLVVIEDVHWAD
FT                   HSSRDLLTLLLTRSFTTPVALVASYRSDDLHRKHPLHETLAVWDRIPHVTHVSLAPLPD
FT                   AAVDEIVEGIEGVPDDPRTMREITRRAEGNPFFAEELAASAVAGQQVSGGLGRVLRARV
FT                   ERLDETSQAVVRAVSLKGGRFIGHELLSRIMGLPEPVLEAAIAQAVEHHVLETSWPPAY
FT                   TFRHALLGETAAESLLPGERLRLHKAYAAVLAECPHLAPASELARHAAASGDLPAAVAA
FT                   SRAAAESAMEVGGPQDALFHLEQALSWLEDDAAERDEVTIRASEAATAAGDILRAVRLL
FT                   KDGIDHPGPRQRDEVRAELLARYATLSRMLDLPVEGLALTSRAVDLLPDEETPRQVLVL
FT                   IAHVQQLVDAGELDDAVRTGDEVMATAERLGLRESLLEIRTILTRVIEAQQDLDAVEAH
FT                   LRGLFADVRGTDNPIQLRLTHQLAAVAHRRGDLRGALAHYDEGTRIARRLHQEWAPWGL
FT                   DCRLLSGLTAYELGDWDDVPSRLALASKVTPQPARALFEAAALGVAVGRGEPVPPSRLS
FT                   SLREWWYVDGLAVVLTVMPGIDLLGDAGDLTGMLEIACEAAQTLDTAWGKYHASVRLAA
FT                   LVAGQVATLAPRAAPELRERAARTVDDLGRRADQLVAKVIRTSQGTGWDPTDVDVLGES
FT                   STETWAWARRLRAERLRLAWVLGQEDPPPVEEMLVAWRASVEAFDRLGHVFEAARSRGR
FT                   LAAALHAAGRDVDSRQVAGSAREVAVRLRARPLLAELDALAPRAPAAATAVELTPRELE
FT                   VLALVARGLSNGQIGKQLYISTKTVSVHVSNLLAKLGASGRTEAAAIARDRALVP"
FT   gene            complement(157380..157565)
FT                   /locus_tag="Intca_0144"
FT   CDS_pept        complement(157380..157565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g242007 hypothetical protein;
FT                   SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46705"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG7"
FT                   /protein_id="ADU46705.1"
FT                   /translation="MTSSITLITPEFMKAELEARYGPRPRRSWRRRPASSLAVEARAHR
FT                   QRTDEAARLAVPARAH"
FT   gene            157843..160371
FT                   /locus_tag="Intca_0145"
FT   CDS_pept        157843..160371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0145"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873:
FT                   IPR009081; KEGG: saq:Sare_1889 AMP-dependent synthetase and
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   AMP-dependent synthetase and ligase; PFAM:
FT                   Phosphopantetheine attachment site; AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46706"
FT                   /db_xref="GOA:E6SFG8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG8"
FT                   /protein_id="ADU46706.1"
FT                   /translation="MRDLAAHGSARAVVTEHDTLTYAELARRVDAVAESLGTTRRLVLV
FT                   EGANHLESLIGYLGALAGGHVVLLVPSDSEPARETLRAAYDPDVVIGASGALDVVREGS
FT                   AHELHPDLALLLSTSGSTGSPKLVRLSWDNLAANADQIATYLNIRETDCAATTLPLHYC
FT                   YGLSVVHSHLSRGASIALTDLSVVDECFWNLFRAARATTLAGVPYTFELLERVRFGSMD
FT                   LPSLRYVTQAGGRLDPEQVRHWAEVGQARGWDLFVMYGQTEATARMAYLPPRLALEQPA
FT                   SIGVPVPGGSLEVVDGELVYSGPNVMLGYADSPADLALPRTVERLRTGDLGRRTEAGVY
FT                   EVTGRSSRFTKVLGHRIDLDQVERGLRLGGHDVRCAGREGLLAVTVAAGEVGPGLVDHG
FT                   ALRRSAARLSGAPPSAIAVVAVPEQPVRANGKTDYAAVLSLVEQLRDRTDGSATARTDT
FT                   VAALYAAALGRSQVAPSSTFVTLGGDSLSYVEVSIRLEQLLGTLPPSWHVTPVAELEEA
FT                   AARRPAATHRTVETNVWLRALAIVLIVGTHADVFVLQGTAHALLVLVGYNVVRFALASE
FT                   RARDRLRSLARGATRVVLPTLAVVVPAHLFGGYYETRNLFLANWLLGEERLGPPWRFWF
FT                   IEALVVALVVAMGLVAVPAVARAERRWPLGLPLALTALAFTLRLPLFPLPGPRMQGSAL
FT                   VVLFLFFLGWSIARASTRRQQWIVTAVAVVSVGTFSGNPARDLLSLAFVLLLIWKPLSR
FT                   IPVALVPVVQVLAASSLYVYVIHWQVLEHLWGAPVPAFVASLAVGVGYWWVWTNGVDAV
FT                   RRGVSGLSAGRSAAGREPTIGLSADLLRSY"
FT   gene            complement(160388..161863)
FT                   /locus_tag="Intca_0146"
FT   CDS_pept        complement(160388..161863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0146"
FT                   /product="TspO/MBR family protein"
FT                   /note="COGs: COG0702 nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509: IPR004307; KEGG:
FT                   krh:KRH_21230 hypothetical protein; PFAM: TspO/MBR family
FT                   protein; NAD-dependent epimerase/dehydratase; SPTR:
FT                   Putative uncharacterized protein; PFAM: TspO/MBR family;
FT                   NmrA-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46707"
FT                   /db_xref="GOA:E6SFG9"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG9"
FT                   /protein_id="ADU46707.1"
FT                   /translation="MTTQPTPSPTRSPTIRSQNGPAEPNDGRTALVTGASGYIGGQLVP
FT                   RLLAEGWQVRVLTRRAGSLDARPWARDVEVVVGDVADRGDLGKALSGIRTAYYLVHSMD
FT                   DEPDFAERDREAADTFGSAARDAGVQRIVYLGGLHPAGEELSPHLASRVEVGRILLESG
FT                   VPTAVLQAAVVLGDGSVSFDMLRHLTTRLPAMVAPKWLDNRIQPIAVDDVITLLAGAAD
FT                   LPADANRTFDIGGPDVLTYREMIQRFAAVTGMRQRVVVTIPVLTPRLASHWVGLVTPIG
FT                   AGIAKPLVGSLVHEVVAKESDLLELVPVPGGLTGFDDAVRRAMEGTTPDTALRNLALTG
FT                   AAVTAAAVVGSLATQPDSRWYRSLDLPAWQPPKATFPIVWSLLYADLAASTAATLTGLD
FT                   REGEGAARKRRTYLAAVGANLALNAGWSVVFWRARRPGAAALESAVLTASGADLARRSA
FT                   AVNPVAGRALVPYVAWCGFATVLSAAIERRNRR"
FT   gene            complement(161868..162587)
FT                   /locus_tag="Intca_0147"
FT   CDS_pept        complement(161868..162587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0147"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675; KEGG: kse:Ksed_01050 CAAX amino
FT                   terminal protease family; PFAM: Abortive infection protein;
FT                   SPTR: Probable integral membrane protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46708"
FT                   /db_xref="GOA:E6SFH0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH0"
FT                   /protein_id="ADU46708.1"
FT                   /translation="MRGPVAELRAFLDAALVRPVVDARPDPPEMRLRRRVVVALSLVVG
FT                   AALLAWALRIRPGDALFYAATLGLAGVWCLGAVLSGPLRLGLGHTRRGARERPVLQSLA
FT                   LGGLLLGAFLAGALVVARIPVLRAPVDDLLDHARFGSLPVVLGITVLNGIAEELYFRGA
FT                   LYAALPKHAVAVTTVLYALTTVGSGVPLLVLAAVVVGLVTALQRRVTGGILGPVITHVT
FT                   WSTGMLLLLPPVLDLVR"
FT   gene            complement(162592..163959)
FT                   /locus_tag="Intca_0148"
FT   CDS_pept        complement(162592..163959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0148"
FT                   /product="deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /note="COGs: COG0415 Deoxyribodipyrimidine photolyase;
FT                   InterProIPR006050: IPR005101: IPR001969: IPR018394: IPR
FT                   002081; KEGG: kra:Krad_3554 deoxyribodipyrimidine
FT                   photo-lyase; PFAM: DNA photolyase FAD-binding; DNA
FT                   photolyase domain protein; PRIAM: Deoxyribodipyrimidine
FT                   photo-lyase; SPTR: Phr; PFAM: FAD binding domain of DNA
FT                   photolyase; DNA photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46709"
FT                   /db_xref="GOA:E6SFH1"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH1"
FT                   /protein_id="ADU46709.1"
FT                   /translation="MTVSVLWFRRDLRVSDHPALLAALDSGTSVLPVFVLDPRLLETGQ
FT                   PRSRRLITSLRALADSLDGHLVVRTGNPVDVIPQVAREVGAESVHVTRETTPFGRTRDA
FT                   AVEVALQSEGRRLVATGTPYAAGPGLVVTQSGAPYRVFTPFARAWRAHGSPPPAAPPLR
FT                   IPWFDGDVGGLALPAVAAAGGPGGIAGEAAARTRWLDFLAEGRLGRYAEDRDRPDLDAT
FT                   SRMSVPLKYGEIHPRTLLADIASHPDGRTGGAATFVTELAWREFYADVLWHRPESAWED
FT                   LRPDLGRMSYDDGPETDRLVAAWREGRTGYPIVDAGMRQLLGEGWMHNRLRMITASFLT
FT                   KDLHVWWPVGARYFLDQLLDGDIASNSHGWQWVAGTGTDAAPYFRVLNPLRQAHRFDPE
FT                   GDYVRRWVPELGHLAGPAVHEPWDHPNGYAHGYPGRVVDHDAERREALARYELSRR"
FT   gene            complement(163956..164708)
FT                   /locus_tag="Intca_0149"
FT   CDS_pept        complement(163956..164708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0149"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002198: IPR002347;
FT                   KEGG: avi:Avi_0085 gluconate 5-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46710"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH2"
FT                   /protein_id="ADU46710.1"
FT                   /translation="MRTALSGQRVWVVGASSGIGAQLADELVRRGASVAVSGRRASELE
FT                   AVSGGRMRSVPVDVTDADAVAEAADAVRDGLGGLDMVIHSAGYWKQFDAASWDREVFAR
FT                   HVEVNLLGLNNVLASVVPGFVEQGRGHVVGIASVAGYRGLAGSEAYGATKAAQLNLLEA
FT                   MRASLPPHGVRVTTVAPGFVRTEMTSVNEFPMPFLIDADEAGRTIADGLERGDDTIVFP
FT                   KRMAVAMAVARLVPGRLWTTLTSRGGRA"
FT   sig_peptide     complement(164637..164708)
FT                   /locus_tag="Intca_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(164705..166015)
FT                   /locus_tag="Intca_0150"
FT   CDS_pept        complement(164705..166015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0150"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="COGs: COG2230 Cyclopropane fatty acid synthase and
FT                   related methyltransferase; InterPro IPR003333; KEGG:
FT                   sen:SACE_6753 cyclopropane-fatty-acyl-phospholipid
FT                   synthase; PFAM: Cyclopropane-fatty-acyl-phospholipid
FT                   synthase; PRIAM: Cyclopropane-fatty-acyl-phospholipid
FT                   synthase; SPTR: Probable
FT                   cyclopropane-fatty-acyl-phospholipid synthase UfaA1
FT                   (Cyclopropane fatty acid synthase) (CFA synthase); PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46711"
FT                   /db_xref="GOA:E6SFH3"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH3"
FT                   /protein_id="ADU46711.1"
FT                   /translation="MTTIQPRPIVPTLAPVRLQAKLARTIFEQVLDRVPVDVVLPDGSP
FT                   LRRSAASGSEPSGIRPTVELRRPSAFFERLAHHPKIGIGEAYMAGDWRAAPGTDLADVL
FT                   RPFAARLTTAIPRRWVALRQVVDRAIPHDQRNTLTGSRRNIEAHYDLSNDLFAAFLDET
FT                   LTYSSALFDRTAPLEGQSLEDAQLRKVHAILDEARVGDGTTVLEIGTGWGTLAIEAARR
FT                   GAHVTTLTLSREQAALARDRAAAAGVADRVDVRLEDYREARGSYDAIVSVEMIEAVGEE
FT                   YWPTYFRAIDSLLAPGGVAAIQAILMAHDRYLVTRRSYGWIQKHIFPGGLIPSLRAITD
FT                   VTQRGTELRVTGVHRFGLDYAETLRRWRATFMAQWPQVERLGFDETFRRKWEFYLAYCE
FT                   AGFDSGYLDVAQIRFERQGPDTVRGASPSAGVAQDAA"
FT   sig_peptide     complement(165950..166015)
FT                   /locus_tag="Intca_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(166012..166767)
FT                   /locus_tag="Intca_0151"
FT   CDS_pept        complement(166012..166767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0151"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="COGs: COG3496 conserved hypothetical protein;
FT                   InterPro IPR010775; KEGG: rer:RER_23220 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1365; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1365)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46712"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH4"
FT                   /protein_id="ADU46712.1"
FT                   /translation="MSPSIRPPRVPSLVEGVVSHTRRTPVTHRFRHRHHQWLVDLDDLP
FT                   RLPWPLSVLARFDPADHLDGGHEEGGIRGDLDRFLASRGVALPAGARVLMLAHARSVGH
FT                   VFDPLSVFWCIAPDGRLVATVLEVHNTYGGRHAYLVDVDDHGRAVVDKAFYVSPFNDVS
FT                   GEYHVRLVLDEQRVAVAIRLTRDGQPILDASVSGRPRPATLRTILSTTARHALMTYRVT
FT                   ALIRWHGVRLWMRRLPVVPRPHRLEEAAR"
FT   gene            complement(166764..168044)
FT                   /locus_tag="Intca_0152"
FT   CDS_pept        complement(166764..168044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0152"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG2907 NAD/FAD-binding protein; InterPro
FT                   IPR002937; KEGG: sgr:SGR_5877 putative amine
FT                   oxidoreductase; PFAM: amine oxidase; SPTR: Amine oxidase;
FT                   PFAM: Flavin containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46713"
FT                   /db_xref="GOA:E6SFH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH5"
FT                   /protein_id="ADU46713.1"
FT                   /translation="MNQSRPQTTAVIGAGVAGLTAAHVLSRTDAVTLFEADQRVGGHAH
FT                   THTVPAGGSTAGASPLRIDSGFIVHNERTYPHLLRLFAELDVETRPTEMSMSITCEQCG
FT                   LSYAGGRGLAGILAQPWRAADPRFVRLLTEVPRFHRAARRLLADPSAEPTWGEFLREGR
FT                   FSTYFVRHFAIPLVATVWSCGDLDAETYPARHLFQFLDHHGMLTVSGSPEWRTVVGGSA
FT                   TYVDRLVARLADVRRSAPVTAVERHDDGVDVRVGDAAPERFDRVVIATHANQALDLLAD
FT                   ALPQEKEDLAAIRYSRNTVWLHRDSSVLPAAKQARAAWNYRMQSCDAPSPQVAVSYWMN
FT                   RLQGLPGTEDHIVTLDPGDHVDPDTVTADLSYEHPVFTAPAVAAAGRLRSAGGERLAFA
FT                   GAHLGWGFHEDGCRSGVEAAQSFGVSW"
FT   sig_peptide     complement(167967..168044)
FT                   /locus_tag="Intca_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            168186..168614
FT                   /locus_tag="Intca_0153"
FT   CDS_pept        168186..168614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0153"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="InterPro IPR019587; KEGG: art:Arth_3265 hypothetical
FT                   protein; PFAM: Polyketide cyclase/dehydrase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Polyketide cyclase /
FT                   dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46714"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH6"
FT                   /protein_id="ADU46714.1"
FT                   /translation="MQFVRTLTVPVPADRVFAYLADFTTTTEWDPATVRTERISGTGGV
FT                   GTRYRNRSRFMGREAEVDYVVTELDPGRHILLRGENQSLVAHDDMTVEGDASGATVTYS
FT                   ASFDLKGLWKLATPVLAPALKRLVDQGADGLRRTLHTL"
FT   sig_peptide     168186..168239
FT                   /locus_tag="Intca_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            168640..169554
FT                   /locus_tag="Intca_0154"
FT   CDS_pept        168640..169554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0154"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551: IPR006158; KEGG: msv:Mesil_1484
FT                   transcriptional regulator, MerR family; PFAM: regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR:
FT                   Probable transcriptional regulator; PFAM: MerR family
FT                   regulatory protein; B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46715"
FT                   /db_xref="GOA:E6SFH7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH7"
FT                   /protein_id="ADU46715.1"
FT                   /translation="MYTIKRAAELTGISLSTLRAWERRYGVVSPVRSDGRYRLYSADDL
FT                   RALGIMAALVNEGWSAREAAAETKARIEGSAQRGGPLSQVDGGPGPRPEASVLPRVDEL
FT                   VAAAGRLDTVAVSDILDEAFSRAGFERVVDDWLMPALSVIGESWADGRISIAGEHLLSH
FT                   AIQRRLAAAYEAAGARTSGPIVTLGLPPGARHELGVLAFAVALRRAGYSTAYLGADLPA
FT                   GDWGEAVAARGATAVVLAVPRAADVVPARQVCEELLAAHPDLVVFVGGGRQDEVGAGSV
FT                   PLGHDMRTAVEAVDSALNARRPA"
FT   gene            complement(169612..170529)
FT                   /locus_tag="Intca_0155"
FT   CDS_pept        complement(169612..170529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0155"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: art:Arth_0341 polysaccharide deacetylase;
FT                   PFAM: polysaccharide deacetylase; SPTR: Polysaccharide
FT                   deacetylase; manually curated; PFAM: Polysaccharide
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46716"
FT                   /db_xref="GOA:E6SFH8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH8"
FT                   /protein_id="ADU46716.1"
FT                   /translation="MTSSSPTASAPTSSATSTPSPRTSPRASTSPSSTSATSRPPTSRP
FT                   VTTPPRPPTRTPTAPPPTTSRASTTTPATTPRTTPTTTSPRPVACTVPSGLLGRDLTRV
FT                   PTDRKVVALTFDAGASNDGVASILATLADKGVPRTFFLTGDFVDAFPSSARAMAKYPIG
FT                   NHTYNHPDLTTLSDSGIRTEINSAESRIKAVTGQDPRPYFRFPFGAVTTRTIAVVNAEC
FT                   YVPFRWTVDTLGWKGTSGGQSVGTVVNRVLDAAVPGEIVLMHVGAHPKDGSTLDADALP
FT                   RMIDALRARGYGFVTLQAVLGSAP"
FT   gene            170787..172568
FT                   /locus_tag="Intca_0156"
FT   CDS_pept        170787..172568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0156"
FT                   /product="sulfate transporter"
FT                   /note="COGs: COG0659 Sulfate permease and related
FT                   transporter (MFS superfamily); InterPro IPR011547:
FT                   IPR002645: IPR001902; KEGG: cef:CE1093 putative sulfate
FT                   transport protein; PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR:
FT                   Putative sulfate transport protein; TIGRFAM: sulfate
FT                   transporter; PFAM: Sulfate transporter family; STAS domain;
FT                   TIGRFAM: high affinity sulphate transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46717"
FT                   /db_xref="GOA:E6SFH9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH9"
FT                   /protein_id="ADU46717.1"
FT                   /translation="MTDQREGAAGWARFAPGLGVLLSYDRTWLRGDVLAGVTVSAYLVP
FT                   QVMAYAEVAGLPAITGLWACAPALVVYALLGSSRQLSVGPESTTALMTAAGIGALAGAA
FT                   GGGRHAELAALLALAVGVVCVLAWLVRLGFLAELLSKPVLVGYMAGIAALMVVSQLGKI
FT                   TGIEVESGTFLEEVGFTATHLGEVHGPTLAVASGVLVVLLAFGRWARRWPGPLIAMVSA
FT                   AALVHVLGLTDEGVRVVGEVPRGLPPLSVPQLDDVEIWKLLPAAVGVAVVAYSDNVLTG
FT                   RAFALKRRETIDSNQEFVALGAANIASSLASGFPVSSSGSRTVLANAMGARTQLHSLVS
FT                   VAVLAATMFWLGPVLATFPTAALGGVVVYAALRLVDVAELRRITGFRHSELVLSLATTV
FT                   AVLGFGVLPGIGVAIVLSVLDLLRRIVHPHDGVLGYVPNVAGMHDIDDHSNAVQVPGLV
FT                   VYRYDSPLFFANSHDFVRRALQAVADSQRTAPVEWFLLNAEANTEVDLTAVDALDTLRL
FT                   SLADEGIRFAMARVKQDMREPLDAAGFVDKVGEDHIFPTLPTAVAAYAKWYEEHHGRPL
FT                   EGLEIPPVPRQPRPPER"
FT   gene            complement(172565..173521)
FT                   /locus_tag="Intca_0157"
FT   CDS_pept        complement(172565..173521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0157"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: nml:Namu_0174
FT                   cobalamin biosynthesis protein CobD; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR: Cobalamin biosynthesis
FT                   protein CobD; TIGRFAM: cobalamin biosynthesis protein CobD;
FT                   PFAM: CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis
FT                   protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46718"
FT                   /db_xref="GOA:E6SFI0"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI0"
FT                   /protein_id="ADU46718.1"
FT                   /translation="MRKGVGSRAVGLAVGFVADRLLGDPRRWHPVAGFGTAAAAVEQRT
FT                   YAAGRAAGVRHVALLVGSTAALGLVAERATRHSPVVHVAATAAATWAVLGGRSLVREGD
FT                   VIGRHLSSGDRVAARRRLRHLVGRDTTRLDEHEVARACVESVAENTSDAVVAPLLWGGL
FT                   LGIPGLVGYRAVNTLDAMIGHRTPRYRDFGWAAARLDDLVNWVPARVAAGAALTGAALD
FT                   GDSLAVSRAREAIRHDAPAHPSPNGGVVEAAFAGVLGVTLGGTNVYEGRAEDRGTLGTG
FT                   PSPAASDIARANRLSRRVGTFSLVGAIALALLPRPRR"
FT   sig_peptide     complement(173453..173521)
FT                   /locus_tag="Intca_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            173626..174459
FT                   /locus_tag="Intca_0158"
FT   CDS_pept        173626..174459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0158"
FT                   /product="protein of unknown function DUF299"
FT                   /note="COGs: COG1806 conserved hypothetical protein;
FT                   InterPro IPR005177; KEGG: gob:Gobs_2870 protein of unknown
FT                   function DUF299; PFAM: protein of unknown function DUF299;
FT                   SPTR: Putative phosphotransferase JNB_14093; PFAM: Domain
FT                   of unknown function (DUF299)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46719"
FT                   /db_xref="GOA:E6SFI1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI1"
FT                   /protein_id="ADU46719.1"
FT                   /translation="MSAPDSVTETPVFFLAGGTGISAETLGNLMLNQFPSVRFRRRKIP
FT                   FITTPEIARQVVAEMDEAMTDAVTPLVFSTVADEEVRTELVKTKCAFIDLFGSHLDAIE
FT                   RVLHVNASHNRAGLHGLGDPRRYEQRMKAIEYAMEHDDGQSLRNLAQAELILVAPSRCG
FT                   KTPTSMYLALQHGIRVANYPLVEEDLHSTHLPRPIRDYADRCFGLVSTPARLSQVRSER
FT                   RPGSTYASLAQCSYELRRAEALYRAHRIPSINSASMSVEEMAAVIMQTRHMSNLA"
FT   gene            174529..176904
FT                   /locus_tag="Intca_0159"
FT   CDS_pept        174529..176904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0159"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="COGs: COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase; InterProIPR002192: IPR008279:
FT                   IPR000121: IPR006319: IPR 018274; KEGG: gob:Gobs_2869
FT                   phosphoenolpyruvate synthase; PFAM: pyruvate phosphate
FT                   dikinase PEP/pyruvate-binding; PEP-utilising protein mobile
FT                   region; PEP-utilizing protein; PRIAM: Pyruvate, water
FT                   dikinase; SPTR: Phosphoenolpyruvate synthase; TIGRFAM:
FT                   phosphoenolpyruvate synthase; PFAM: PEP-utilising enzyme,
FT                   TIM barrel domain; PEP-utilising enzyme, mobile domain;
FT                   Pyruvate phosphate dikinase, PEP/pyruvate binding domain;
FT                   TIGRFAM: phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46720"
FT                   /db_xref="GOA:E6SFI2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI2"
FT                   /protein_id="ADU46720.1"
FT                   /translation="MTANILWFRELGLTDVESVGGKNASLGEMVQHLSKAGVSVPDGFA
FT                   TTAEAYRRFLAHEGLADRINALLDDLDVDDVRRLAEVGRQIRDAVESQPFPADLEGEIR
FT                   TAYDELVAAAGAEGVSWAVRSSATAEDLPDASFAGQQETFLNITGIDNILHAIKLVFAS
FT                   LYNDRAIAYRVHSNFDHSGVALSAGVQRMVRSDIGASGVMFTIDTESGFPDAVFITSAY
FT                   GLGEGVVQGAVNPDEYYVYKPALRAGRPAILKRGIGAKATKMVYTEDASVGRTTEFVPV
FT                   DPADQVRFSLTDDEVTELAQHAVRIEEHYGRPMDIEWARDGIDGRIYVLQARPETVKSR
FT                   SGSSTLRRFRMNERGPVVAEGRAIGQKVGSGAVRVLSDVASMHEFQPGEVLVADMTDPD
FT                   WEPIMKRASAIVTNRGGRTCHAAIIARELGIPAVVGSGNATRVLEDGHEVTVSCAEGDT
FT                   GFVYEGLLDFSVDETALDEMPEVPVKIMMNVGTPEQAFEFSRLPHHGIGLARLEFIINR
FT                   QIGIHPRALLELDDQEPALRDEIRGLIGAYDSPREFFVKRLSEGVAMLAAAFAPEPVIV
FT                   RMSDFKSNEYANLVGGERYEPHEENPMIGYRGASRYLSADFAECFAMEAEALKFVRDEM
FT                   GLTNVKIMIPFVRTVAEAKGVIDLLAQHGLRRGENDLQVIMMCEVPSNAVNADAFLEHF
FT                   DGFSIGSNDMTQLTLGLDRDSALVAGSFDERDPAVKKMLSMAIQACRAQGKYVGICGQG
FT                   PSDHVDLAEWLLDEGIETMSLNPDTVVDTWLRLAKHAG"
FT   gene            complement(176995..177672)
FT                   /locus_tag="Intca_0160"
FT   CDS_pept        complement(176995..177672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0160"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="InterPro IPR002941: IPR017985: IPR001091; KEGG:
FT                   cur:cur_0372 hypothetical protein; PFAM: DNA methylase
FT                   N-4/N-6 domain protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46721"
FT                   /db_xref="GOA:E6SFI3"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI3"
FT                   /protein_id="ADU46721.1"
FT                   /translation="MPRPPLPPYLTATASELVAERAAGADGADEDVHFTEHLATEVIER
FT                   LSEPGDLVLDPFAGFGTTLLVADRLGRRGLGVELLPERVDVVRARVPAATIVEGDARGL
FT                   HRLLPDAGPVALCLTSPPYRTANDHPHDPLTAYTLVAGSYASYLADLASIAQALRRILR
FT                   PGGHLVLNVANIRHAGHTTALAWDVARAVGAVLPFQGETVVHWDTLPHDFTGDYLLTFR
FT                   RES"
FT   sig_peptide     complement(177601..177672)
FT                   /locus_tag="Intca_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(177686..178135)
FT                   /locus_tag="Intca_0161"
FT   CDS_pept        complement(177686..178135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0161"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763: IPR001307; KEGG: dds:Ddes_2090
FT                   rhodanese domain protein; PFAM: Rhodanese domain protein;
FT                   SMART: Rhodanese domain protein; SPTR: Thiosulfate
FT                   sulfurtransferase; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46722"
FT                   /db_xref="GOA:E6SFI4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI4"
FT                   /protein_id="ADU46722.1"
FT                   /translation="MSHRRRLAGALLALVAVTSVAACSGADDGANLSSAAPAAAAPTLG
FT                   AELSAADFAAAAKREGTTILDVRTPAEFAEGHLPGAVNVDVEGADFATTIAQLDPKAPY
FT                   AVYCRSGNRSAAALQLMQAAGFTSAYHLSGGIGAWQQSGGEVVTD"
FT   sig_peptide     complement(178016..178135)
FT                   /locus_tag="Intca_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            178358..179032
FT                   /locus_tag="Intca_0162"
FT   CDS_pept        178358..179032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0162"
FT                   /product="protein of unknown function SprT"
FT                   /note="InterPro IPR006640; KEGG: nca:Noca_3805 protein of
FT                   unknown function SprT; SMART: protein of unknown function
FT                   SprT; SPTR: Putative uncharacterized protein; PFAM:
FT                   SprT-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46723"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y3"
FT                   /protein_id="ADU46723.1"
FT                   /translation="MELSAALKLGRELMAVHGLSDWTLNLDRARTRAGVCRAGKREISL
FT                   SAHLTRLHPEAEVRDTILHEIAHALVGPGHGHDAVWRARARQIGCSGNRCSSVDAPGIA
FT                   GAWVGTCPAGHRTTRHRMPSRVVLCTRCRGTEAARVFDWTHQGRRVAMHPNYAAELDAL
FT                   LLGLPHLAPGRLGPGAVVRIAAPGQYDGAVGRIVTRGRTRYRVRVPDGLLSVPFAWVEQ
FT                   AG"
FT   gene            complement(179335..180639)
FT                   /locus_tag="Intca_0163"
FT   CDS_pept        complement(179335..180639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0163"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000878:
FT                   IPR000182; KEGG: tbi:Tbis_1840 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Acetyltransferase (GNAT)
FT                   family; Tetrapyrrole (Corrin/Porphyrin) Methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46724"
FT                   /db_xref="GOA:E6S5Y4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y4"
FT                   /protein_id="ADU46724.1"
FT                   /translation="MTQRIHLVGIGLGDRAHLTGAGVAALDTLDVFVVLEPGAAAQREL
FT                   LAAVLTDPGAHRFIEPTAHPSEPGSVGSPAAYGVGSVSERVTAIVRELGELAPPAATVG
FT                   LLVPGVPALEAAAHELATALADRLGIGVAITPGVGAAQLLAARHGITLGRDGTGVHAIS
FT                   GQHLVDTYQPHDGDAVVVADAELRCLELAELYPDLEVFWGAHLDRDDEVLVSGRLGDLA
FT                   ATLTAARRRAEDASGWLLDAYVVRPSEPSSEVGPPPWPPVERLSDGVLGLRPLTASDWQ
FT                   TVLEENNDEESLRWSLTGPLTEAEARRRAASARRDWVSGRAARFVMVDEATGHPAGAIG
FT                   VLRMGPPDIGLIGYGVLPRFRGRGFTTRALELLAEWAFSATSIVRLELGHKVGNVASGV
FT                   VAARAGFVRESVLTGRLRNVDGTFSDEVTYARVRR"
FT   gene            180741..182288
FT                   /locus_tag="Intca_0164"
FT   CDS_pept        180741..182288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0164"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: cfl:Cfla_0709
FT                   sodium:neurotransmitter symporter; PFAM:
FT                   sodium:neurotransmitter symporter; SPTR: Transporter; PFAM:
FT                   Sodium:neurotransmitter symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46725"
FT                   /db_xref="GOA:E6S5Y5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y5"
FT                   /protein_id="ADU46725.1"
FT                   /translation="MSTTADDDVREAHRGMFSTRRVFILAAIGSAVGLGNIWRFPYVAY
FT                   ENGGGAFILPYLVALFTAGIPFLFLEYALGHKYRGSAPLSFARLSRGTEGLGWWQVGVC
FT                   FMIAVYYAAVLAWALSYTVFSFTKAWGDDPNAFLFGDYLKVAESPGISLDFVPGVIIPL
FT                   LIVWGALIVLMALGVQRGVGRTSVIFIPVLVVAFLALVIQGLTLPGAGAGLDALFAPNW
FT                   GALADPAVWAAAYGQIFFSLSIGFGIMITYASYVKRRTDMTGSAMVVGLSNSGFEILAG
FT                   IGVFAALGFMAQASGVAVSEVATSGLGLAFVAFPAIVNEAPAGAVLGVLFFFSLVLAGF
FT                   TSLISVLEVVVSAVRDKFEMSRIGATLWVTIPCAILSLLGFSTTSGLFVLDILDHFINR
FT                   FGILLVAVVSMVVLAWVVRALPGLQSHLNTDGSVPVRWWWIALVSVISPIALGFVLVRE
FT                   FIAVVQEPYGGGDYPQWMLLAFGWGAALAVLVAGFLLARIPWRPDTPVHGHGREDSE"
FT   gene            182285..182410
FT                   /locus_tag="Intca_0165"
FT   CDS_pept        182285..182410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: krh:KRH_05460 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46726"
FT                   /db_xref="GOA:E6S5Y6"
FT                   /db_xref="InterPro:IPR031596"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y6"
FT                   /protein_id="ADU46726.1"
FT                   /translation="MSTGAIVMMVVAILVVWGGLALAIHNLRRGDAQEMLEHRDL"
FT   sig_peptide     182285..182353
FT                   /locus_tag="Intca_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(182470..183279)
FT                   /locus_tag="Intca_0166"
FT   CDS_pept        complement(182470..183279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0166"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="COGs: COG1695 transcriptional regulator protein;
FT                   InterPro IPR005149; KEGG: nca:Noca_4612 PadR family
FT                   transcriptional regulator; PFAM: transcriptional regulator
FT                   PadR family protein; SPTR: Transcriptional regulator, PadR
FT                   family; PFAM: Transcriptional regulator PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46727"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y7"
FT                   /protein_id="ADU46727.1"
FT                   /translation="MNSDRNEANEEWGWSDATAGSEGEPGHRGGPSRHGGHRRPGGPGG
FT                   RGPGGPDWLTGFGGWGPEGGPWGGMGRGRPGPPPWIHDLIRQFGGPALGPEQHPRGPRR
FT                   PRARRGDVRAAILDVLAGNEMNGYQLIQEIAERTGGGWKPSPGSVYPTIQQLEDEGLVE
FT                   GRDAEGRRLLRLTDEGRRYVEEHPDEMGATWAPFEPENDAAPDDRASHGFSGTPGGDGL
FT                   MPVVGQVMGAMWQVVTTGTAQQRAEARDILSETRRRLYQLLADGDPE"
FT   gene            183478..183936
FT                   /locus_tag="Intca_0167"
FT   CDS_pept        183478..183936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0167"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="InterPro IPR003594; KEGG: tcu:Tcur_0095 putative
FT                   anti-sigma regulatory factor, serine/threonine protein
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   SPTR: Putative regulatory protein; PFAM: Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46728"
FT                   /db_xref="GOA:E6S5Y8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y8"
FT                   /protein_id="ADU46728.1"
FT                   /translation="MPTMQDGSPSTDGGAPQNEKRTVRIPWAPSAAPSIRKTLVADLAS
FT                   REVPGEVVEEAEIVVSELVANAIRHAKPLADGAIRVHWKVKNNVVEVEVTDGGGPTVPR
FT                   PAPPTTWGPGGRGLRIVRSLAHEWGVLDEPNGRTVWASVGGPSRRRSH"
FT   gene            184008..184895
FT                   /locus_tag="Intca_0168"
FT   CDS_pept        184008..184895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_01600 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46729"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Y9"
FT                   /protein_id="ADU46729.1"
FT                   /translation="MGKASRRSRADRAARTSGPVPAPFVARPFEGLPGETDWVAMREIV
FT                   PAATATIRFAPGRAPEGAPETVTIATVLPLAWPALHRDTGEILVGIQSGNASGDTSRDI
FT                   AQAIELAVAAQPGSPVTTLPVSTLDTDRLQDLLDLDAPFDIEVHEGFEFWVGDSELDVE
FT                   GQQSLERANESAIPTVKLAAAPSAYWCRIGERCYVRWVLPHDEETSTSALARLHAAGTS
FT                   TLGDGGRLLGCFRSSGLLIPVWEVDPEAEPESHEAGVSAMHGRLEGAVTSTAPLTAAER
FT                   GARAGLMNRQVTLR"
FT   gene            184907..185659
FT                   /locus_tag="Intca_0169"
FT   CDS_pept        184907..185659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0169"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: kra:Krad_0170
FT                   glycosyl transferase family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase family 2; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46730"
FT                   /db_xref="GOA:E6S5Z0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z0"
FT                   /protein_id="ADU46730.1"
FT                   /translation="MPHPTGVAVPFVVVIPAKDEATRIAATIRGVRRIPGVGEIVVVDD
FT                   GSSDSTARIAAGAGAEVVRLTRNHGKADALMSGLGRMAGLQRVGRVDPGAAVLFVDADL
FT                   ADSATEVGALVGPVLRGEADLTIATLPPQRSAGGGRGLVVGLARRGIEELTGWSPVQPL
FT                   SGMRCLSPAARAAATPFARGWGVEVGMTIDVLEAGLVVREIPCDLHHRVTGADWRGQLH
FT                   RAAQYRDVALALAVRRLRLGSHRHSHRP"
FT   gene            complement(185882..188074)
FT                   /locus_tag="Intca_0170"
FT   CDS_pept        complement(185882..188074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcu:Tcur_0118 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46731"
FT                   /db_xref="GOA:E6S5Z1"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z1"
FT                   /protein_id="ADU46731.1"
FT                   /translation="MIRRHPVKALFAVLVLLVAALGWSYATRDSVPVPRTADPEPGESL
FT                   VVVGVGGISWDDVSPDRTPVLWGLLRDGAAASVSVKTLHLTTCPTDGWATLSAGEAAGP
FT                   RAEGDRPECTPLPEVVGDEQRGYSVAGFAQIAAASREAAFEARLGLLGDSFADHTSCVG
FT                   AIGPGAAIAAARSDGTVQRYTPFDEGTLVSELAQCPITLVDAGGILTTDPDPATHVEQT
FT                   TAIEQRIARVRDAMPTGADLIVAGLADRDQQERLRILTATGPHYAPGILASASTRMEGI
FT                   AQISDVTATILQRGGVRAVEPIGGRALSASPSPNNSESTAAKKLTRLTDIDTKADAMHR
FT                   IVVPFLVVWLASALLALLVLWILWQRARPWHTRLSRQRILRLTRLVGLVAAGMPAATFL
FT                   ANLVPWWRWSPPSSVLVALLSALVLLISGLIAVVCLNGPWGSSALGPLAVLSAVTASVI
FT                   GLDLMTGSRLQMSSIFGLQPLVGGRFYGMGNVAFALYGSAVILLCAAMAHALRRRNAPR
FT                   LAVVVVLVLGGAALAVDVLPAWGADFGGPIALVPALGLLLMRVAGIRVSVRSLALVGLA
FT                   AGLVVGLVCYLDWRRPEQYRSHPGRFFQTLLDGDAFTVVSRKLLANVELSTAHPALLAV
FT                   VLAVAAFVLVLVLQPGRFGTAPFARLVEEAPLLRDGLVAILVLSAIGFLTNDSGAAIPP
FT                   VAMVLTVPLVVAAVAAFMAIERANEPVRRRRDRHHR"
FT   sig_peptide     complement(187964..188074)
FT                   /locus_tag="Intca_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            188121..188705
FT                   /locus_tag="Intca_0171"
FT   CDS_pept        188121..188705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_2106 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46732"
FT                   /db_xref="GOA:E6S5Z2"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z2"
FT                   /protein_id="ADU46732.1"
FT                   /translation="MGGGHSLERERASPAAGLPLRIVEEPTLAVVAIGAAVVAVLALAL
FT                   AVGAQLRLARIRRDFRALAGDGSTDIARVAAGQNHRIDRIATEVSRLREQVRTAEDDVR
FT                   QSLRHVAVVRYDAFGDMGGRLSFSAAIVDDLGDGIVISSIHARSESRTYAKGVVGGRSS
FT                   ITLSPEEQQALAAATRGEPRSVHPSSQKDVP"
FT   gene            188702..189646
FT                   /locus_tag="Intca_0172"
FT   CDS_pept        188702..189646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0172"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="COGs: COG0077 Prephenate dehydratase; InterPro
FT                   IPR001086: IPR002912: IPR018528; KEGG: ach:Achl_0282
FT                   prephenate dehydratase; PFAM: prephenate dehydratase; amino
FT                   acid-binding ACT domain protein; SPTR: Prephenate
FT                   dehydratase; PFAM: Prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46733"
FT                   /db_xref="GOA:E6S5Z3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z3"
FT                   /protein_id="ADU46733.1"
FT                   /translation="MTPRTLSDLHRFGYLGPRGTFTQMALDAWDGARHEEQVPFGSVDA
FT                   ALDALRSAEIDAAMVPIENSVEGGVSATLDALATGDPLVVIGEVLVPVTFVLCARAGMP
FT                   LGSVRSVGTHPHAWAQVRSWMASHLPDAVYVPTLSTAASAAALGRPGDVMFDAGVCAPV
FT                   AAANEGLEILAGDIGDNRAAVTRFVLVSRPGTLPEPTGADKTTVVLFQRDDHAGGLLEL
FT                   LEQFAVRGVNMTRLESRPTGEAMGSYCFSIDFEGHVQDARVGETLMGLRRVCADVRFLG
FT                   SYPRADGVRADARLGTADHDFDAARLWLEQLRS"
FT   gene            189978..190367
FT                   /locus_tag="Intca_0173"
FT   CDS_pept        189978..190367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4153 outer membrane efflux protein;
FT                   SPTR: Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46734"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z4"
FT                   /protein_id="ADU46734.1"
FT                   /translation="MTDYVPGRLLVAGFPRTDDAPWLVELRLALAEVGLTFRLTAASRR
FT                   RTRRLRSTGGRALELLDAMWVSTVVLEPLVGPGVERPEIPQAWWVIERLRSRRPTLADR
FT                   LSLVETRRPATMGTEPLGLVIGVPA"
FT   gene            complement(190383..191543)
FT                   /locus_tag="Intca_0174"
FT   CDS_pept        complement(190383..191543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0174"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG1228 Imidazolonepropionase and related
FT                   amidohydrolase; InterPro IPR006680; KEGG: mbt:JTY_0076
FT                   hypothetical protein; PFAM: amidohydrolase; SPTR: Putative
FT                   uncharacterized protein Mb0076; PFAM: Amidohydrolase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46735"
FT                   /db_xref="GOA:E6S5Z5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z5"
FT                   /protein_id="ADU46735.1"
FT                   /translation="MHVIRADQVFDGDGFLGRTDVVLDGPNVVAVQEPTEYASEVVVED
FT                   LGAVTVLPGLVDAHQHLTWDAADPLAWHAEHDDSALLEQGRTNARRALSAGITTIRDLG
FT                   SRGRVALQLRDETARSPLAGPTLLVAGPALTTPGGHCWFLGGACTDADELVKAVARLDE
FT                   AGVDVIKVMATGGNITPGSAPHESQFRLPELKAVVDAAHAAGLPVAAHAHGTGGVSDAT
FT                   AAGVDTIEHCSFFTEDGIAEDPALIQRLAESGVAVSLTAGTPPGTTPLPAVAARMPALL
FT                   AHIRGLREAGVRCILGTDAGIGPGKPHDVLPLAVVQGVELVGIPVTEALAMCTSRAAEA
FT                   IGLGRRAGRLRAGGTADVLVVTGLVDEDPAALVRPARVLRGGVRVA"
FT   gene            191685..192566
FT                   /locus_tag="Intca_0175"
FT   CDS_pept        191685..192566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0175"
FT                   /product="iron permease FTR1"
FT                   /note="COGs: COG0672 High-affinity Fe2+/Pb2+ permease;
FT                   InterPro IPR004923; KEGG: amd:AMED_8204 high-affinity iron
FT                   transporter; PFAM: iron permease FTR1; SPTR: Putative
FT                   membrane protein; PFAM: Iron permease FTR1 family; TIGRFAM:
FT                   FTR1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46736"
FT                   /db_xref="GOA:E6S5Z6"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z6"
FT                   /protein_id="ADU46736.1"
FT                   /translation="MLVSNALIGLREGLEAALVVVILVAFLVKTGRHWALRWVWLGVGT
FT                   AVALSVVLGAVLTYGTSRLSFEQQELIGGFASIIAVVFVTGMVFWMRSAARTISGELRG
FT                   RLDRALDLGPLAVALVGFLGVGREGLETAIFFYATTQAAGAGNSQPLIGWVLGLTGAVA
FT                   LGGLIYRGAVRINLTAFFRWTGSLLVVVAAGILAYGLHDLQEAGLLPGLGAVAFDISSV
FT                   IAHDGWIGNLLRGIFNFTPQPTVVQAVAWSLYVAVILTLFLRPQRTSQPSEPAPSAPAD
FT                   LAARPSEPAPAN"
FT   sig_peptide     191685..191789
FT                   /locus_tag="Intca_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            192652..193365
FT                   /pseudo
FT                   /locus_tag="Intca_0176"
FT   gene            193365..193595
FT                   /pseudo
FT                   /locus_tag="Intca_0177"
FT   gene            complement(193726..194838)
FT                   /locus_tag="Intca_0178"
FT   CDS_pept        complement(193726..194838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0178"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="COGs: COG1597 Sphingosine kinase; InterPro
FT                   IPR001206; KEGG: xce:Xcel_3229 diacylglycerol kinase
FT                   catalytic region; PFAM: diacylglycerol kinase catalytic
FT                   region; SMART: diacylglycerol kinase catalytic region;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Diacylglycerol kinase catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46737"
FT                   /db_xref="GOA:E6S5Z7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z7"
FT                   /protein_id="ADU46737.1"
FT                   /translation="MPNDYLPWIIAGIVALALGVGVVLGTRTAARSTTALRRRRGRGRP
FT                   SRDQFRSGQRSTALKRAAVVVNPTKFADLPMIHERITSTSHACGWGDPLFYETTVADPG
FT                   TGQAERAVAEGASVVCSLGGDGTVRAVASGLIGTETPLGILPAGTGNLLARNLDLPVLA
FT                   LDEAVRVALTGRNRRIDVGEVVIGEMDAHGQPVGGGELVTQQFLVMAGMGLDALIMGGT
FT                   NEALKQRVGWAAYLLTGFKHLVSPEFRTQVRLDAEPEFKRRARAVVIGNCGRLLGGLVL
FT                   MPDARVDDQQLDVVIASPRGFVGWAPVIARVLTRQRKGHSTLDHKVCREIRVRVDHPLP
FT                   VQVDGDVVGEATEINATVRPAALTVRVPIT"
FT   sig_peptide     complement(194749..194838)
FT                   /locus_tag="Intca_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            194894..195451
FT                   /locus_tag="Intca_0179"
FT   CDS_pept        194894..195451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3194 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Mycothiol
FT                   maleylpyruvate isomerase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46738"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z8"
FT                   /protein_id="ADU46738.1"
FT                   /translation="MSDARVQPSDPGPAAPDTADWTWVLTRPCLDCGFDPADVRPDGVS
FT                   EILLDARRRFTRVLERDDVALRPAEGVWSPLEYSAHVRDVCDVMRGRLEQILAAGGATV
FT                   QFANWDQDAAAVEKSYWRSDPTVLRRELDAAFDAAAAAFARPTPGQWSWPGLRSNGSPF
FT                   TVDTLGRYFVHDVLHHLWDVRG"
FT   gene            195448..196506
FT                   /locus_tag="Intca_0180"
FT   CDS_pept        195448..196506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0180"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: cfl:Cfla_0574
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46739"
FT                   /db_xref="GOA:E6S5Z9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S5Z9"
FT                   /protein_id="ADU46739.1"
FT                   /translation="MSPVAVGGNAHALPEARVPDPREAPPIRWGILAPGGIANEFAAAV
FT                   TAGTASTVVAVGSRSEQRARDFADRHHIPRAFGSYEALVADEAVDAVYVASPHSEHHDH
FT                   ALLALEAGKPVLVEKAFTRNVTEARAVIRAGADRGLLVAEAMWARYLPHYDVVRQVLDG
FT                   GVLGDLVLLRADHSQLLHPNGPERLARPELAGGALLDLGVYPVSFADHLLGPPASVAAR
FT                   GSLTECGVDATVGIVLAYVSGAVAVLTCSMLARTPCAAEIIGTEARLELDGPFYAPTAV
FT                   RLLSPAGEVLAERPGTLPGPLRGFSYQAAEFARCLSAGSRECPAMPHAATLRVMSTMDE
FT                   IRAQVGVRYPGE"
FT   gene            complement(196555..197370)
FT                   /locus_tag="Intca_0181"
FT   CDS_pept        complement(196555..197370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0181"
FT                   /product="pentapeptide repeat protein"
FT                   /note="COGs: COG1357 Uncharacterized low-complexity
FT                   protein; InterPro IPR001646; KEGG: kfl:Kfla_5660
FT                   pentapeptide repeat protein; PFAM: pentapeptide repeat
FT                   protein; SPTR: Pentapeptide repeat protein; PFAM: Protein
FT                   of unknown function (DUF664); Pentapeptide repeats (8
FT                   copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46740"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S600"
FT                   /protein_id="ADU46740.1"
FT                   /translation="MERFHDADLSGSEFEHVRLVGAQLRRVDLTGARFQTVDLTGAAFR
FT                   DVDFSGAQLRGVLVREADVSGEILSLTVNGVDVVPLVEAELDRRDPERPTLLRPTDPAG
FT                   FREAWAINERRWAGTVERARLLPAEALYQSVDGEWSFIETLRHLAFATDSWVSRAIQGD
FT                   PSPWHPLELPWDEMPDTPGVPRDRAARPSLDEALALRHDGMARVGRLLEGLTDESLAAQ
FT                   TTPVDGPGWPEPRSYPVRECLLTVLNEEYHHRLFAERDLSVLEAGDSGT"
FT   gene            complement(197444..198877)
FT                   /locus_tag="Intca_0182"
FT   CDS_pept        complement(197444..198877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0182"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COGs: COG0364 Glucose-6-phosphate 1-dehydrogenase;
FT                   InterPro IPR001282: IPR019796; KEGG: mjl:Mjls_5357
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; PRIAM:
FT                   Glucose-6-phosphate dehydrogenase; SPTR:
FT                   Glucose-6-phosphate 1-dehydrogenase; TIGRFAM:
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   Glucose-6-phosphate dehydrogenase, C-terminal domain;
FT                   Glucose-6-phosphate dehydrogenase, NAD binding domain;
FT                   TIGRFAM: glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46741"
FT                   /db_xref="GOA:E6S601"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S601"
FT                   /protein_id="ADU46741.1"
FT                   /translation="MPATTVVLFGATGDLAKRKLLPGMLHLHESQLLEGLRIVATSLED
FT                   LTRDEFLDLVVDSVRTHSSRDVTDEDLREFADRIHWVPGSGGPAALRQAVLDSEEILGS
FT                   GARRLHYLSVPPAAALAVVRQIAAAGLVERSRIIMEKPFGTDLASARKLNAELHEVFAE
FT                   EQIFRIDHFLGKEPAQNILAFRFANGLFEPIWHRNHIDHIQIDVPETLGLEQRADFYEA
FT                   TGAYRDMVVTHLFQVLAFTAMEPPTSLEPSAITEEKSKVFRSMLTIDPHDVVRGQYVGY
FT                   RDEEGVAPDSETETFVALKCFVDNWRWAGVPFFLRTGKRMSEGARIISIAFKEPPRTMF
FT                   PPSSGVGDDGPDHLTFDLADRARMSLSFYGKRPGPGMALDKLSMQFSMQDTDWAGAALE
FT                   AYERLIYDAARGDATLFTRAEGIERLWEISQPLLDNPPPVRPYQQGTWGPNQIHQLVAP
FT                   FAWRLPFERPWRDPNLMGA"
FT   gene            199110..200222
FT                   /locus_tag="Intca_0183"
FT   CDS_pept        199110..200222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0183"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="InterPro IPR005135; KEGG: bcv:Bcav_1530
FT                   endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR: Phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46742"
FT                   /db_xref="GOA:E6S602"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E6S602"
FT                   /protein_id="ADU46742.1"
FT                   /translation="MDVRFATFNASLNRNAAGQLVADLSTPDNAQARAVAEIIQRTSPD
FT                   VLLINEFDFYEDGVAAELFRDNYLEVSQNGADPADYPYYFVAPSNTGIPSGFDLNDNGV
FT                   VGGPDDAYGFGFFPGQYGMVVYSKYPIDAGAVRTFQHFLWKDLPGNLMPTEFYSPEEQA
FT                   VLRLSSKSHWDVPISIGKHTVHFLVSHPTPPTFDGPEDRNGRRNNDEIRFWADYVGSPA
FT                   RSAYVYDDAGATGGLRPGELFVIAGDQNSDPNDGDSVEGSIEALLNHPRINTSVTPSSA
FT                   GAVEASALQGGANLSHTGNPAYDTADFNDNPAPGNLRADYVLPSRALRILDAAVFWPVQ
FT                   ADPLSRLTGTFPFPSSDHRLVWVDVRLPHR"
FT   sig_peptide     199110..199205
FT                   /locus_tag="Intca_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            200356..201291
FT                   /locus_tag="Intca_0184"
FT   CDS_pept        200356..201291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0184"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593: IPR017871;
FT                   KEGG: nca:Noca_4497 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46743"
FT                   /db_xref="GOA:E6S603"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S603"
FT                   /protein_id="ADU46743.1"
FT                   /translation="MCRAVADRHRGPMIHVDRLTKRYGPFTAVDDISFEVRPGQVTGFL
FT                   GPNGAGKSTAMRIMAGLTPATSGTATVLGRAYGHLPNPGRHVGVLLDASAQHAGRTGRE
FT                   ILSLSAIMMGVDRRRVDEMLDLVGLTDKEAARRVRNYSLGMRQRLGIANALLGDPEVLI
FT                   LDEPANGLDPAGIRWMRDLLRGYANQGGTVLLSSHLLNEIERVADEIIVIGHGRIVAQG
FT                   TKDALLSGAGTYVRSTDDAGLAAALALEDISVSPAATGGLHVDAEPMTVGQVAAASGVV
FT                   LVELRSGDSRGLEEMFLELTAATAREEVAA"
FT   gene            201288..202127
FT                   /locus_tag="Intca_0185"
FT   CDS_pept        201288..202127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_0762 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46744"
FT                   /db_xref="GOA:E6S604"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E6S604"
FT                   /protein_id="ADU46744.1"
FT                   /translation="MSTTVTEPVASPTAESPLPATARIPERIPGERPTAAIPFSRLLLV
FT                   ELRKMVDTRAGRWLLIGIGAVIALALTIMFFNESGHHPFAAYLQATTMPMAVILPVVGI
FT                   LAVTSEWSQRTGLVTYTLEPRRARVTWAKFLGAMLAGVAAIALSLALAAVMHQGAITLR
FT                   GYSGDWSLDNKALLGASLYVLLGIAQGVGFGMLLRNTPAAIVLYFVLPIAWGILGDLVS
FT                   WLDGAASWLDMNRTMNPLFLVESMTGEQWAQLATSVGVWVALPVALGIWMLHRAEVK"
FT   gene            complement(202245..202988)
FT                   /locus_tag="Intca_0186"
FT   CDS_pept        complement(202245..202988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0186"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR003439: IPR005876: IPR003593:
FT                   IPR017871; KEGG: sro:Sros_0995 cobalt ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Cobalt ABC transporter, ATPase subunit;
FT                   TIGRFAM: cobalt ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter; TIGRFAM: cobalt transport protein ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46745"
FT                   /db_xref="GOA:E6S605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S605"
FT                   /protein_id="ADU46745.1"
FT                   /translation="MSGAPVLDVRGLAYAYPDGHQALFGVDLQVGRGERVSLLGPNGAG
FT                   KTTLVLHLNGILTAGAGAVTVSGLPVTKANLREIRRRVGIVFQDPDDQLFMPTVRDDVA
FT                   FGPANLGLRGDELDSRVHRALDQVGMVEFVDRPPHHLSFGQRRRVAVATVLAMEPEILV
FT                   LDEPSSNLDPASRRELAEILRSLDVTVLMVTHDLPYALELCERAVVLSGGVIAADGPTR
FT                   DLLADADLMARHRLELPYGFTVPTP"
FT   gene            complement(202985..203749)
FT                   /locus_tag="Intca_0187"
FT   CDS_pept        complement(202985..203749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0187"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339: IPR012809; KEGG: nca:Noca_1329 cobalt ABC
FT                   transporter, inner membrane subunit CbiQ; PFAM: cobalt
FT                   transport protein; SPTR: Cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: Cobalt transport
FT                   protein; TIGRFAM: cobalt ABC transporter, permease protein
FT                   CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46746"
FT                   /db_xref="GOA:E6S606"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:E6S606"
FT                   /protein_id="ADU46746.1"
FT                   /translation="MGAPHGHALHFHGHSPVHRLPAHVKIVVLVGYVLAVVATPRGVFW
FT                   PYAAHLLALAGAVAVSRVPLAHLAKRLVIEVPFVVFALVLPFVATGPRTAVGPVEISQP
FT                   GLEAAAALLAKGTLGVLASLLLAATTEPRDIVAGFEKLRLPQSLVQIMSFMLRYTEVVA
FT                   ADLGRMRVARESRGFRARSVRQWPALGATLGALFIRSYERGERVHLAMLSRGYTGRLPT
FT                   LRPLTATGSQWAASGLLPIACGLVSAAAVLAG"
FT   sig_peptide     complement(203645..203749)
FT                   /locus_tag="Intca_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(203755..204794)
FT                   /pseudo
FT                   /locus_tag="Intca_0188"
FT   gene            complement(204852..205133)
FT                   /locus_tag="Intca_0189"
FT   CDS_pept        complement(204852..205133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ncr:NCU01878 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46747"
FT                   /db_xref="UniProtKB/TrEMBL:E6S607"
FT                   /protein_id="ADU46747.1"
FT                   /translation="MPTVKDDAPPAASPEREPGLDLATASLAALRATLRLIEDRITEEL
FT                   TTGGYRPGPGHTARIGRLRRREQDLRAEIAHRRSERPQVGRPPAERPE"
FT   gene            205231..206556
FT                   /locus_tag="Intca_0190"
FT   CDS_pept        205231..206556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0190"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COGs: COG0172 Seryl-tRNA synthetase;
FT                   InterProIPR015866: IPR002314: IPR002317: IPR018156: IPR
FT                   006195; KEGG: kra:Krad_0249 seryl-tRNA synthetase; PFAM:
FT                   tRNA synthetase class II (G H P and S); Seryl-tRNA
FT                   synthetase, class IIa-like; PRIAM: Serine--tRNA ligase;
FT                   SPTR: Seryl-tRNA synthetase; TIGRFAM: seryl-tRNA
FT                   synthetase; PFAM: Seryl-tRNA synthetase N-terminal domain;
FT                   tRNA synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46748"
FT                   /db_xref="GOA:E6S608"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E6S608"
FT                   /protein_id="ADU46748.1"
FT                   /translation="MIDIKLLRDEPDRVRASQLARGEDPGIVDAILAADERRRSSLGEF
FT                   ETLRAEQKAVSKDVGAAMGAFQRAKKAGAPDAAHLESVAHAARAKAAHLSDQVKALESN
FT                   ADEAGAELERLLRKVGNVIIDGVPTGGEDDYVVVETIGTPRDFASEGFEPLDHLALGER
FT                   LGAIDMERGAKVGGARFYYLTGVGALLELALLNMAMAQATAAGFTAMITPTMARPEIML
FT                   GAGFIDAHADEVYRLEADDLYLTGTSEVALAGFHADEIIDLSAGPKRYAGWSACYRREA
FT                   GSHGKDTRGIIRVHQFHKVEMFSYCRPEDAEAEHGRLLDWEREMLAKIEVPYRIIDTAA
FT                   GDLGSPAARKFDCEAWVPTQGKYRELTSTSNCTTYQARRLNTRERDPNGSGTRTVATLN
FT                   GTLGTTRWLVAILENHQQPDGSVVVPEALRPFLGMDVLKPIA"
FT   gene            206637..208019
FT                   /locus_tag="Intca_0191"
FT   CDS_pept        206637..208019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0191"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR001327: IPR004099: IPR013027: IPR000815; KEGG:
FT                   sco:SCO3443 pyridine nucleotide-disulphide oxidoreductase;
FT                   PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Putative
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46749"
FT                   /db_xref="GOA:E6S609"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S609"
FT                   /protein_id="ADU46749.1"
FT                   /translation="MESFDIIVVGMGPGGEHVANTLAERGLRVLGVDHGLVGGECPYWG
FT                   CIPTKMMVRAADALAEARRVDGLAGSVADVTPDWSLVARRIRDEATDGWDDQVAVERFT
FT                   QKGGTFLRGTGRVVGPGRVDVDGKPYAAGRGIVVNVGSRAATPPIEGLEGVPFWTNREF
FT                   AEATALPGSLVVLGGGAIGCELAQVAARFGTTVTVVESAPRLLSPEEPEASERIATVFE
FT                   REGITVHVGSAAATVAASPTPGEADQVEVTLEDGTVLRAERLLVATGRRTDPGAVGLGS
FT                   VGVAADARVAPTDEWCRVAPGVWAVGDITGKGAFTHVSMYQAAIVVRDVLGEAGPPADY
FT                   RAVPRVTFTDPEVATVGLTEAQARDQGVEVRTGFTALGSTTRGWIHGVGGDGFIKLVAD
FT                   PGRGLLVGATVMGPAAGEVMGALAVAVHAEVPLDRLRSMIHAYPTFHRGIEDALADLDQ
FT                   RS"
FT   gene            208086..209039
FT                   /locus_tag="Intca_0192"
FT   CDS_pept        208086..209039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0192"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307; KEGG: kfl:Kfla_1685 myo-inosose-2
FT                   dehydratase; PFAM: Xylose isomerase domain-containing
FT                   protein TIM barrel; PRIAM: Myo-inosose-2 dehydratase; SPTR:
FT                   Putative myo-inositol catabolism protein; PFAM: Xylose
FT                   isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46750"
FT                   /db_xref="GOA:E6S610"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6S610"
FT                   /protein_id="ADU46750.1"
FT                   /translation="MTGQQQDEPSRVVHPHHLGARPLAERIASAPISWGVSEVPGWGWQ
FT                   FDPHTVLAQMAEIGLAATELGPDGFLPDAPADRARLLGAAGLEAAGQLVSVVLHDATVD
FT                   PLAALEPTMDALVATEATTLVVVAATGVAEDATRPDLDEAAWATLLRNLDRLEDAARSR
FT                   GLVAAVHASADTVVQSLVELQRVIDGSRIGVCLDTGHLALVGDDPLSLALARPGRIVHV
FT                   HLKDVRAAVAERVRSGELSLVEAVRAGLHPPLGQGDLDIAAIVSALEDAGYDGWYVLEQ
FT                   DVVLDEDPGAPGPARQVEQSLDHLLGLAAQWSGVGA"
FT   sig_peptide     208086..208244
FT                   /locus_tag="Intca_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209122..210036
FT                   /locus_tag="Intca_0193"
FT   CDS_pept        209122..210036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0193"
FT                   /product="superoxide dismutase"
FT                   /note="KEGG: ami:Amir_2064 superoxide dismutase; SPTR:
FT                   Superoxide dismutase; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46751"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E6S611"
FT                   /protein_id="ADU46751.1"
FT                   /translation="MGPRQALVTTALVAVFAATPLGAATAEPFPDVIPIPTGSLPEGIA
FT                   TGTGTSVYAGSRADGSVWLGDLRTGAGDLLVEGGEGRMAVGVKVASGLLFVSGGTYGDA
FT                   HVYDARTGAEVAAYHLTDGPAFINDVTVTHEAAYFTNSAAAELYAVELARGVPTGEFAT
FT                   IPLVGEWQQVAGFNANGIAATPDGQTLLVINSTSGILYSVDPHTGVALAVDTGGTDLTA
FT                   GDGILLRGRTLYVVRNVLNEVVELRLAPDHRSAAHVVTLTDPDFDVPTTIAMQGSRLYV
FT                   VNARFTTPPGPTTEHDIVKVDGE"
FT   sig_peptide     209122..209199
FT                   /locus_tag="Intca_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            210111..210353
FT                   /locus_tag="Intca_0194"
FT   CDS_pept        210111..210353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_6838 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46752"
FT                   /db_xref="GOA:E6S612"
FT                   /db_xref="UniProtKB/TrEMBL:E6S612"
FT                   /protein_id="ADU46752.1"
FT                   /translation="MGAGVTLAVIGAILAFAVRADPDGISLPTVGVILMIAGGLLIVLS
FT                   RRDHHRKVITSVEPAEDPRDPPHVYTEGAIRDIDD"
FT   sig_peptide     210111..210170
FT                   /locus_tag="Intca_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(210379..211176)
FT                   /locus_tag="Intca_0195"
FT   CDS_pept        complement(210379..211176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: det:DET0762 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46753"
FT                   /db_xref="GOA:E6S613"
FT                   /db_xref="InterPro:IPR041113"
FT                   /db_xref="UniProtKB/TrEMBL:E6S613"
FT                   /protein_id="ADU46753.1"
FT                   /translation="MTATGSTETHPPTTATGVDETRLRSLRRWNLALSLLHLGQAVTVL
FT                   LLATGFAVTVTQSLPSGPPGTPPGSPEALFDLPIGASVAVFLTLAALDHLLTATALRKS
FT                   YEQDLRGGINRFRWMEYSVSATLMVVLIALYTGIDGISALIGIAGANVAMILFGWLQEL
FT                   ANPPGRSATTMKPFWFGCVAGAAPWVAIGYNLVAADEVPGFVVGIFVSLFVFFNSFALN
FT                   QWLQYRQVGRWRSYAFGEKTYLALSLVAKSALAWQIFAGSLVG"
FT   sig_peptide     complement(211054..211176)
FT                   /locus_tag="Intca_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            211283..212164
FT                   /locus_tag="Intca_0196"
FT   CDS_pept        211283..212164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0196"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200: IPR006379: IPR000150; KEGG:
FT                   cfl:Cfla_3183 HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; SPTR: Hydrolase (HAD superfamily protein); TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: Cof subfamily of IIB
FT                   subfamily of haloacid dehalogenase superfamily;
FT                   HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46754"
FT                   /db_xref="GOA:E6S614"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S614"
FT                   /protein_id="ADU46754.1"
FT                   /translation="MALRMLALDLDGTTLNHLGELSDAVRDAVAALPDEVIVVVATGRS
FT                   IIATTPVLESLGVTEGFAVCANGAVTIELDRRAPTGYAIVDTVTFDPKPVLERLRVALP
FT                   EARIAVEELGVGFKVSRHFPEGELMGQARVVDWDELVAHPVTRVTLRQPEATAEEFMEM
FT                   VERAGLHGVSYAVGWSAWLDINPEGVSKASALELIRRRIGVEPIHTVAVGDQRNDLEML
FT                   RWAAWGVAMGNAPDEVKAVADEVTGHVDEDGLVPVVRGIAEAARHGVPFRDGVPSTAAD
FT                   RSPWRADRRTGT"
FT   gene            212281..212721
FT                   /locus_tag="Intca_0197"
FT   CDS_pept        212281..212721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0197"
FT                   /product="YCII-related protein"
FT                   /note="COGs: COG3795 conserved hypothetical protein;
FT                   InterPro IPR005545; KEGG: pfo:Pfl01_2519 DGPFAETKE; PFAM:
FT                   YCII-related; SPTR: Conserved DGPFAETKE domain protein;
FT                   PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46755"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6S615"
FT                   /protein_id="ADU46755.1"
FT                   /translation="MRYLIIVPGGPETESDTIGTEQQLADMQSYQEEMLRAGVYVDGQG
FT                   LHPTAKGALVSFEDDEWVVTDGPFAEAKEIIAGFSVIDVSSREEALEWVKRWPRSCAPG
FT                   PGQALELRQMYAPEDFDEQLSPELRERERALREAAARQAAQG"
FT   gene            212782..214089
FT                   /locus_tag="Intca_0198"
FT   CDS_pept        212782..214089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0198"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="COGs: COG4941 RNA polymerase sigma factor containing
FT                   a TPR repeat domain; InterPro IPR007627: IPR013249:
FT                   IPR014284; KEGG: cwo:Cwoe_0348 putative RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2; SPTR: Putative
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46756"
FT                   /db_xref="GOA:E6S616"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S616"
FT                   /protein_id="ADU46756.1"
FT                   /translation="MTPPAPPVTDPDADSDVVRRTLEAVWRMETAKVTAVVARVVGDIG
FT                   LAEDLAQDAFLQALEQWPRDGLPDKPGAWLTATARRRAIDRIRRDVNLRDKLQQVGHAE
FT                   ELRAADLAEAGFDRALEDIDDDVLGLVFAACHPVLTAQARISLTLRMIGGLTTREIARA
FT                   FLTTESTIGQRISRAKKALRADGVTIEVPSGADLPPRLASVLEVVYLIFNEGYAATSGR
FT                   DWVRGDLMEEAIRLGRVLAALAPQEPEVHGLVALMEIQASRTRARMAADGSPVLLLDQD
FT                   RTRWDWSLIRHALGALDRATQLSGIPGPYVLQAAIAACHARARTPDETDWARIVTLYDE
FT                   LARVRPSPVVDLNRAVAMAYAAGPGPALAVVDRLVESGSLADYHLLPSVRGDLLRKLGR
FT                   EEEAREEFRRAAAMTDNAAERRLLLERAGDDGPVDP"
FT   gene            214168..215091
FT                   /locus_tag="Intca_0199"
FT   CDS_pept        214168..215091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0248 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uracil DNA
FT                   glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46757"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6S617"
FT                   /protein_id="ADU46757.1"
FT                   /translation="MVTHRSCPGYVDEPFASLVADYPGAEAYPPGDFRVEWGPVFHRGR
FT                   LDGSARVLVIGQDPATHEAISRRVLVGEAGQRVQGLLARLGITHSYVMLNVYLYSVFGQ
FT                   AAGYRHVKDPDIVDYRHRWLDAVLLDSASPSVTPSVTPSVTPSVTPSVTPSVASSGVTA
FT                   VIALGTLAKRAFGLWEDSSPEREARSRRLHLAAVRHPTYAEGSARASGQPLEDTTAAQL
FT                   ADWSAHLPALGAAVSPEVTPNLRSYGESWTERDLVAIPEQDLPPGAPAWWRAVDAWAVR
FT                   DGADAQEKRATIRVAVPKGARSWPTL"
FT   gene            215076..216473
FT                   /locus_tag="Intca_0200"
FT   CDS_pept        215076..216473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0200"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   bja:blr0249 hypothetical protein; PFAM: amidohydrolase;
FT                   SPTR: Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46758"
FT                   /db_xref="GOA:E6S618"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6S618"
FT                   /protein_id="ADU46758.1"
FT                   /translation="MADPLRTGPAPGRVTFEEAYSRGITDELPPPPRRARALPPTPFAL
FT                   RGAVITPQGAWSSGYVTVADGRIDRVSRRRPTSVPVLETDGVILPGLLDLHGHPEFNVF
FT                   AAWEPPKLYPNRYAWRRSTAYKQLVRDPQNALLSTVPPQTQTRYAEVRALVGGVTGIQG
FT                   AASASSSASAEPLVRNIDRWAFGAHRARSLVDLPTGSFGKESFDRIMAHIAAGTVNAFY
FT                   LHLSEGRRGDAVSTEEFRRFVDLGAATPATNIIHGSALTVTDLHEVADAGCRLVWSPQS
FT                   NLRLYGETTLAGEALRAGVPVALGADWLPSGSTSLLAEMKVARRELARQEHPVAAADLV
FT                   AMVTSVAARVAGLDEHLGSVAVGRPADLLVLERHHRDPYESVCLADPSWVELVCIGGDV
FT                   TYGRVDWFDELSGGAVGSTVEDLVAWGKPMRLDTGFQSPASGATPSLTEIRALLTAAYP
FT                   PVGPIFA"
FT   gene            complement(216537..217097)
FT                   /locus_tag="Intca_0201"
FT   CDS_pept        complement(216537..217097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0201"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COGs: COG1335 Amidase related to nicotinamidase;
FT                   InterPro IPR000868; KEGG: sna:Snas_0489 isochorismatase
FT                   hydrolase; PFAM: isochorismatase hydrolase; SPTR:
FT                   Isochorismatase hydrolase; PFAM: Isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46759"
FT                   /db_xref="GOA:E6S619"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6S619"
FT                   /protein_id="ADU46759.1"
FT                   /translation="MASLENRPKSALLVIDMQKGVVADAHDRERVIANIGSLVARARDE
FT                   DVPVVWVQHSDEGLAEGSEEWELVPELAPGDDEPLVGKHYGDSFEETDLESVLAKRAVG
FT                   RVVVTGAQTDACVRATLHGALVRGYDATLVSDAHTTEDLRQWGVPVSPEQVIAHTNAYW
FT                   SEAKAPGRKGDTASTAEVSLRTD"
FT   gene            217202..218068
FT                   /locus_tag="Intca_0202"
FT   CDS_pept        217202..218068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0202"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro IPR013123:
FT                   IPR001537; KEGG: kse:Ksed_01710 rRNA methylase; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; SPTR: Putative rRNA
FT                   methylase; PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46760"
FT                   /db_xref="GOA:E6S620"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E6S620"
FT                   /protein_id="ADU46760.1"
FT                   /translation="MNLPRDLSVSSPSNPRLKALVALRRRRVREETGQTIVEGHEEIRL
FT                   ALDAGVTPRTLYVAEELFSPSGRAGSQEIGTQPELVERLRAAGVEIVRLSPAAYAKVSY
FT                   REGPDGLLAVVDDVGVPLASLTVDGPSWLGLVAQRIEKPGNLGAMLRTADAAGVDAVVA
FT                   ADPVTDWGNPNVVRASKGTLFAVPVASGTTSETLAWLAHGAVTLVVTTPETDLLHTEVD
FT                   YTGRVAIAVGSEKHGVDDALLVAATHRVRIPMHGRANSLNVSVAAAVVLYEAVRQRASR
FT                   LGGGGPA"
FT   gene            218117..218752
FT                   /locus_tag="Intca_0203"
FT   CDS_pept        218117..218752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_01720 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46761"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E6S621"
FT                   /protein_id="ADU46761.1"
FT                   /translation="MRVDHVSYAAEHDGLQATAERLSKLLGVEPVDGGVHPRFGTRNVI
FT                   LPLADRNYVEVVEVLDHPASDKAPFGQAVRARSEAGGGWLGWVVAVDDLTAAEKRLGRE
FT                   AVEGNRHRPDGTELRWRQIGIRGLIADPQVPYFIQWEDISLHPANGSAAQVHIGELQIA
FT                   GDPARVREWLGVDQTFDKGDIHFTFVAPHGTPGLLSVTFHTPDGDVTI"
FT   gene            complement(218742..220340)
FT                   /locus_tag="Intca_0204"
FT   CDS_pept        complement(218742..220340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0204"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG2217 Cation transport ATPase; InterPro
FT                   IPR005834; KEGG: mmi:MMAR_0231 cation transporter p-type
FT                   ATPase CtpA_1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: Cation-transporting P-type ATPase; PFAM:
FT                   haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46762"
FT                   /db_xref="GOA:E6S622"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S622"
FT                   /protein_id="ADU46762.1"
FT                   /translation="MQGRDDRSPRADELLTKLRRRAEALGSAGAAPGEDEHPAAALPPP
FT                   GARTRLLVALVLTVPVVALALWANDSTVGRWAQVVLTAVILGWSAGPLVAAAGRTLRAL
FT                   RPGPEVPVLLGALVSWAASVTDLVRGAPEQWFGAAAVAATLLLLVRHVAARAHAAAGPD
FT                   MPQPTVVDRLARWLPPVVLLVAAVVLVVRLRTGHTVADSLSATVAVLFIASLPAAALAA
FT                   PAALAAARARAERRLGSAPAAGTLARSATLDTVVINRTGLLTTGDLALRKIAVTGRLSK
FT                   KAALIAAAAVEQGSDHPIARAIVAGAGQARVDLPRIRDFEANPGEGASARIKDTEVTVG
FT                   KAALFEHVDPDLLAHADGTPGRTVFVGWGGRARAALTVEDTIRETSRPAIARLKGLGLT
FT                   PYLLTEDGEAHARGLAAAVGIDPGKVRSGSRGKAVTDRDLVSELQRQGRRVAVIGRAPA
FT                   DLLFEADDVDAAADTIELAQQTQSVIRQHLGWALGYNVIALVAGGLGWVHPTWAAILAA
FT                   VAAFVPLASAQRLRS"
FT   gene            220512..220823
FT                   /locus_tag="Intca_0205"
FT   CDS_pept        220512..220823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0205"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein;
FT                   InterPro IPR003735; KEGG: kfl:Kfla_1527 protein of unknown
FT                   function DUF156; PFAM: protein of unknown function DUF156;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46763"
FT                   /db_xref="GOA:E6S623"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S623"
FT                   /protein_id="ADU46763.1"
FT                   /translation="MDHGTEAVPHQHGYIHQKDDYLRRLRRIEGQSRGLQRMVDEEQYC
FT                   IDILTQISAMTKALQSVALGLLDEHIAHCVVDAVREGGPDAELKLKEASDAIARLVRS"
FT   gene            complement(220918..221277)
FT                   /pseudo
FT                   /locus_tag="Intca_0206"
FT   gene            221298..221513
FT                   /locus_tag="Intca_0207"
FT   CDS_pept        221298..221513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0207"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="InterPro IPR006121: IPR017969: IPR000428; KEGG:
FT                   amd:AMED_3508 heavy metal transport/detoxification protein;
FT                   PFAM: Heavy metal transport/detoxification protein; SPTR:
FT                   Putative metal-binding protein; PFAM:
FT                   Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46764"
FT                   /db_xref="GOA:E6S624"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E6S624"
FT                   /protein_id="ADU46764.1"
FT                   /translation="MSETSTYTVVGMTCGHCVASVSEEVGAIAGVENVDVDLASGRVTV
FT                   TSGSPVDEAQVKAAVEEAGYALAPTA"
FT   gene            221510..222451
FT                   /locus_tag="Intca_0208"
FT   CDS_pept        221510..222451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46765"
FT                   /db_xref="UniProtKB/TrEMBL:E6S625"
FT                   /protein_id="ADU46765.1"
FT                   /translation="MTTVTRIVGFALGLVVVFVLALGLGRVVGPVGEPPAAHAGSSGGG
FT                   AGSADLPAAGLPGGLTISDAGYTLRLSAPTAPAGRGVPVSFAVTGPDGTPVTDYEVEHE
FT                   KELHLIAVRRDFTGYQHVHPTLRADGTWSAALDLEPGVWRLFADFTATGAGALTLGTDL
FT                   SVPGTAALAAPVGETRTVTVDGYTVSITGDLVAGQDADLSFSVRKDGAPVADLQPYLGA
FT                   YGHLVALRQGDLAYLHVHPDGAPGDGRTRPGPDVVFHASVPSAGAYRLYLDFQHDGVVR
FT                   TAPLSVTAHGSAAPAEPAPASSGTTSDHGDDH"
FT   sig_peptide     221510..221626
FT                   /locus_tag="Intca_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            222451..224775
FT                   /locus_tag="Intca_0209"
FT   CDS_pept        222451..224775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0209"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR006121: IPR008250: IPR005834: IPR006403: IPR
FT                   006416: IPR001757: IPR018303: IPR017969: IPR000150:
FT                   IPR000695; KEGG: rop:ROP_pROB01-02380 putative
FT                   copper-transporting ATPase CopA; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Putative
FT                   copper-transporting ATPase CopA; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; copper-translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase; Heavy-metal-associated
FT                   domain; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   copper-(or silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46766"
FT                   /db_xref="GOA:E6S626"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6S626"
FT                   /protein_id="ADU46766.1"
FT                   /translation="MTTTPTTTPGGASLGLPSAPGAIELEITGMTCASCANRIERKLNK
FT                   LDGVTATVNYATEKAKVSFPDTLSAEELVKAVEAAGYGATVPAPPVTAEGAEGPSGGEA
FT                   SPAAYDRVRALRDRLVVSAVLSLPVIAMAMVSALQFDYWQWASLTLAAPVVVWGAWPFH
FT                   KAAWTNLRHGTTTMDTLVSMGVLAAFGWSLYALFLGTAGMPGMVHPFELTISRTDGAGN
FT                   IYLEAAAGVTTFLLAGRYFEARSKRQAGAALRALLELGAKDVSVLRDGLSGQVEERIPT
FT                   SQLQVGMRFVVRPGEKIATDGVVEDGTSAVDAAMLTGESVPVEVGPGSAVAGATINAGG
FT                   RIVVRATRVGSDTQLAQMARLVEDAQNGKAQVQRLADRISGFFVPIVIGLSAATLGFWL
FT                   GTGAGAAAAFTAAVAVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRQV
FT                   DTIVLDKTGTVTTGAMALHAVVAADGEDEAEVLRLAGAVEDASEHPVARAVAAGAKERL
FT                   GALPAVSGFESTQGLGVRGEVDGSDVYVGRPVFLAERRQMRCTELDAAATEHESQGSTV
FT                   VAVAWGGRMRGILVVADTIKTTSAQAIQELRDLGLTPILLTGDNERVARTVAAQVGIAE
FT                   ADVIADVLPADKVDVVKRLQESGKVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEAS
FT                   DLTLVRGDLRVAADAIRLARRTLRTIKGNLFWAFAYNVAAIPLAAAGLLNPMLAGAAMA
FT                   FSSVFVVSNSLRLRGFRATAA"
FT   gene            complement(224946..226355)
FT                   /locus_tag="Intca_0210"
FT   CDS_pept        complement(224946..226355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0210"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COGs: COG0015 Adenylosuccinate lyase; InterPro
FT                   IPR000362: IPR013539: IPR004769: IPR020557; KEGG:
FT                   kse:Ksed_01820 adenylosuccinate lyase; PFAM:
FT                   Adenylosuccinate lyase domain-containing protein; fumarate
FT                   lyase; SPTR: Adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: Lyase; Adenylosuccinate lyase
FT                   C-terminal; TIGRFAM: adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46767"
FT                   /db_xref="GOA:E6S627"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E6S627"
FT                   /protein_id="ADU46767.1"
FT                   /translation="MASLAAATPPIALGALDGRYRAAVAPLVDHLSEAALNRERVRVEV
FT                   EWLIHQTSHGIVPGVRRLTDAEISALRGLVETFGPVEVAELAEIERVTVHDVKAVEYFL
FT                   KRRLAEIAPAEEDKGLAELVHFGCTSEDINNLAYALMVKGAVADVWLPRAQALVEQVSA
FT                   LARDLRDVPLLAHTHGQPATPTTMGKELAVLAFRLGRQLRRVDRQEYLGKFNGATGTFG
FT                   AHALALPDVDWPTVSREFVEGLGLTWNPLTTQIESHDWQAELYADVARFNRVLHNLCTD
FT                   VWTYISMGYFAQVRGQGTVGSSTMPHKVNPIRFENAEANLEVGNALLDVLGSTLVQSRL
FT                   QRDLTDSSMQRNIGSAFGHSLLALDNVARGLAGLDAVPSAMAADLESNWEVLGEPIQSA
FT                   MRALGARGVPGMEEPYERLKELTRGRRVGGDEVREFVRGLGLPADVEERFLALTPQTYT
FT                   ALASRLVDYLP"
FT   gene            complement(226547..227338)
FT                   /locus_tag="Intca_0211"
FT   CDS_pept        complement(226547..227338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0211"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COGs: COG3324 protein related to lactoylglutathione
FT                   lyase; InterPro IPR004360: IPR013838; KEGG: amd:AMED_0924
FT                   glyoxalase/bleomycin resistance protein/dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; SPTR:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46768"
FT                   /db_xref="GOA:E6S628"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:E6S628"
FT                   /protein_id="ADU46768.1"
FT                   /translation="MRDLHVTVPHYPYGAPCWVDLLVSDVGRAQHFYSELFGWRWLTGD
FT                   AASGGYTMALLADQPVAGISRRPPTAPVPSQWTTYLRVGDITVAAQAIATYGGRPLGRP
FT                   VQIGALARTMVAVDPGGAYFGVWEPGDLPGSGTLDQPGSLTWNELLTRDYDVVLDFYEN
FT                   IFAHGFIDETENGGPRWSTAHTGDGNPAYGLAEIEADWPPEIPAHWVAHFATDSVVTTV
FT                   AHALDLGGTLLQGPFDGPFGLGAVLSGPEGEVFSVLVPELD"
FT   gene            complement(227343..227855)
FT                   /locus_tag="Intca_0212"
FT   CDS_pept        complement(227343..227855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0212"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR017867: IPR000106; KEGG: sco:SCO3921 low molecular
FT                   weight protein-tyrosine-phosphatase; PFAM: Protein-tyrosine
FT                   phosphatase, low molecular weight; SMART: Protein-tyrosine
FT                   phosphatase, low molecular weight; SPTR: Protein tyrosine
FT                   phosphatase; manually curated; PFAM: Low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46769"
FT                   /db_xref="GOA:E6S629"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E6S629"
FT                   /protein_id="ADU46769.1"
FT                   /translation="MPSPRPFHVTFVCSGNICRSPMGHVILEQLVAEAGLADAVTVSSS
FT                   GTGDWHVGERADPRTVDVLAHHGYDGSGHRAREFDATAFDDIDLVLASDDGHVRHLRRL
FT                   APTSDHRSRIRLVREFDPTAVAAGTLETSDPWYGDEEHFRRCFTEVEAACKGVLEHIRG
FT                   RLEMEHP"
FT   gene            227937..228362
FT                   /locus_tag="Intca_0213"
FT   CDS_pept        227937..228362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr0593 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46770"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E6S630"
FT                   /protein_id="ADU46770.1"
FT                   /translation="MTTTRGARTPRELLSAFVGRVAAGDVAGIAGAYAADAVVSLPRGR
FT                   EAAGSQAIERAYAAALAGGALLAVGRPDDAAALELLVESARVIETGPLSMVSFTGADGA
FT                   VRTMVAWQGEDGWAWVRDGSMLRDVEAALGAGLSDVA"
FT   sig_peptide     227937..228038
FT                   /locus_tag="Intca_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            228372..229718
FT                   /locus_tag="Intca_0214"
FT   CDS_pept        228372..229718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0214"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: cmi:CMM_2049 putative MFS
FT                   permease; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   Putative MFS permease; PFAM: Bacterial protein of unknown
FT                   function (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46771"
FT                   /db_xref="GOA:E6S631"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S631"
FT                   /protein_id="ADU46771.1"
FT                   /translation="MVDGSETREGATARRSHLVDISPLRASLPFARLWAGNTLAGIGAQ
FT                   VTATAVALHIYDLTASTFMVSLVAWFALGPVIASGLYGGAVADRFDRRSVALIASVVAW
FT                   ASTVSLAAIAWAGVTTVWAFYVITTVNAVAATIASATRQAITPRLLPLHLLPQAAALTG
FT                   ISMGLMVTAGPGLAGVLVARVGYAWTYTVDVLLFVAGLFGLWTLPRIRPELDEDGAPPA
FT                   SGLRAVVEGLAHLRTAPNVRMSFVVDIIAMTFGHPMVLFPAVGAVVIGGGPVTAGLLLA
FT                   AFAAGGILSSLGSGRVTGARWQGRAIRNAIIVYGVAILGFGMVLAVVMVGGHAVSSRDF
FT                   GDADRTALVAAVVCLAVAGGADNVSSIFRQSILQAAVPDRLRGRMQGIFTVVVTGGPRL
FT                   GQMLAGSLATLTVTWVPPVVGGALVVGLVVLAVARVPSFRDYDALDPRP"
FT   sig_peptide     228372..228464
FT                   /locus_tag="Intca_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(229809..230825)
FT                   /locus_tag="Intca_0215"
FT   CDS_pept        complement(229809..230825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0215"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="COGs: COG1087 UDP-glucose 4-epimerase; InterPro
FT                   IPR001509: IPR005886; KEGG: gbr:Gbro_0593 UDP-glucose
FT                   4-epimerase; PFAM: NAD-dependent epimerase/dehydratase;
FT                   SPTR: UDP-glucose 4-epimerase; TIGRFAM: UDP-glucose
FT                   4-epimerase; PFAM: NAD dependent epimerase/dehydratase
FT                   family; TIGRFAM: UDP-glucose-4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46772"
FT                   /db_xref="GOA:E6S632"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S632"
FT                   /protein_id="ADU46772.1"
FT                   /translation="MRVLVSGGAGYIGSHMVVQLVAAGHDVVIVDNFANSKPTVVARLE
FT                   AITGAHLPVHAFDLVDQEKTEHLFTQEPIDAVIHFAGLKAVGESVEKPLEYYENNLGTT
FT                   FSLIRAMRRHQVRTLVFSSSATVYGSNEPPFTEDMPTAAANPYGWTKVMIEQVLRDVAR
FT                   ADPSWRIALLRYFNPVGAHESGTIGEDPQGIPNNLMPFVAQVAVGRRERLHVFGSDYAT
FT                   PDGTALRDYIHVEDLAAGHLAALDQLARTAAPVSTWNLGTGVGTSVLEVIQAFERASGR
FT                   QIPYEVVGRRAGDLPAAFADPTRAQRELGWRAQKDIDDMCVDTWRWQSQNPEGYPEA"
FT   sig_peptide     complement(230757..230825)
FT                   /locus_tag="Intca_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(231164..232060)
FT                   /locus_tag="Intca_0216"
FT   CDS_pept        complement(231164..232060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0216"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="InterPro IPR001915; KEGG: msm:MSMEG_3631 integral
FT                   membrane protein; PFAM: peptidase M48 Ste24p; SPTR:
FT                   Putative uncharacterized protein; PFAM: Peptidase family
FT                   M48"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46773"
FT                   /db_xref="GOA:E6S633"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E6S633"
FT                   /protein_id="ADU46773.1"
FT                   /translation="MVIAALLTLTIALAWPVPRLMAGMTTFRRAPRAALVVWQSTTMGA
FT                   VLAALFAAPAALPYVIGPTAALADNATQIAVAVAVSGLIAGRLIVSGHRVGTRLRAHRR
FT                   RHRRLVDLLAVPVGADGSHAAHMRVIEHPTPTAYCVPGMRRRVVLTQGTLDSLPEDQLV
FT                   AVLAHERAHLRARHDLILEFFTVIHEAVPSWFRCEMAMHEVKLLIEVLADRAAVRATGV
FT                   VSTARAIVGMATGAVKPEGMLAMGESPSAARLRLELLQPGPVAGLPAGVAATVMYLFAT
FT                   SVVIMPVALLVVAWATA"
FT   sig_peptide     complement(231995..232060)
FT                   /locus_tag="Intca_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(232075..232488)
FT                   /locus_tag="Intca_0217"
FT   CDS_pept        complement(232075..232488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0217"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="COGs: COG3682 transcriptional regulator protein;
FT                   InterPro IPR005650; KEGG: kse:Ksed_01860 predicted
FT                   transcriptional regulator; PFAM: Penicillinase repressor;
FT                   SPTR: Transcriptional regulator-like protein; PFAM:
FT                   Penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46774"
FT                   /db_xref="GOA:E6S634"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S634"
FT                   /protein_id="ADU46774.1"
FT                   /translation="MASNPPTRLGDLERAVMEHLWVSTEAHPEGLTVRDVHDAIGVTRG
FT                   LAYTTLMTVLDRMAKKQLVTRERDGRAWRYLPASSRDELTSEALHHTLGELAGSQRRSA
FT                   LLRFLDQSTPEELDELRAALADLEQREGTHQTG"
FT   gene            complement(232501..234210)
FT                   /locus_tag="Intca_0218"
FT   CDS_pept        complement(232501..234210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0218"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="COGs: COG4987 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis fused ATPase and permease
FT                   components; InterPro IPR003439: IPR014223: IPR003593:
FT                   IPR017940; KEGG: kse:Ksed_01870 cysteine export CydDC
FT                   family ABC transporter permease subunit/ATP-binding protein
FT                   CydC; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Putative ABC transporter ATP-binding protein;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydC; PFAM: ABC
FT                   transporter; TIGRFAM: thiol reductant ABC exporter, CydC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46775"
FT                   /db_xref="GOA:E6S635"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E6S635"
FT                   /protein_id="ADU46775.1"
FT                   /translation="MTGPVRPGSAPEHRGRIALAGLLGGIATASGVALTATSGWLIARA
FT                   AERPLILTLMTAIVAVRTFGIARPVFRYWERLVSHDASLATLAARRSAAYEALLPLTPA
FT                   RLGRRRRADVLTAVVHDITDEVEAQVRVTVPVVSSAVAGALAIGFTTVIAPPVGLVVAL
FT                   VCVAVALVSVLAHRTEARTLGALVAARAEVVRVSELVTTQADQLRAIGAWGTATRWLDE
FT                   AHDDVARATRTAVRGRALAAGTFLLVVATATIATAAVATGLELSNPVKALLVLTPVALA
FT                   DAIAPLADAMRARAQAGAAAARTDALLTQDPAVHDAGRAGPDGADTGPEPFGGLRLEAV
FT                   TASWGGSGGSAVPGDEQADGPVLGPFDLDLSPGETVAVVGPNGSGKSTLLAVLARHLDP
FT                   RAGRYETAADGRLRDVLTEPLDRARARVAVVDDEPHVFATSVRNNLTLARPGATDEDVL
FT                   RALDRAGLGRLVPSLPDGLDTVLGAGGRGLSGGERARLAIARAHLSRRPVIVLDEPVAH
FT                   LDPPTARSVLTDLLAQRRDTGDGGHPAVVLVTHRPEGLHLVDRVFTVTHPHR"
FT   sig_peptide     complement(234076..234210)
FT                   /locus_tag="Intca_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(234207..235868)
FT                   /locus_tag="Intca_0219"
FT   CDS_pept        complement(234207..235868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0219"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="COGs: COG4988 ABC-type transport system involved in
FT                   cytochrome bd biosynthesis ATPase and permease components;
FT                   InterProIPR001140: IPR003439: IPR014216: IPR003593: IPR
FT                   017871: IPR017940; KEGG: kse:Ksed_01870 cysteine export
FT                   CydDC family ABC transporter permease subunit/ATP-binding
FT                   protein CydC; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase; SPTR:
FT                   Putative ABC transporter; TIGRFAM: ABC transporter, CydDC
FT                   cysteine exporter (CydDC-E) family, permease/ATP-binding
FT                   protein CydD; PFAM: ABC transporter transmembrane region;
FT                   ABC transporter; TIGRFAM: thiol reductant ABC exporter,
FT                   CydD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46776"
FT                   /db_xref="GOA:E6S636"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S636"
FT                   /protein_id="ADU46776.1"
FT                   /translation="MRPFDPRLLHVVPAARRPVAALAAIGIATGVTTIATAFALTGVVV
FT                   AVVDDRPVAAPATWLGILFAIRAVLAWATEVVAAWAGVSVSTALRSALVRRWGAGPAAA
FT                   GSAPVDQATALSLATSGASAVEPYAARYLPTLVTAAVVPVVAVLALAVVDWPSALIVVL
FT                   TVPLLPLFAALIGRATEDSTQRRWAALASLSGHFLDVVRGLPTLVGYGRGRRQVEVVRE
FT                   VSERHRRATMETLRIAFLSSAALELLATISVALVAVTVGLRLSYGSMDLTPALAAILLA
FT                   PEAYWPIRRVGQEFHAAADGATALDDILGALADPPSPSPTGAPFARVDLRDVSYTYAAG
FT                   LAPVIRDLDLVVGSGLYAITGPSGVGKTTLLDLIAGLKAASSGSLTAPPSHYVTQRPFL
FT                   AAGSIRANLTLADDAERNARSDDALWQALRTVGLDGVVAGLPEGLSTRLGDDGFGLSAG
FT                   QRQRLALARAWLAPEPLLLLDEPTAHLDPEVADTVNALIVELAERRIVVVVTHRPELVA
FT                   VADEHLHLLPLPEPDGPRDDLAIPGLTPGVRPEVAR"
FT   sig_peptide     complement(235752..235868)
FT                   /locus_tag="Intca_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(235876..236949)
FT                   /locus_tag="Intca_0220"
FT   CDS_pept        complement(235876..236949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0220"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="COGs: COG1294 Cytochrome bd-type quinol oxidase
FT                   subunit 2; InterPro IPR003317; KEGG: nca:Noca_0943
FT                   cytochrome d ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome bd ubiquinol oxidase subunit II; SPTR:
FT                   Cytochrome d ubiquinol oxidase, subunit II; TIGRFAM:
FT                   cytochrome d ubiquinol oxidase, subunit II; PFAM:
FT                   Cytochrome oxidase subunit II; TIGRFAM: cytochrome d
FT                   oxidase, subunit II (cydB)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46777"
FT                   /db_xref="GOA:E6S637"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:E6S637"
FT                   /protein_id="ADU46777.1"
FT                   /translation="MDLATFWFIVLGVLWTGYFVLEGFDFGVGILLPVLGRTKGAVGAA
FT                   AVDAEKRRRVLLNTIGPVWDGNEVWVLTAGGATFAAFPHWYATLFSGFYLPLLLILVAL
FT                   ILRNLGFEYRHKRGGAEWKSRWDLAIFWGSLVPAFLWGVALTNIVRGVPIDADMEYTGN
FT                   LFTLLGLVPILGGLTFVALFVTHGAIFVALKTDGPIRSDSRRIAERMGLVTVVLAVALL
FT                   LLLGISDGTAASWATTIVAAVALLGALQANRAGREGWAFLGTAVTIALAVATYFLMLFP
FT                   NVMPSSTNPAWNLTVDNASSSDYTLKVMTVVALIFTPLVLVYQAWTYWIFRKRLTVGHI
FT                   PEDVLPDRPDQPLQRVG"
FT   sig_peptide     complement(236881..236949)
FT                   /locus_tag="Intca_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(236964..238448)
FT                   /locus_tag="Intca_0221"
FT   CDS_pept        complement(236964..238448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0221"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="COGs: COG1271 Cytochrome bd-type quinol oxidase
FT                   subunit 1; InterPro IPR002585; KEGG: nca:Noca_0942
FT                   cytochrome bd ubiquinol oxidase, subunit I; PFAM:
FT                   cytochrome bd ubiquinol oxidase subunit I; SPTR: Cytochrome
FT                   d ubiquinol oxidase subunit I; PFAM: Bacterial Cytochrome
FT                   Ubiquinol Oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46778"
FT                   /db_xref="GOA:E6S638"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:E6S638"
FT                   /protein_id="ADU46778.1"
FT                   /translation="MDATDLARWQFAITTVYHFLFVPITIGLSAVVAYFHTRWVRTHRP
FT                   EWLRLAKFYGKLFTINFALGLVTGIVQEFQFGMNWSDYSRFVGDIFGAPLAVEALLAFF
FT                   LESTFLGLWIFGWGRIPERLHAATMWIVHIGTLLSAYFILAANSFMQNPVGYRYNPDTG
FT                   RAELTDFFALLTNKVQLVTFPHVILAAYMVGGAVVMGVALHLMRREALPAEGVDPADRL
FT                   ASGDASLYRTAVRIGAVVTLVAGLGVAVTGDIQGKIMTEVQPMKMAAAEGLYESVPEGQ
FT                   GAPFSVLTLGTLDGQHANPIIEVPGLLSFLATGDVNGAVAGILDLKNEYAKTYGETGNP
FT                   LVADPATDYVPNIPTTYWTFRLMIGVGMAAAAIALAVLWLTRKGRTPTQRWLFWAAVAA
FT                   PLLPVLGNSFGWIFTEVGRQPWLVFGLMTTASGVSPSVSAGEVIASMVGFTLLYGALAV
FT                   VEIKLFLHYVRRGADPFEQPQQPSERDEDAPLVFAY"
FT   gene            238634..239011
FT                   /locus_tag="Intca_0222"
FT   CDS_pept        238634..239011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0222"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG1725 transcriptional regulator protein;
FT                   InterPro IPR000524; KEGG: nfa:nfa49100 putative
FT                   transcriptional regulator; PFAM: regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; SPTR: Putative
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, gntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46779"
FT                   /db_xref="GOA:E6S639"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S639"
FT                   /protein_id="ADU46779.1"
FT                   /translation="MTGPNDLSITIDPASAEPPFEQVRAQLAALIRSGRLLPGDRLPTV
FT                   RALAAHLGLAANTVARTYKELEAAGLVETRGRAGTVVASGEHTADVALAALAARYAVAA
FT                   REAGVDDATAVDLVRSALRSS"
FT   gene            239047..240075
FT                   /locus_tag="Intca_0223"
FT   CDS_pept        239047..240075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0223"
FT                   /product="dihydroorotate oxidase A"
FT                   /EC_number="1.3.98.1"
FT                   /note="COGs: COG0167 Dihydroorotate dehydrogenase; InterPro
FT                   IPR012135: IPR005719: IPR001295; KEGG: nml:Namu_4274
FT                   dihydroorotate dehydrogenase 2; PFAM: dihydroorotate
FT                   oxidase; SPTR: Dihydroorotate dehydrogenase; TIGRFAM:
FT                   dihydroorotate dehydrogenase; PFAM: Dihydroorotate
FT                   dehydrogenase; TIGRFAM: dihydroorotate dehydrogenase,
FT                   subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46780"
FT                   /db_xref="GOA:E6S640"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6S640"
FT                   /protein_id="ADU46780.1"
FT                   /translation="MIYERVARPALFRLGGGDPEIAHERTIGALTALAKVPPAVAALRR
FT                   LNTVEAPRTVFGVRFPGVVGLAAGMDKNGVALRAWPALGFGHVEVGTVTRHAQPGNPRP
FT                   RLFRLRESGGIINRMGFNNDGAEALAARLTAVGPLGVPLGISIGKSKVTPVEDAVEDYL
FT                   HSFRALRRFADYVAVNVSSPNTPGLRGLQDRAALDELVGALAAEAQGTPLLVKIAPDLT
FT                   DEAIGEVLQVCADHGVSGLIATNTTVSRGGVAAADRPVADVETGGLSGRPLTARAREVV
FT                   AFIHREAPELPVIGVGGISSVDDAHRMLDAGASLLQVYTGFIFGGPPLIRAINRSLAPA
FT                   GT"
FT   gene            complement(240158..241471)
FT                   /locus_tag="Intca_0224"
FT   CDS_pept        complement(240158..241471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0224"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="COGs: COG1541 Coenzyme F390 synthetase; InterPro
FT                   IPR000873: IPR011880; KEGG: kfl:Kfla_6851 phenylacetate-CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; PRIAM:
FT                   Phenylacetate--CoA ligase; SPTR: Phenylacetate-CoA ligase;
FT                   TIGRFAM: phenylacetate-CoA ligase; PFAM: AMP-binding
FT                   enzyme; TIGRFAM: phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46781"
FT                   /db_xref="GOA:E6S641"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S641"
FT                   /protein_id="ADU46781.1"
FT                   /translation="MTTESPAPALPDHEIPTLSVDELRHLQTERLRATISAAYANVPHY
FT                   TAAFDAKGLTPDDIRSLDDLRRLPFLAKADLRDYYPFGMFAVPRTEVVRIHASSGTTGR
FT                   PTVVGYTKQDIDTWADLMARSIRFAGGGPGDIIHVAYGYGLFTGGLGAHYGAERLGGTV
FT                   VPVSGGMTERQVQLIRDFGATVILVTPSYFLSLIDQMESEGIDPRSTSLRVGIFGAEPW
FT                   TEAMRREIEERTGMDAVDIYGLSEVMGPGVAQEAGTTKDGLHLWEDHFYPEIIDPVTEE
FT                   VLPDGEFGELVLTSLTRQAMPVIRYRTRDLTRLLPGTACPSMRRMEKVTGRSDDMMIIR
FT                   GVNVFPTQIEEFVLAEPRLSPYFQCVLRQPGRMVELTVLVEPVESLGDADADAIARHLQ
FT                   HEIKTNIGTSCRVEVRAPGSIERSIGKARRIVDERPKG"
FT   gene            complement(241538..242416)
FT                   /locus_tag="Intca_0225"
FT   CDS_pept        complement(241538..242416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0225"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro IPR003439: IPR003593:
FT                   IPR017871; KEGG: sma:SAV_2984 arginine/ornithine transport
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Putative arginine/ornithine ABC transport
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46782"
FT                   /db_xref="GOA:E6S642"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E6S642"
FT                   /protein_id="ADU46782.1"
FT                   /translation="MTTTTNQQGRPDQRTRADGSQPLVRAVNVTKSFHGNEVLKGIDLT
FT                   VHRGEVVVLLGPSGSGKTTFLRCINQLETIDGGRIWVDGDLMGYREDEKGHLHHLTDKQ
FT                   VSAQRRDIGMVFQRFNLFPHKTALENVMEAPMQVKGVSKAKARARGLELLERVGLADKP
FT                   KAYPGALSGGQQQRVAIARALAMDPKLMLFDEPTSALDPELVGEVLRVMRDLAEAGMTM
FT                   IVVTHEMGFAREVADHVVFMDAGVVCEEGTARDVISNPQQERTRSFLRRMRSEEQQERR
FT                   DEQEQEQVEPA"
FT   gene            complement(242416..243417)
FT                   /locus_tag="Intca_0226"
FT   CDS_pept        complement(242416..243417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0226"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515: IPR010065:
FT                   IPR018062; KEGG: pfr:PFREUD_22920 polar amino acid ABC
FT                   transporter, inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Polar amino acid ABC transporter, inner
FT                   membrane component; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46783"
FT                   /db_xref="GOA:E6S643"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S643"
FT                   /protein_id="ADU46783.1"
FT                   /translation="MSVSPEQTPQVSLGTEDRPGAIHARPVPHPWRWVALAAIAVVVAM
FT                   VASSFLTNERWNFPQALRIMNFNPVLEGLLKGTLLGTAGAMVLGVVFGVAIAVMRLSAN
FT                   PVLRGVSFVFTWFFRAIPRYVLLVMMGSIGYLYPDLALGLPFGQQLAESLGWGTDLTFA
FT                   TVDVNRFSTGISTGIFLGIIGLGLSEAAYMAEIARAGILSVDKGQAEAAQALGMSSGKT
FT                   MRRIVLPQAMRVIVPPTGNETIAMVKDTSLLTAIPVQMELFNQTRIIGTRTLQIMPSLV
FT                   AAVGWYLIVCSVLMVGQYYLERYFGRGFGETRRQARKAQAKRAARPAGMGGA"
FT   gene            complement(243417..244331)
FT                   /locus_tag="Intca_0227"
FT   CDS_pept        complement(243417..244331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0227"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001638; KEGG: kra:Krad_1224 extracellular solute-binding
FT                   protein family 3; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3; SPTR: Extracellular solute-binding
FT                   protein family 3; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46784"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E6S644"
FT                   /protein_id="ADU46784.1"
FT                   /translation="MRRLPLLAITGMVAVGLTLSACGSDSLEPGSGSPSSPSASTPAST
FT                   GSADAALAEKVPDKIKSAGKIIVGIDASYAPNEFIGNDGKTVEGMDVDLFNAVAAKLGV
FT                   TAEYQNAGFDTIILGVTGGKYDAGVSSFTINDDRKKEVNMVSYFNAGTQWVAKTGNPKN
FT                   VDPNNACGLTIGVQKGTVQETDDLPLKQKACKDAGKPDITLVVQEKQDQVTADVVSGKT
FT                   DAMLADSPIGLYAVKQTNGQLEAVGDIYDAAPYGFVVPKDQADFAQAIADALKALKADG
FT                   TYDAVLKQWGNESGGITDFAVNP"
FT   sig_peptide     complement(244188..244331)
FT                   /locus_tag="Intca_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            244676..246262
FT                   /locus_tag="Intca_0228"
FT   CDS_pept        244676..246262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0228"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterProIPR011545: IPR001650: IPR014001: IPR014021: IPR
FT                   014014; KEGG: nca:Noca_4567 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; SPTR: ATP-dependent RNA
FT                   helicase; PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46785"
FT                   /db_xref="GOA:E6S645"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S645"
FT                   /protein_id="ADU46785.1"
FT                   /translation="MSIDTTDLTFGALGVPSALTAALADLGITTPTPIQAATLPDSLAG
FT                   RDVLGRGRTGSGKTYAFLLPIVARLAAAPTRRSPGRPRALILAPTRELATQIDTALAPL
FT                   AATAGLNSLTIFGGVGQNPQVQGLRRGVDVVVACPGRLEDLMGQGHVSLDSVEITVLDE
FT                   ADHMADLGFLPGVRRIMDKTPATGQRMLFSATLDGAINVIVKRFLTSPRTHEADSAQSP
FT                   VSTMAHHVLHVTSDAHLAVILDLAAAPGRKVVFTRTKHRAKKLAKQLNSSGVPAVELHG
FT                   NLSQGARTRNMDDFHSGRAQTLVATDIAARGIHVDDVALVIHADPPVEHKAYLHRSGRT
FT                   ARAGADGTVVTMMLDDQVRDVRDLTRKAGIKPTTTRVAVGHPLLVELAPGERSYAAGLV
FT                   REAVPTVGGGARRQGGSGSSRGTGARDGAGQGRAGGGRAGGGRAGGGRGAGRSGGSAAA
FT                   GGSGSSAASGSGRRGGSGSSGSSAGARAGAGGNGGRGRQGGSATVYSTSSGGGAAAFSA
FT                   GTRAGSRRRAG"
FT   sig_peptide     244676..244783
FT                   /locus_tag="Intca_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(246324..247094)
FT                   /locus_tag="Intca_0229"
FT   CDS_pept        complement(246324..247094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0229"
FT                   /product="RDD domain containing protein"
FT                   /note="COGs: COG1714 membrane protein/domain; InterPro
FT                   IPR010432; KEGG: gbr:Gbro_4825 RDD domain containing
FT                   protein; PFAM: RDD domain containing protein; SPTR:
FT                   Possible conserved membrane protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46786"
FT                   /db_xref="GOA:E6S646"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E6S646"
FT                   /protein_id="ADU46786.1"
FT                   /translation="MTGEGVALEVPVASIGTRVLSGLIDVVLHVGLLVGVFFAAGALTG
FT                   QSSEAVSRTAVIVSFVAVLVGVPTVSETLTRGKTLGKLITGLRVVRDDGGPISFRHALA
FT                   RALVGWVEVYLLTGVAAVIAALVTARTKRLGDLAAGTYVIAERSRLELPLPPVAPLALE
FT                   GWARRADIAPVAADLAVAVRQFLPRARLLVPEARQALGRQLLARVLPLVAPPPPPGNDP
FT                   EAILTAVMAERYRRDLERLHREQALRERALPDSR"
FT   sig_peptide     complement(246969..247094)
FT                   /locus_tag="Intca_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            247240..248235
FT                   /locus_tag="Intca_0230"
FT   CDS_pept        247240..248235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0230"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="COGs: COG1300 membrane protein; InterPro IPR002798;
FT                   KEGG: nca:Noca_3912 integral membrane protein; PFAM:
FT                   protein of unknown function DUF95 transmembrane; SPTR:
FT                   Putative membrane protein; manually curated; PFAM: Integral
FT                   membrane protein DUF95"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46787"
FT                   /db_xref="GOA:E6S647"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:E6S647"
FT                   /protein_id="ADU46787.1"
FT                   /translation="MNLDALVAAHSAQWSRLDELSRRRRLTGGEADELLDLYQQVSTHL
FT                   SLIRSGEADPTLIRHLSTILSRARVTLAGRGSSTWADLGAFFVRTFPAALYRLRRWWLG
FT                   TLALNLVAAVLVAWWTVEHPQVYTSVMSRAQIDAYVGTDFENYYREFPHHEFATLVWVN
FT                   NAWVAAQCIVFGVLGLPVVYVLWQNTLNLGVAGALMASHDRASLFFGMILPHGLLELTA
FT                   VFVAGGAGLWLFWSWIEPGPRPRAVAFAEAGRTVIAIALGLAAVLLVSGIIEGFVTPSA
FT                   LPTGARILIGVLAEGAFLAYVFVVGRRAFRGGATGDVSRAAVGDAAPVVG"
FT   gene            complement(248352..249647)
FT                   /locus_tag="Intca_0231"
FT   CDS_pept        complement(248352..249647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0231"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: nca:Noca_3911
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46788"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S648"
FT                   /protein_id="ADU46788.1"
FT                   /translation="MVLTGRAALVVLLGAVAVAWRPGVGTVLLWTLGVLVLVLADLALA
FT                   PSPRGLVIERSVAPLVRLGEAVTSELLVTNPGRRAVRGQVRDAWQPSAGAEHDRHDLRL
FT                   RSGDRVRLTTRLRPTRRGDRHADLVTLRLHGPLGLAARQASITVAGTIRVLHPFHSRRH
FT                   LPSKLSRLRQIDGRSAVRRRGQGTEFDSLRDYVEGDDVRSIDWRATARRGSVVVRTWRP
FT                   EQHRRIVVVVDTSRTSAGRVGDVPRLDAAMDATLLLTALAGHAHDRVDVIAGDQRVRVR
FT                   VIGSTDRTSPLAEVVSALAPIQPAIVEADWSALASAVVSRHHQRSLVVLLTPLEPAAIE
FT                   EGLLPVIPTLVARHRVVLASVADPAVGTLLAERTTVADVYGAAAAERTMARRERVAAAL
FT                   ARLGVDVIDAEADELPARLADHYLWLKSEGLL"
FT   sig_peptide     complement(249591..249647)
FT                   /locus_tag="Intca_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(249670..250677)
FT                   /locus_tag="Intca_0232"
FT   CDS_pept        complement(249670..250677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0232"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011703:
FT                   IPR016366: IPR003593; KEGG: gbr:Gbro_4821 ATPase associated
FT                   with various cellular activities AAA_3; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SMART:
FT                   AAA ATPase; SPTR: Putative regulatory protein; PFAM: ATPase
FT                   family associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46789"
FT                   /db_xref="GOA:E6S649"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E6S649"
FT                   /protein_id="ADU46789.1"
FT                   /translation="MTDHTTDTPTHDPGRPDDAGRAALDALLAVRAEVGKAVVGQEAAV
FT                   TGAIVALLTRGHILLEGVPGVAKTLLVRALAAALDVTTKRVQFTPDLMPGDVTGSLVLD
FT                   PRTSDFTFREGPVFTNLLLADEINRTPPKTQSALLEAMEERQVTVEGTARPLPRPFLVA
FT                   ATQNPVEYEGTYPLPEAQLDRFLLKVSLPLPAREDEVEVLRRHATGFDPRDLAAAGLTA
FT                   VAGPADLAAGSAAVQRVVVSPEITGYIVDIARATRTSPSLALGVSPRGATALLATSRAW
FT                   AWLHRRAFVTPDDVKAMAHATLAHRLALRPEAELEGVSVAAVLDSALGSVAVPR"
FT   gene            complement(250674..251921)
FT                   /locus_tag="Intca_0233"
FT   CDS_pept        complement(250674..251921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0233"
FT                   /product="secreted protein"
FT                   /note="KEGG: nca:Noca_3909 secreted protein; SPTR: Secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46790"
FT                   /db_xref="GOA:E6S6Q4"
FT                   /db_xref="InterPro:IPR025646"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q4"
FT                   /protein_id="ADU46790.1"
FT                   /translation="MSTRLPEATALPALPALPGGSPASAGPPARRRWGLAALLAVAGIV
FT                   AVGLLAVLSGGAGRSGTLGDPDSASRNGSRALAEVLRQQGVQVEVVRTIRAFEAARVDP
FT                   STTVVVGSFDYLGEAAAERTSRHSSSARRLVLLEPGDLALGDLGVPLVTTGGGRAELTG
FT                   GCNSDIVEADDRLDATTTVYASADDDGPALPRGATGCFPEKQSGVALVVLPASGAQPET
FT                   VVLGSADALTNARVGDASHAAVGLRSLGNSERLVWYVPGLSDLDVADASGEHRSSDRGV
FT                   PDWFDPGVLLLVIAFIAFALARGRRLGRIVTEPLPVVVRAVETTEARGRLYRRAGDRGR
FT                   AASSLRSGTRHRLAARLGLPTPTVGSDLVEAVARAAGRGTAEVRALLDGPAPTNDRDLV
FT                   LLAEQLAQLEENVRRA"
FT   sig_peptide     complement(251847..251921)
FT                   /locus_tag="Intca_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(251918..252562)
FT                   /locus_tag="Intca_0234"
FT   CDS_pept        complement(251918..252562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1140 hypothetical protein; SPTR:
FT                   Putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46791"
FT                   /db_xref="GOA:E6S6Q5"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q5"
FT                   /protein_id="ADU46791.1"
FT                   /translation="MHVWAVSVPVDPSAEEAREWVLRELSRPEYADERGLLQRLLDWVG
FT                   DLVDELLRHDPGALPGWVLPVVLALLAALLGVVLVTRLGREAGTPRGGAGGVLDEPHLD
FT                   AEAYRARARAAYAVGEVDDAATDWFRAIAASASERAVIDESPGRTAHEVSVALAALLPE
FT                   EAPALSRAADQFDAIRYGDAHVDEAVARSIADLDTRLAASRPFLRRTRVTP"
FT   gene            complement(252565..253689)
FT                   /locus_tag="Intca_0235"
FT   CDS_pept        complement(252565..253689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mul:MUL_4272 hypothetical protein; SPTR:
FT                   Putative integral membrane protein; PFAM: Membrane domain
FT                   of glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46792"
FT                   /db_xref="GOA:E6S6Q6"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q6"
FT                   /protein_id="ADU46792.1"
FT                   /translation="MSDEPGWAAPGPAPSGGTDRWVPPDAGSVPPDAGSAPPPPPPSGG
FT                   YRPAPPPPPAPRLEYRPGIIPLRPLTLGEIWSGVFATVRGNPGATLGLALLTTALALVP
FT                   ATALAIWLAGQDLGLAAVLSADPFGDPNLSAGAYSDATLASYVPGLAMWVVSLLLPLFV
FT                   ALVIGHAIQGRKVTLGQTWQQTRGRILPAIGTTLLIVAMFAGVIVVVLLAAAGTWASGD
FT                   GAGSVALTVLLVVGFAAAAVYLWVKVSFAVTIVVLESAGPRRAVRRSWGLTGGRPFWRI
FT                   FGIRLLTAIVASIVGSIVATPIGLIALFAADDPDATSMAWVLPLTQAVSLLVQGVLVTP
FT                   FVSGVDSLLYVDQRIRREGLDVQLMQQLPTSPSG"
FT   gene            complement(253738..254169)
FT                   /locus_tag="Intca_0236"
FT   CDS_pept        complement(253738..254169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0236"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="COGs: COG2050 Uncharacterized protein possibly
FT                   involved in aromatic compounds catabolism; InterPro
FT                   IPR006683: IPR003736: IPR011973; KEGG: kfl:Kfla_6849
FT                   phenylacetic acid degradation protein PaaD; PFAM:
FT                   thioesterase superfamily protein; SPTR: Probable
FT                   phenylacetic acid degradation protein; TIGRFAM:
FT                   phenylacetic acid degradation protein PaaD; PFAM:
FT                   Thioesterase superfamily; TIGRFAM: uncharacterized domain
FT                   1; phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46793"
FT                   /db_xref="GOA:E6S6Q7"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q7"
FT                   /protein_id="ADU46793.1"
FT                   /translation="MSEPVGGGEDAGVAFARQMWADDEASRRLGMEAVVIEQDHAVVRM
FT                   PVRADMVNGHDICHGGFVFTLADSTFALACNSRGVVTVASGADITFTAPSRLGDVLVAE
FT                   GMVRSAFGRSGITDVTVKRESDGQIIAEFRGRSRSLKRQ"
FT   gene            complement(254166..255341)
FT                   /locus_tag="Intca_0237"
FT   CDS_pept        complement(254166..255341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0237"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /EC_number="1.1.1.157"
FT                   /note="COGs: COG1250 3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro IPR006176: IPR006108: IPR006180; KEGG:
FT                   kse:Ksed_01910 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain-containing protein;
FT                   SPTR: 3-hydroxyacyl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46794"
FT                   /db_xref="GOA:E6S6Q8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q8"
FT                   /protein_id="ADU46794.1"
FT                   /translation="MNLTDVAVIGAGAMGAGIAQVAATAGHRVSLVDAVPGAAEAATDR
FT                   LGGGLDRLVAKGRLTADDAAAIRGRLTPAGSVAELPDCGLVIEAVPEDLALKRKIFGEL
FT                   GGSQPASTILATNTSSIDVSAIAEAVIHPERVVGLHFFNPPQVMALVEVIHGARSSATV
FT                   LDEAVELMRAWGKTPVRCSSTPGFIVNRVARPFYGEAQRMVEAGVADAATIDWILREKG
FT                   GFPMGPLELTDFIGQDVNLAVGTSVWEQTGRDERYAPTEFQRGLVEAGRLGRKTGQGVY
FT                   TYAADGVLVGGDPDLGLAERLVGGPVETDPLARTVAMLVNEAADLVGRGEATAADVDIA
FT                   MVLGTRYPRGPIEWGRSLGFAVVSRQIEELDRVFPGGRYRPSPALLDGTVQ"
FT   sig_peptide     complement(255267..255341)
FT                   /locus_tag="Intca_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            255397..257121
FT                   /locus_tag="Intca_0238"
FT   CDS_pept        255397..257121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0238"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590: IPR011975; KEGG: kse:Ksed_01930
FT                   phenylacetic acid degradation protein PaaN; PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: Phenylacetic acid degradation protein
FT                   paaN; TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM: phenylacetic
FT                   acid degradation protein paaN"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46795"
FT                   /db_xref="GOA:E6S6Q9"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6Q9"
FT                   /protein_id="ADU46795.1"
FT                   /translation="MTAQATKPTHPLLDQHAGVLDEIRQALAERSWFSRYPESPSPRVY
FT                   GETAAADGLAAYEAHLNRPYAAELASGVTGTFVGSEVSPYGPTLGVSYPALDLDAALAA
FT                   ARAAVPAWRDAGPQVRAAVCVEIVDAINRRSFEVANAVMHTSGQPFVMSFQAGGPHAQE
FT                   RALEAVAAGLVEQERVPASVVWEKPGKDREGKPAPIRMQKDYRIVPRGVSLVIGCNTFP
FT                   TWNAYPGIFASLVTGNPVVIKPHPRAVLPLAITVEAARGVLAAAGFDPALVQLAAEVDG
FT                   QGLARTLAERDEVAIIDYTGGPAFGGWLEERGAALGKLVYTEKAGLNTVVVDSTDDLKG
FT                   LLGNLAFSLTLYSGQMCTAPQNIYVPTGGVDTDEGHLSFDEFGERLGSAVSRLTGDDAK
FT                   AVELLGATVNDQVRANAESLEAMAAEAEGRVLLQSRRIAHPVYAEAVVRAPGLVAVDVQ
FT                   REDVYTQECFGPVGFLIQTASTEQSLAQLADTVKEHGGMTASVYSTSEEVLEGAREAAA
FT                   TGGVALSENLTGQIFVNQTAAFSDFHGTGANPAANAAYTDSAFVANRFRVITARRHI"
FT   gene            257154..258479
FT                   /locus_tag="Intca_0239"
FT   CDS_pept        257154..258479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0239"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: nca:Noca_2339 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Putative transporter; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46796"
FT                   /db_xref="GOA:E6S6R0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R0"
FT                   /protein_id="ADU46796.1"
FT                   /translation="MTLLETPVDRASLQRKVIRTLVATQILGGVGMASGIAVGALLAEE
FT                   LSGTESLAGVGTTSQVLGSALITIPVARAIAARGRRVGQSLGLAVAFAGAALVITAAVA
FT                   GSFPLFLVGMFLFGGGTTANNQARYAAADLAAPAHRGRDLSIVVWATTIGSVAGPNLVG
FT                   PGVSVARLIGIPDLAGSFVFSLAGFLLAWAVVTRLLRPDPLVTAKALEATAHEERAQRH
FT                   TAAIADGTTTGPAPTAPNHDGSMGRGLSVIRGNARALRAVLVMGLGHLVMVSVMVMTPI
FT                   HMKHGHAELEVIGFVISIHILGMYVLSPVVGTAVDRWGGRPVAMLGGGILTVSAVLAAL
FT                   SDAGWSALLLVALFLLGVGWSCTLVSGSTLLTGAVETDERPATQGLADVFMGLAGAGGG
FT                   AAAGVVVGGLGYSWLASGSAVVGLVIVVVAGSTSRLKDQQPH"
FT   gene            258661..259512
FT                   /locus_tag="Intca_0240"
FT   CDS_pept        258661..259512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0240"
FT                   /product="cell wall binding repeat 2-containing protein"
FT                   /note="InterPro IPR007253; KEGG: ace:Acel_1487 cell wall
FT                   binding repeat 2-containing protein; PFAM: cell wall
FT                   binding repeat 2-containing protein; SPTR: LytC; PFAM:
FT                   Putative cell wall binding repeat 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46797"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R1"
FT                   /protein_id="ADU46797.1"
FT                   /translation="MTNPTARRISRSKKLAAGAAALTLLALGGVQGASAADPGVDIVYV
FT                   ATGANFPDALAGSVLAALEGAPILLVTRDTIPGPTATELARLDPRYIRVLGGTSTVSDA
FT                   VLTQLKAYATANTADEVTRIAGLNRYATAAEISQLVPAAASKLPDNQVRIVTGSPGLPS
FT                   SIGVVASTTVTLPDVCPGADGWKVRATANGYYLTSGSVTSGAATTALSLDNPGSYLAST
FT                   ITNQNFVPNVGQTRENYVSDFIFDGVDAGTHTIRQWGVEDTNVDVTAAQNRLLVEVIGY
FT                   TC"
FT   sig_peptide     258661..258765
FT                   /locus_tag="Intca_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(259591..262584)
FT                   /locus_tag="Intca_0241"
FT   CDS_pept        complement(259591..262584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0241"
FT                   /product="putative exonuclease"
FT                   /note="COGs: COG0419 ATPase involved in DNA repair; KEGG:
FT                   cfl:Cfla_0124 putative exonuclease; SPTR: Putative
FT                   exonuclease; TIGRFAM: exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46798"
FT                   /db_xref="GOA:E6S6R2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R2"
FT                   /protein_id="ADU46798.1"
FT                   /translation="MQLHHLRMTAIGPFAGTEVIDFSAVGRAGLFLLEGPTGSGKSTII
FT                   DAITFALYGKVAQESADAERIHSHHADPREIPVVTLVFETQSGLYRVRRTPRFERPKSR
FT                   GTGLTVQQPSVKLWRITSPDDLEGGELLSANIGECDDEITRAVGLTRAQFVQTVILPQG
FT                   EFATFLRARSEEKGKLLEKVFGTAFFRRVQDEIVESGRLAQARRQGAVTEIRDCIHAFA
FT                   VSAAIEADRRDSLVALAQATPGDLDDELAQVVDELATRERHAAKASREAIEAHQQMADM
FT                   VSDAKLRRQRRQRLLELQREDESLGARAVEFDRLRAAVARARQARPVAGAVRTLAQSEA
FT                   ALKRAEAAVATARARVLPEQRDLTTAELRVAASTTREVVGALTSAAELEGALELRRTRL
FT                   GELRARADRTRAALGSVTTELESLPASLAAHEKSLTAARHLHSLLEGRTSAAARAHKQL
FT                   EAATQEAAARARLPGAEERAAGALIALRAGESRLASLRQARIDDIAGELGLTLEDGRPC
FT                   PVCGSLEHPAPARPTPDAVTPEQVAEQEERVEALRAEVTAVTDRLAGLRAEIAGLAVAA
FT                   DGLDVDAATAAAQRAAAELAASLQAADAVASSEATLAGLRLRSAELSERSAELTAEVAR
FT                   CEHSATELGERLGSDTAVVETARAGHPTVSARRAALVEVAARVDALVDALSRRDAARAS
FT                   VAEDEAARDSDLAAAGFADVGAWLAADQPVEWIAAREKEIADFETACTRVKAGLSGPEL
FT                   ADVQLDTLFDDIDQMVTLERAAKQDMEAATSEHGSLRSQVKRTKDRVAEIRAALDRHAT
FT                   CIAETADAVRLGQLVAGNGDNQLNLDLAKYVLIRRFAEVLAAANTELARFSGGRYSLEH
FT                   TDAKQGNAKSGLGVRVQDMHTNQVRDVGTLSGGETFYVSLSLALALAEVVRSESGGVDL
FT                   GTLFVDEGFGTLDPDVLDDVMHTLEGLRAGGRTVGIVSHVTELKSRVADRIEILVNEDR
FT                   TSTLRVTA"
FT   gene            complement(262586..263782)
FT                   /locus_tag="Intca_0242"
FT   CDS_pept        complement(262586..263782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0242"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="COGs: COG0420 DNA repair exonuclease; InterPro
FT                   IPR004843: IPR004593; KEGG: cmi:CMM_0677 putative dsDNA
FT                   exonuclease subunit; PFAM: metallophosphoesterase; SPTR:
FT                   Putative dsDNA exonuclease subunit; TIGRFAM: nuclease
FT                   SbcCD, D subunit; manually curated; PFAM: Calcineurin-like
FT                   phosphoesterase; Type 5 capsule protein repressor C
FT                   terminal; TIGRFAM: exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46799"
FT                   /db_xref="GOA:E6S6R3"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R3"
FT                   /protein_id="ADU46799.1"
FT                   /translation="MRMLHTSDWHLGRTLHGVSLHEAQAAVLERICELVEDPPDGVPVD
FT                   AVIVAGDVYDRGVPPVESVQLFEWTLSRLSQVTTVVVTSGNHDSAIRLGYGAGLFRDTI
FT                   RMITDLSMVDLPVLLDGSDGVRAAIYGIPYLDVDHARAALARGGELLPRSHQAVVGAAC
FT                   DRIREDLRARTGVRSVVVAHAFVAGAEPSDSERSIAVGGVDRVAGTVFAGLDYAALGHL
FT                   HGPQSPECAEGSVVRYSGSPLRYSFSEQDHAKCVLLVDLPAAGPVVVTPLPITQPRPMA
FT                   TLRGMLDDLLADPAHAMHEDAWLRVTLTDRVRPDSLMDRLKSRFPHVLQVFHEPDGRIE
FT                   RGVRGTTAVSERDPRELGSDFISYVTKTEASTGEIGCFVAGYEAAVKAQALAEAQEVA"
FT   gene            264033..264503
FT                   /locus_tag="Intca_0243"
FT   CDS_pept        264033..264503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_6978 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46800"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R4"
FT                   /protein_id="ADU46800.1"
FT                   /translation="MSREFQVTFDAADPIGLSLFWAEALGYVVQPPPGSDLSPETPAEE
FT                   VVEAWMSFLTATGVAIERHRSASAIVDPTGSGPRVFFQQVPEPKTAKNRVHLDVRAAPG
FT                   LEGDERMAALEAECQRLISLGAKRIRRFEPVPPMSAGFIVMADPDGNEFCLD"
FT   gene            264520..264855
FT                   /locus_tag="Intca_0244"
FT   CDS_pept        264520..264855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_2846 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: TfoX N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46801"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R5"
FT                   /protein_id="ADU46801.1"
FT                   /translation="MAYDEELANRIRFVIGPDPVVSEKKMFGGLAFLAHGNMAVAASGQ
FT                   GGLLVRVDPQRSDALVDDVHVRRMEMQGRQMAGWLRVDGDLVDEDAQLRRWVDEGLGYA
FT                   RTLPPKR"
FT   gene            complement(265109..265492)
FT                   /locus_tag="Intca_0245"
FT   CDS_pept        complement(265109..265492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0245"
FT                   /product="membrane protein of unknown function"
FT                   /note="InterPro IPR007165; KEGG: kse:Ksed_02330 predicted
FT                   membrane protein; PFAM: membrane protein of unknown
FT                   function; SPTR: Predicted membrane protein; PFAM: Membrane
FT                   protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46802"
FT                   /db_xref="GOA:E6S6R6"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R6"
FT                   /protein_id="ADU46802.1"
FT                   /translation="MLLNFVIKTVINGIALWIAALLVDGITFGTQADTAAIVRTVLIVA
FT                   LIFGVLNTFVRPIAKAVSLPFIILTLGLFVFIINALMLQLTSWLADQLNLAFHVEHFFW
FT                   DAVLGSLIITFVSMILGFFNPKD"
FT   sig_peptide     complement(265397..265492)
FT                   /locus_tag="Intca_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(265498..266586)
FT                   /locus_tag="Intca_0246"
FT   CDS_pept        complement(265498..266586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0246"
FT                   /product="pyrophosphate-dependent phosphofructokinase"
FT                   /EC_number="2.7.1.90"
FT                   /note="COGs: COG0205 6-phosphofructokinase; InterPro
FT                   IPR000023: IPR012003: IPR012829: IPR015912; KEGG:
FT                   tbi:Tbis_1326 phosphofructokinase; PFAM:
FT                   phosphofructokinase; SPTR: Phosphofructokinase; TIGRFAM:
FT                   phosphofructokinase; PFAM: Phosphofructokinase; TIGRFAM:
FT                   phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46803"
FT                   /db_xref="GOA:E6S6R7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R7"
FT                   /protein_id="ADU46803.1"
FT                   /translation="MRIGILTGGGDCPGLNAVIRGAVRAAEVTYDSTVVGFRNAWRGVM
FT                   DNDFELLDVDRCRGILPLGGTILGTSRDQPFAFEDGLKKVRKAYDRHGLDAIIGVGGEG
FT                   SMSVLARLHENGFPIVGVPKTIDNDISLTEMTFGFQTAVQICTDAIDRLHTTAESHHRV
FT                   LVVEVMGRHVGHIATWSGIAGGAAITLVPEEPFDIGEVCERIVHRHRKGRFATIIVVAE
FT                   GALPQPGTMELPEPEMDKYGHQILGGIGSILAREIQGRTGIESRMTALGHIQRGGSPVA
FT                   FDRVLGTRFGVAAVEAALDGAWGQMVALQQGHIVRVPISDAVGQLKMVDADLLRLNTMF
FT                   QPRIPGDEYPGIPADRLERVED"
FT   sig_peptide     complement(266512..266586)
FT                   /locus_tag="Intca_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            266739..267857
FT                   /locus_tag="Intca_0247"
FT   CDS_pept        266739..267857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0247"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR005861: IPR004839: IPR001917; KEGG: sma:SAV_4261
FT                   putative aminotransferase; PFAM: aminotransferase class I
FT                   and II; SPTR: Putative histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: Aminotransferase class I and II;
FT                   TIGRFAM: histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46804"
FT                   /db_xref="GOA:E6S6R8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R8"
FT                   /protein_id="ADU46804.1"
FT                   /translation="MSDDAVQPPPATPGASPTVRLRQVLGQMPDYKPGRPAAAAAGVTP
FT                   FKLSSNENPYGPLPSVLAAITEAAGSVNRYPDMAVVGLRERLGRALSVSSDCIATGTGS
FT                   VAVLAQIVQAACDAGDEVVFAWRSFEAYPIVTQLAGATPVMVALDDRARHRLDAMADAV
FT                   TERTRVVLVCTPNNPTGPTVHRAELDAFLDRVPSDVIVVIDEAYVEFVRDPEAVRGLEV
FT                   WRERPNVVVLRTFSKAYGLAGLRVGFAVAHPDVAAAIRKTATPFGVNSLAQVAAVASLD
FT                   AFDELNERVESIVAERERVVRALQDQGWKLPDSDANFVWFPLGSDSTAFAEACEAAGLM
FT                   VRQYGDDGVRVTIGEAEANSRLLEVAEAFGAR"
FT   gene            268074..269228
FT                   /locus_tag="Intca_0248"
FT   CDS_pept        268074..269228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0248"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR001017: IPR017596; KEGG: nca:Noca_4509
FT                   pyruvate dehydrogenase (acetyl-transferring); PFAM:
FT                   dehydrogenase E1 component; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: Pyruvate dehydrogenase
FT                   (Acetyl-transferring); TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   Dehydrogenase E1 component; TIGRFAM: pyruvate dehydrogenase
FT                   E1 component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46805"
FT                   /db_xref="GOA:E6S6R9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6R9"
FT                   /protein_id="ADU46805.1"
FT                   /translation="MSDKVVAELHEPTPAVGDGGPDMIQLLTPEGERLSHPDYDKYVAD
FT                   LTPEDLRSFYRDLVLIRRLDAEGYALQRQGELGLWPSLLGQEAAQVGSGRALKPHDMCF
FT                   PTYREHGVGFVRGMDPQSSLQLFRGVSQGGWDPKDHNFHLYTIVIGAQTLHATGYAMGV
FT                   KMDGNVGTGDPDRDTAVICYFGDGASSQGDVNEAFVYAASFDAPVVFFCQNNQWAISEP
FT                   VSKQTRIPLFQRARGFGFPGMRVDGNDVLATYAVTQHCLDEARNGNGPLLIEAFTYRMG
FT                   AHTTADDPTKYRVSAEVEQWKFRDPILRLKTYLSHEGWADEAFFTRVDEEADQFAAELR
FT                   HGCITMDTMPGETMWDHVYAEDHPVMEAERAAFQAYQASFEEAN"
FT   gene            269228..270214
FT                   /locus_tag="Intca_0249"
FT   CDS_pept        269228..270214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0249"
FT                   /product="Transketolase central region"
FT                   /note="COGs: COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type beta
FT                   subunit; InterPro IPR005475: IPR005476; KEGG: cai:Caci_0092
FT                   transketolase central region; PFAM: Transketolase central
FT                   region; Transketolase domain-containing protein; SPTR:
FT                   Putative branched-chain alpha keto acid dehydrogenase E1
FT                   beta subunit; PFAM: Transketolase, C-terminal domain;
FT                   Transketolase, pyrimidine binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46806"
FT                   /db_xref="GOA:E6S6S0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S0"
FT                   /protein_id="ADU46806.1"
FT                   /translation="MALEKVTLGKSLTSGLRRAMERDPKVVLIGEDIGKLGGVFRITEG
FT                   LQKDFGEARVIDSPLAESGIVGTAVGLALRGYRPVCEIQFDGFVYPAFDQIVSQVAKLR
FT                   ARSLGAVTMPIVIRIPFGGGIGSPEHHSESPEAYFAHTAGLRVVACSNPEDAHWMIQQA
FT                   IECDDPVIFFEPKRRYHDRGEYDTAATEAPRGLFEAHIVRPGSDVTMVGYGPVVKTMLE
FT                   SAAAAEADGTSIEVIDLRSLSPLPIDTIVGSVRKTGRLVVVHEASSFLGMASEISAQVT
FT                   EQCFYDLEAPVIRVNGANIPYPPSRMEEDFLPDLDRILDGVDRALAY"
FT   gene            270237..271715
FT                   /locus_tag="Intca_0250"
FT   CDS_pept        270237..271715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0250"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR000089: IPR004167: IPR001078; KEGG:
FT                   kse:Ksed_02370 pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase component; PFAM:
FT                   catalytic domain-containing protein of components of
FT                   various dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; SPTR:
FT                   Putative dihydrolipoamide acyltransferase component; PFAM:
FT                   2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); e3 binding domain; Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46807"
FT                   /db_xref="GOA:E6S6S1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S1"
FT                   /protein_id="ADU46807.1"
FT                   /translation="MAIRTFNLPDPGEGLVEAEIVEWKVAPGDTVKVNDMVLEIETAKS
FT                   LVELPIPWSGTVRELLVNVGDTVDVGTPIISIDDGQGGDAPAAPAGETAQAPKGEQQEA
FT                   NLVGYGAKAGATARRARKQGDGRMPLGSVPESAPARAAAPTETEQVAEAEPVAEQTAPA
FT                   PRTESPAPAVEPVAREGRPKAKPPVRKLAKDLGVDLWSVPGSGPDGIITRDDVESFARG
FT                   VNLPERQGVSDQGEAAASVSAAPSPAAYPFGSGEREVRTPIKGVRKMTAQAMVGSAFTA
FT                   PHVTEWVTVDVTRTMELVDRLKRSREFKDVKVTPLLVLARAMILAIRRNPGVNATWDEA
FT                   AQEIVQKNYVNLGIAAATPRGLIVPNIKDAHGMSMLQLAQAIGELTATAREGRTQPAEM
FT                   SGGTITITNVGVFGVDSGTPIINPGESAIVAFGAIRKMPWVVEGPAGDEIVVRHVTQLA
FT                   MSFDHRLVDGELGSRFLADLAAIMADPGQALVWG"
FT   gene            complement(271743..272971)
FT                   /pseudo
FT                   /locus_tag="Intca_0251"
FT   gene            complement(273327..275405)
FT                   /locus_tag="Intca_0252"
FT   CDS_pept        complement(273327..275405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0252"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR011701: IPR004638: IPR005829: IPR001411; KEGG:
FT                   bfa:Bfae_08840 drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   Drug resistance transporter, EmrB/QacA subfamily; TIGRFAM:
FT                   drug resistance transporter, EmrB/QacA subfamily; PFAM:
FT                   Major Facilitator Superfamily; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46808"
FT                   /db_xref="GOA:E6S6S2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S2"
FT                   /protein_id="ADU46808.1"
FT                   /translation="MPSSPATSRTTEPDDVSTGLDPRARQIFTALMLGMLVASISQTIV
FT                   GPALPRIVAELGGMEHYSWLATAAMLVSAITVPIVGKLSDIYGRRGFYLGGLVVFMVGS
FT                   VLSGFAQNFWWLIGARALQGVGMGTLMPLSQTIIGDIIPPRQRGKYQGLMGGVFGLSSI
FT                   LGPLVGGFVTDNWGWRWLFFISLPIGVVAYIGIARFLHLDHVDRETVIDKAGIALLSLA
FT                   LILLLVPTSLGGTTLAWDSPVTMGLYAVGLVALVAFIAVERRAVEPVLPLRLFRSSIFT
FT                   LSNIASFMVSVMMFGAMIYLPVYAQGVLGVSATNSGLILMPMSVAMIGLSIVAGLVITR
FT                   TGRYKLQTLVGILIMGAGFWMLIRMDYAADELDLTLAMVVFGIGLGMAMQVYTLIVQNA
FT                   AQRRDLGVATASTQFFRNVGSTVGIAVFGTIMSSGLAVNIASHLPAGAAERLATSGQQV
FT                   DAGSVLDPAALVNLPPEVVTGVQQGLADSLHAVFLWGLVPFAIALVATLFIKELPLRNT
FT                   VHTADEAGRELLDTMTQTAADDELVVPLGREAGNTRTKERLLGLRLGLLADAALSGDRP
FT                   LLSRAVAEVGQGDVERGAALLQRTAHMLTTEDNAVAAETERYAVEVAEAARVSGPLTPE
FT                   LKRELATAVAERDARTVMTTVEPTVAERYEAVDIQMLERVGDDLTAAYLVDAMRTRA"
FT   gene            275478..276071
FT                   /locus_tag="Intca_0253"
FT   CDS_pept        275478..276071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0253"
FT                   /product="regulatory protein TetR"
FT                   /note="InterPro IPR001647; KEGG: fra:Francci3_0716 TetR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46809"
FT                   /db_xref="GOA:E6S6S3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S3"
FT                   /protein_id="ADU46809.1"
FT                   /translation="MSEPDCGLRERKKRETRMAIHRAALDLVEEAGFDAVTTDQIAARA
FT                   GVSPRTLFNYFPTKESAVLGATPADLDEMRALLDARPASEPILQSIRAIVEARLSPTTY
FT                   DPQLRAQRRRVILSEPSLGPALVGNNIRAENVLTELVADRLGLDPRESVRPRVTVASAL
FT                   AAVRACIEHQHSGGSGTVEEAVDEAFLLLEHGFA"
FT   gene            complement(276076..276426)
FT                   /locus_tag="Intca_0254"
FT   CDS_pept        complement(276076..276426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0254"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="COGs: COG1734 DnaK suppressor protein; InterPro
FT                   IPR000962; KEGG: bcv:Bcav_3682 transcriptional regulator,
FT                   TraR/DksA family; SPTR: Transcriptional regulator,
FT                   TraR/DksA family; PFAM: Prokaryotic dksA/traR C4-type zinc
FT                   finger"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46810"
FT                   /db_xref="GOA:E6S6S4"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S4"
FT                   /protein_id="ADU46810.1"
FT                   /translation="MTDTTTHSTRLAEERQTTVDRLEGLRREFGQVVEAAVDSNSDDEH
FT                   DPEGATIAYERSQVAALIDQAEEHLGEIDAALARLDEGSYGLCVVCGRRIPEERLEARP
FT                   TARTCVEHAGQG"
FT   gene            276540..277997
FT                   /locus_tag="Intca_0255"
FT   CDS_pept        276540..277997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_1105 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46811"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S5"
FT                   /protein_id="ADU46811.1"
FT                   /translation="MAEHRGVVFPLDEASGRRSTAAVGRAVVADALLSVDPVGAASAAR
FT                   ETNWRQGYLEHFRRLVEAGLPGAAAAHTIAREGLISVHARMRWTGPSGEVALAAAVEEP
FT                   VTRLGSATIRGEGAPDRTISLPYAAERASGDRLRRVLAGWVERGVVEPSCAEAVELVIA
FT                   NPDWLDLSDQTIVVLGAAAEMGPLRSLLRWGADVVAVDLPRKDLWHRLIGDTRRLSGSM
FT                   TVPVQPGSGPVESRLGGDLVHDLASVTQWVTSQEGPLVLGNYVYADGATNVRVATAVDV
FT                   LTQRAVAERGRDEVSLAFLATPTDVFAVPGGAVARSVENYAQRHTSKVLRVPLRTLSGG
FT                   RLMRRNYVPGEDPGINDSVVLQQGPNYLLAKRLQRWRATAHRADGGLVSLNVAPPTRTR
FT                   SVVKNRALAAAYAGAHRFGVEVFEPGTANTLMAILLVHDLRVGAPAREHPWQDEAAAAV
FT                   HGGLWTSAYDPRSVLGIAALLGLAAAR"
FT   sig_peptide     276540..276659
FT                   /locus_tag="Intca_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            278024..279340
FT                   /locus_tag="Intca_0256"
FT   CDS_pept        278024..279340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0256"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: aau:AAur_pTC10168
FT                   H(+)-stimulated manganese uptake protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: Mn2+/Fe2+
FT                   transporter, NRAMP family; PFAM: Natural
FT                   resistance-associated macrophage protein; TIGRFAM: NRAMP
FT                   (natural resistance-associated macrophage protein) metal
FT                   ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46812"
FT                   /db_xref="GOA:E6S6S6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S6"
FT                   /protein_id="ADU46812.1"
FT                   /translation="MWLSELARRVPVAHALTMGDRPGRALPSHVDARSPEHGLGGTLRA
FT                   PRTLVPALLAAIAYVDPGNFGVNITSGAEHGYALVWVVVFASCAAMVIQYLAAKLGMVT
FT                   GLSLAEHSARRYPGVGRIVLWTQAEIVVIMTDLAEIVGGAIALYLLFGMPLMWGAVAVT
FT                   GFSLVVLYLKVHGRSHFESVVLVLLAVIIGSLLWQVLVAEVDRVALLRSAVPGPLDSSA
FT                   ALLAVGIVGATVMPHALHFHSAASRTRDDGQVEPSQAVRLRIGRQTVRSVVIAMTVAGA
FT                   ANISLVVFAAALPSEAGASIETAYAALGAEAGQIAATMLAVALLASGLASTLVGVQTGD
FT                   VVMTGFGRRPIPALLRRTLAVVPALIILGLGVEPTLALVWSQVILSFALPGTLIPLLLF
FT                   THDRRLMGAMANHRLTTAVAWIITAVIVGLVGFLLVSGA"
FT   sig_peptide     278024..278068
FT                   /locus_tag="Intca_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            279602..280762
FT                   /locus_tag="Intca_0257"
FT   CDS_pept        279602..280762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0257"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006092: IPR006091: IPR006090: IPR006089; KEGG:
FT                   mgi:Mflv_5166 Fis family transcriptional regulator; PFAM:
FT                   acyl-CoA dehydrogenase domain-containing protein; SPTR:
FT                   Transcriptional regulator, Fis family; PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46813"
FT                   /db_xref="GOA:E6S6S7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S7"
FT                   /protein_id="ADU46813.1"
FT                   /translation="MAREPRAPIVPPVVVEGEVLRGLRLEVREFLAGQIESGRFTPHVD
FT                   TWLTRWDRDFTRELGRRGWLGMVIPEEYGGQGRTYLERFVVTEELLVVGAPVAAHWVAE
FT                   RQIGPSLLRFGTEEQKRHFLPRISRGDLVFGIGMSEPDSGSDLASVRTRAQQVDGGWRL
FT                   TGTKVWTSGAHEADAFFALARSAPLDPAHRHQGLSQFIVDLRAPGVEIRPIISMGGDHH
FT                   FNEVHLDGVLVPDDRVLGTIGEGWQQVTSELGFERSGPERYLSTFQLLAAAAEAMEAGV
FT                   LPLDPGLGRHVARVAALHQMSFAVSTALEAHADADTAAAAVKVLGTTTEGDIADYVDTL
FT                   TATGWIEDEELHTLLHAAILQRPGFTLRGGTNEILRGVIARGLGMR"
FT   gene            280762..281820
FT                   /locus_tag="Intca_0258"
FT   CDS_pept        280762..281820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0258"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006090; KEGG: mgi:Mflv_5167 acyl-CoA dehydrogenase
FT                   domain-containing protein; PFAM: acyl-CoA dehydrogenase
FT                   domain-containing protein; SPTR: Acyl-CoA dehydrogenase
FT                   domain protein; PFAM: Acyl-CoA dehydrogenase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46814"
FT                   /db_xref="GOA:E6S6S8"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S8"
FT                   /protein_id="ADU46814.1"
FT                   /translation="MAELEHLARSTSADPDLVAMLTDLFATYRSTRPAPTELLDLDLGL
FT                   WAQLDELGLTRLTASEASGGSGASWVEGSALLGLAAAAGAPVPLVEHGMLGAWLLEEAG
FT                   LPNDGALRTVCRPDPSGRALNVTFARDSASIVALWEDADRWRVADVPTERVGLTQSRNL
FT                   AGEPCDTVEFELVDLASAPFVDDSVGHQFHLRGALARSAQVCGAMERVLEVVLTHTRER
FT                   EQFGRPIGRFQAVQHLVADIATESSLARAATDTAVARAAASQWQDPGMLFAVGVAKSCV
FT                   GHAASVVVRNAHQVLGAIGTTLEHELHVLTKPILVRRSEYGSVHEWDETLAELAASAGR
FT                   DRLWPLILTGRR"
FT   gene            281857..282633
FT                   /locus_tag="Intca_0259"
FT   CDS_pept        281857..282633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0259"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR001753: IPR018376; KEGG:
FT                   gob:Gobs_3773 enoyl-CoA hydratase/isomerase; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; SPTR: Enoyl-CoA
FT                   hydratase/isomerase; PFAM: Enoyl-CoA hydratase/isomerase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46815"
FT                   /db_xref="GOA:E6S6S9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S9"
FT                   /protein_id="ADU46815.1"
FT                   /translation="MSEVTYTVADAVATITLSAPERRNALSVEMSRELIDAAQAAGQDH
FT                   AVGAVVVTGGPHFCAGAVRAVLADTGLDPVEDEAYRNLETVYRAFTTIGDLAVPTVAAV
FT                   RGAAVGAGLNLALATDLRIVSTSARLLPGFAQIGIHPGGGHFTLLGRVAGREAAAAMGL
FT                   FGEEVDGARAVQLGLAWAAHDDADVEAEAHALAARVAKDPELARRLVRSFRRETAPGGI
FT                   PWDVAVELERSPQMWSLRRKHGPRADRAERAEPDGR"
FT   gene            282729..283928
FT                   /locus_tag="Intca_0260"
FT   CDS_pept        282729..283928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0260"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: sma:SAV_2408 transmembrane
FT                   efflux protein; PFAM: major facilitator superfamily MFS_1;
FT                   SPTR: Putative transmembrane efflux protein; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46816"
FT                   /db_xref="GOA:E6S6T0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T0"
FT                   /protein_id="ADU46816.1"
FT                   /translation="MLSSYRPLFEVPGARTFIIGGMTARSAGAMFAVATVAMVAARRGS
FT                   YELAGAVMAAGLVALAVAAPVLGRLVDRYGQSRVAVPFFIWSGFWAAMTMVASWRGWPS
FT                   WVLFITFPLCAVIPNLGTMARARWSHIFAHDPRSLHTAMSFEQVMEEVTFVIGPVLAIW
FT                   LSTTLFPEAGFLFAAICYAVGVLVFVSARSTEPPIVPHHERPGGGAHRHPGILPLAFIM
FT                   VMTGAIFGVNEVVTLAVAEDAGHPNVAGAVLGLFAVGSAASGLVFGQISHGRNLLKLLL
FT                   VGTLGMMVLEAPVLLAGNLWVLAGIMLVAGMATAPTLITTMNLIERIVPRAQINEGMTL
FT                   VLTGLIIGIAAGSAVSGAVIDRVGPRHGYWVAVVAGGAAFLMALATRRFLSRRDMHNLR
FT                   "
FT   gene            284145..284882
FT                   /locus_tag="Intca_0261"
FT   CDS_pept        284145..284882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0261"
FT                   /product="ANTAR domain protein"
FT                   /note="InterPro IPR003018: IPR005561: IPR012074; KEGG:
FT                   rop:ROP_10100 hypothetical protein; PFAM: ANTAR domain
FT                   protein; GAF domain protein; SMART: GAF domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: ANTAR domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46817"
FT                   /db_xref="GOA:E6S6T1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T1"
FT                   /protein_id="ADU46817.1"
FT                   /translation="MSEHLPADQGTRDVFVRLSALIYAGADEADVYQTIVDAARRLVDG
FT                   CERASIMLKRRDRFVTAASTDDIARLADQIEREVREGPCYDAVLDEAYQHDTDLTSGTS
FT                   PWPRFTERVLAETPVRSAIGYRLFLDGDKVGALNLFADEPGALTERSADQGAVLASFAS
FT                   VALMAVRAREEAATLRLGLQSNREIGKAVGLLMAAHHMGSEQAFGVLRRTSQELNMKLT
FT                   QVAEEVVRGQEQQFGSTSSDGQG"
FT   gene            complement(284973..285842)
FT                   /locus_tag="Intca_0262"
FT   CDS_pept        complement(284973..285842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0262"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR017517; KEGG: tcu:Tcur_3849 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Mycothiol maleylpyruvate isomerase N-terminal domain;
FT                   TIGRFAM: uncharacterized Actinobacterial protein TIGR03083"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46818"
FT                   /db_xref="GOA:E6S6T2"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T2"
FT                   /protein_id="ADU46818.1"
FT                   /translation="MPLHPAAPDDQGGLLDAFEQVVQAIVDLGWACREEDFEKPTECPG
FT                   WTVKDHMVKVVATEKAFAALPREPHGPANRAEVRNEFNRMVDLEVAARRQWTGRSVISE
FT                   LADFHQHRMSQLRSLDVDLDTEIAGFFRERTTFGDQLRAQITETWVHEQDVRTALDRPG
FT                   NLDSPAAAVFTAAIVDALPLVAVRDAGIEPGSAVVLDVTGPVLARGGARVVEGPDGRPV
FT                   GEALFSGQDPEAGEPLDVTTIQLTTEALTRRAAGRRTRDEIHFTILGDESVGHRILDAL
FT                   DVLGPAAS"
FT   gene            285869..287905
FT                   /locus_tag="Intca_0263"
FT   CDS_pept        285869..287905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0263"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="COGs: COG3336 membrane protein; InterPro IPR019108;
FT                   KEGG: kse:Ksed_26540 predicted membrane protein; PFAM:
FT                   Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related; SPTR: Putative uncharacterized protein; PFAM:
FT                   Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG);
FT                   Copper resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46819"
FT                   /db_xref="GOA:E6S6T3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T3"
FT                   /protein_id="ADU46819.1"
FT                   /translation="MPSAARDVAVGRSVLPWAVALAVVAGLAASVLAAVFSGAVAAPPA
FT                   GLTDAGPVVRWALPLVRVVHDVAAALTVGALLLAATMIPGPTRAASAALEEPRRAAAFR
FT                   VATAAAFVWASAGAVGVVFTFADAAGLPLDHPAFAAELLRSVWSIDTLRVELISTMAAF
FT                   IVASFASLGRARSVAVALVVLAVLGVVVLGLTGHAGGSADHETAVNALAVHLLSATLWT
FT                   GGLLALILLRGALGDALAVVARRYSSVALWAFVALGVSGVMAASTRFARVEDLTSPYGV
FT                   LVLLKAGAFIVLGFAGWWHRRVTIHALERERAESRPGWAFLRLAIGEIVVMGVAFGLAT
FT                   ALARTQPPVPETVANPSAALALTGFPEPPSPTALSWVTAWRVEWLFLATALLAIGLYVA
FT                   GVVRLARRGDRWPVLRTVSWVAGWLVFIWATNGALGIYGRVAFSWHMTLHMVEAMVVPI
FT                   FLVLGAPVTLALRSLRARLDGTLGPRELLLGLVHSPYLKVVGNPIFAAAFFFMSLVVFY
FT                   WTDLFYLALTTHTGHLIMTAHFLIAGYLFAWVLVGSDPGPAKWSPALRLIVLFATIAFH
FT                   AFFGVAMISGTAVLAPDFFTAIDLSWVDDPLADQRNGGAVAWAIGELPSLALALLVAVQ
FT                   WSRTDKAEGRRRDRHADRDGDAELTAYNEHLARLARHDERPRP"
FT   sig_peptide     285869..285994
FT                   /locus_tag="Intca_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            288118..288303
FT                   /locus_tag="Intca_0264"
FT   CDS_pept        288118..288303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfr:PFREUD_12670 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46820"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T4"
FT                   /protein_id="ADU46820.1"
FT                   /translation="MAGVPTPKCPIRIGEPCTLCFPGASGPQDCGLVYLVQSDDEWRDQ
FT                   LADKRREVRAGGTLAS"
FT   gene            288346..289161
FT                   /locus_tag="Intca_0265"
FT   CDS_pept        288346..289161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0265"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR003010:
FT                   IPR001110; KEGG: kse:Ksed_26530 predicted amidohydrolase;
FT                   PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; SPTR: Putative hydrolase; PFAM:
FT                   Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46821"
FT                   /db_xref="GOA:E6S6T5"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T5"
FT                   /protein_id="ADU46821.1"
FT                   /translation="MKVALIQLAYGDDESVADRTARVVDLVLAQEGHDLVVLPELWPAG
FT                   GFDYRAWDERAEPVDGPVARALAAAAREARVTLHGGSIVERATPTDGDGHGLWNTSLVF
FT                   SPAGELVATYRKIHRFGFGEGEPKLMDPGADLVVIDVPVASAGPRASVAVGLSTCYDLR
FT                   FPELYRALLDRGAEVFVIPAAWPAKRVAHWTLLGQARAVEDQCVVIQCNTAGTHAGHEM
FT                   GGRSQVVDAQGVVLATAGHHEEVLSVEFDPAETHAWRGAFPVLADRRLR"
FT   gene            289158..291032
FT                   /locus_tag="Intca_0266"
FT   CDS_pept        289158..291032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0266"
FT                   /product="NHL repeat containing protein"
FT                   /note="InterPro IPR000866: IPR001258: IPR017936; KEGG:
FT                   ach:Achl_3716 NHL repeat containing protein; PFAM: NHL
FT                   repeat containing protein; alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; SPTR: NHL repeat
FT                   containing protein; PFAM: NHL repeat; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46822"
FT                   /db_xref="GOA:E6S6T6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T6"
FT                   /protein_id="ADU46822.1"
FT                   /translation="MTTEPSLRARVKVRAPELVGRGWLNTGGRALSLADFRGRVLVLDF
FT                   WTFCCVNCLHVLDELRPVEAQYPDALTIVGVHSPKFEHEADPDALAAAVERYAVHHPVL
FT                   DDPELVTWRAYTARAWPTLVVVDPEGYVVASMSGEGHGPGLAALVGELIEEHAAKGTLQ
FT                   PGGDPFVPPPAPDTALRFPGKVVALDDGSFVVSDTANHQVVHLEADLETERRRWGGPGV
FT                   LNEPQGLVLATSKVRDQYGVDLVVADSVNHQVKGIRFSDGTIHPLVGTGRQLRQRRGGA
FT                   PARQQDLSTPWDLAWLDGRLIIAMAGTHQLWAWSPAGPPETAPTPGGTVEVIAGTTNEG
FT                   LRDGPGAQAWFAQPSGLCTSADGRRVWVADSETSALRSVAIDDTGGLTVQTHVGTGLFD
FT                   FGHRDGPAAQALLQHPLGVTELPDGSVAVSDTYNGAIRRYDPVTGEVTTLARDLAEPSD
FT                   AVVEGDPESGRTRLVVVESAAHRLTRIALPEDAQRVDGPARRTQRPATELAPGEVRLEV
FT                   TFVPPKGQKLDDRWGDPTVLDVSASPEGLLLDGGGRTRGLRRTLTLASGIRTGTLHVSV
FT                   QAAACDGDPETDDLPEHAACHLFQQDWGIPLTLVADGPTELTLDLRGA"
FT   gene            291308..291589
FT                   /locus_tag="Intca_0267"
FT   CDS_pept        291308..291589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_2351 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46823"
FT                   /db_xref="GOA:E6S6T7"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T7"
FT                   /protein_id="ADU46823.1"
FT                   /translation="MGIGLGITLLVLGAILTFTGLDENILNYNLDTVGIILMVGGALAL
FT                   IMGIIQNAQRTRHTTVTEHRGAPEVVERRGPDVVERRDEIIDRRDERY"
FT   sig_peptide     291308..291370
FT                   /locus_tag="Intca_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            291682..293070
FT                   /locus_tag="Intca_0268"
FT   CDS_pept        291682..293070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4358 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46824"
FT                   /db_xref="GOA:E6S6T8"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T8"
FT                   /protein_id="ADU46824.1"
FT                   /translation="MTTRSTTASPDPAAQAAAATPAHRDRWVDALRAGSLLVVVLGHWL
FT                   MVGLTPGGEITNALTEVPALQPLTWFLQVMPIFFLVGGVAHSYALESLDRRVAPGTPGR
FT                   YATFFRGRAVRLLRPTLAFLALWVALGVVAHVTGLTARPGTVGRFARDALVGVPQLLWF
FT                   VGIYLGACALAPVMRTFHERWGPYAAGLLAGAAVLVDVVRFNAVGLAGNLNFALVWLAF
FT                   HQLGFLWRDDRLTPRVGWLMVVAGYAGMLVAVTVGPYPTSMVGLPGEPVSNMAPPTVAL
FT                   LAQGIGICGLAVVARPVMNRVLRRPRAWLVVVRAAPFAMTAFLWHLTALMVVLVTLWAL
FT                   GVEQPAVASWRWWLTRPLLFAVLLVVTAVVVAVFVRFDRGPRTASDVPTTAARRSDVAA
FT                   ALSAVLVFFGILMVSIVGVDVLGSRPVFFLLGEVTPVVGLGVLAAGLAVLPGASRAWWH
FT                   RAAG"
FT   sig_peptide     291682..291837
FT                   /locus_tag="Intca_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(293077..294081)
FT                   /locus_tag="Intca_0269"
FT   CDS_pept        complement(293077..294081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0269"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182; KEGG: sna:Snas_5102 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46825"
FT                   /db_xref="GOA:E6S6T9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T9"
FT                   /protein_id="ADU46825.1"
FT                   /translation="MGTVQLDVNDDRLTRQAHQALTASRAVGRPWYEPPSFEETVVDWR
FT                   HEDQAEPKEIWVAEHDGEVTGLAMLYLPMEDNTWLAWCDLHVHPEHRRRGHGSALMDRV
FT                   VERAKDARRTSLVTEFMVPVDEPEHGYRRFVERHGYTLSNTEVVRHLDLPVPDSQLQHL
FT                   DSASRPRWAGDYRLETYVNGVPEALQPSLCEVMNQLIVDAPTGEIEYEPESMSPGRYRE
FT                   HLGVERQMARTRLTTVALGAAGEVVGYSDLVLPAGAPTTVFQWGTYVHREHRGRRLGMA
FT                   IKVENLRRLQADHPERRRVVTGNDGTNSWMVSINEALGFHVVELSPAYQRKLD"
FT   gene            complement(294226..296088)
FT                   /locus_tag="Intca_0270"
FT   CDS_pept        complement(294226..296088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0270"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006091: IPR006090; KEGG: kse:Ksed_26500 acyl-CoA
FT                   dehydrogenase; PFAM: acyl-CoA dehydrogenase
FT                   domain-containing protein; SPTR: Putative acyl-CoA
FT                   dehydrogenase; PFAM: Acyl-CoA dehydrogenase N terminal;
FT                   Acyl-CoA dehydrogenase, C-terminal domain; Acyl-CoA
FT                   dehydrogenase, middle domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46826"
FT                   /db_xref="GOA:E6S6U0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U0"
FT                   /protein_id="ADU46826.1"
FT                   /translation="MGHYKSNVRDLEFNLFEVLGRGEILGQGLYSDVDVDAAKDILREV
FT                   ARLSENELAESLLDSDRNPPVYDPATHSVTMPESFHKSFKAYVDGDWGNLDVPAELGGM
FT                   VIPPSLRWATAEMVCGANPAVHMYTASYSFANLLYHLGTDDQKKLAKHIVDKAWHTTMV
FT                   LTEPDAGSDVGAGRTKAIQQPDGTWHIEGVKRFITSAESDLVDNIVHFVLARPEGAGPG
FT                   TKGLSLFIVPKFHVDLETGELGERNGAYVTNVEHKMGLKVSTTCEVTFGDKEPAVGTLL
FT                   GDVHDGIAQMFHVIENARMFVGTKAIATLSTGYLNALEYAKQRVQGADLTQMTDKTAPR
FT                   VTITHHPDVRRSLMLQKSYAEGLRALVLYTATQLDTVAQAQNGNRTVAVEKGSDAELAS
FT                   RVSDLLLPIVKGLGSERAWVLLGTESLQTLGGSGFLQDYPIEQYVRDAKIDTLYEGTTA
FT                   IQGLDFFFRKIVRDKGQALQHVAGQIQEFAKDLGGSLDTERELLGKALEDVQAIVGHMI
FT                   NDLMKSDPRVGGEITNLYKVGQNTSRLLLSAGDLIVGWLLLRQAAIAQAALDAGATGRD
FT                   ADFYRGKVAAASFYAKNVLPKLAAERAIAESIDNDLMDVPESAF"
FT   gene            complement(296249..296881)
FT                   /locus_tag="Intca_0271"
FT   CDS_pept        complement(296249..296881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0271"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="COGs: COG0400 esterase; InterPro IPR003140; KEGG:
FT                   nca:Noca_2054 phospholipase/carboxylesterase; PFAM:
FT                   phospholipase/Carboxylesterase; SPTR:
FT                   Phospholipase/Carboxylesterase; PFAM:
FT                   Phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46827"
FT                   /db_xref="GOA:E6S6U1"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U1"
FT                   /protein_id="ADU46827.1"
FT                   /translation="MSSDFGPAQVAWAGSEDPAAPLVVLLHGRGADERSILSIAPHLPD
FT                   GPAYAAVRAPIGEGGGYAWFANRGIGRPVAESLTATMAWFREWLDGVAPAGRPVVLVGF
FT                   SGGAAFAGGLLLADPQRFAGAAILYGTLPFDAGVPVTPGHLAGTDVFVAQGDADHVIPR
FT                   ELLDRTWDYVTGESGATARTRRDPGGHGITGETAAELRDWVASITQA"
FT   gene            complement(296878..297513)
FT                   /locus_tag="Intca_0272"
FT   CDS_pept        complement(296878..297513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0272"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="COGs: COG2085 dinucleotide-binding protein; InterPro
FT                   IPR004455; KEGG: rxy:Rxyl_1793 reduced coenzyme F420:NADP
FT                   oxidoreductase; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; SPTR: Putative reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46828"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U2"
FT                   /protein_id="ADU46828.1"
FT                   /translation="MHVAIIGSGNVGGALAGAAIAAGHSVTLSAADAAHAAEVAGRTGA
FT                   TAAATNAEAVRDADVVVLAIPGLAVPAVADELRDALQGKVVIDATNPLNESFTDTFTTD
FT                   RSAAEELQERVPGVPVIKAFNTIFASRHGNPSEGGQPLDAYIAGDDAAAKAKAAELAGS
FT                   LGYRVIDAGSLRMARALEEMAFLNISLNAGNGWTWQSGWKLVGPTEAQ"
FT   sig_peptide     complement(297406..297513)
FT                   /locus_tag="Intca_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            297602..298054
FT                   /locus_tag="Intca_0273"
FT   CDS_pept        297602..298054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0273"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835; KEGG: scb:SCAB_86641 putative MarR family
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; SPTR: Transcriptional regulator; PFAM: MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46829"
FT                   /db_xref="GOA:E6S6U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U3"
FT                   /protein_id="ADU46829.1"
FT                   /translation="MTTTTTDHDLVSTFGLLMEAYNSLEKQLGDSLEREAGVPHTWFEV
FT                   MLRISRADAGLAPMGCLAEQVALTGGGVTRMVDRMVAAGLIERVPCAQDRRVVYAALTT
FT                   QGQQVLTKAVAVHEGNLQRILSDFAPGELDTLDETLRRLRTARLPD"
FT   gene            complement(298174..298247)
FT                   /locus_tag="Intca_R0005"
FT   tRNA            complement(298174..298247)
FT                   /locus_tag="Intca_R0005"
FT                   /product="tRNA-Gly"
FT   gene            complement(298230..299129)
FT                   /locus_tag="Intca_0274"
FT   CDS_pept        complement(298230..299129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_0348 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46830"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U4"
FT                   /protein_id="ADU46830.1"
FT                   /translation="MTHPTWRGVTICPCLKEPLDELARASGKDILVSPIKGFGSYQVGR
FT                   TASAGTGSGGGHVDLALRGLTPEQKLRLEGLARRIGFYADIREPTWWSPTRRQWLSEKW
FT                   SSHLHMLLKDCRHLSPEARTQLRDWYSGGNGLVGSDPDDGDRTHLRQTWKQYRSDRQGV
FT                   RPPAPQATIAVANLKHGRRNGDVKRYQAAVWRRLAAATRARILAANHLKETQIADGFFG
FT                   DVTVEMTTALYRQIAAREPQGGWPIWAEPGPRLLKRLGFIPAGARDLDDPHDEFGEPDS
FT                   VSDPVSANIDPHPAGVVQ"
FT   gene            complement(299259..301448)
FT                   /locus_tag="Intca_0275"
FT   CDS_pept        complement(299259..301448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0275"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="COGs: COG2247 Putative cell wall-binding domain;
FT                   InterPro IPR002502: IPR007253: IPR006619; KEGG:
FT                   mcu:HMPREF0573_11044 putative N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   cell wall binding repeat 2-containing protein; SMART:
FT                   Animal peptidoglycan recognition protein PGRP;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SPTR: LytC;
FT                   PFAM: N-acetylmuramoyl-L-alanine amidase; Putative cell
FT                   wall binding repeat 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46831"
FT                   /db_xref="GOA:E6S6U5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U5"
FT                   /protein_id="ADU46831.1"
FT                   /translation="MTPSTRRNLGPTTLAAAALLLPFVLSAAASASAQVQPSETGSPAR
FT                   ASSTVTASASTRPPTTRQTNHALLGADQVPGVTALAAADSAEAAEHAGGKSVKVVSAST
FT                   PVTLPDLGVVGVTWRAGSAPGASIQYRTLDGSTWSDWAFLELDGDHAPDDAEAKEAAAK
FT                   LGGARDGSAPLVTTDSEQVQVRVLAADGSTPDDAQLAVIDPGTSGTSPQPTAPTTSDST
FT                   PGTSTTPGTMTGVAEPVIRTRADWGADETLRDPSEPDYGSVDLAVVHHTAGSNSYSEAD
FT                   VPGIIRGIYAYHVKTRGWRDIGYNFLVDRFGRIWEGRYGGVDRAVVGAHAYGVNSWSMG
FT                   ASVLGDFETTAPPDADKQAIGTALRDLIAWKADVHRFDVLGTTTIGGVTYDNISGHRNV
FT                   NQTECPGQYLYATLPSLRTATAALSPSAPRYAGINRYATAAAASAATFAPGAPVAYIAT
FT                   GASFPDALAGGPAGGYRGGPVLLTTRSSLPVDTETELQRLKPAEIVILGGTAAVSDAVR
FT                   SELAVWAPTVTRVSGADRYSTAAAVSARTFGTGVPVAYIATGANFPDALAGGPAGGFRG
FT                   GPLLLTTSATVPAPTLTELGRLNPASIVVLGGTSAISPEVESVLHDYAPSVVRVAGDDR
FT                   FATAAETSRRTFSPGVPVVFVATGTNFPDALSGGPMGGDLGGPVLITRPDTLPATTADE
FT                   LTRLAPGKVVVLGGTAAVSDAVSKRLYNYEVPPSP"
FT   sig_peptide     complement(301287..301448)
FT                   /locus_tag="Intca_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(301445..301999)
FT                   /locus_tag="Intca_0276"
FT   CDS_pept        complement(301445..301999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2257 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46832"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U6"
FT                   /protein_id="ADU46832.1"
FT                   /translation="MQPATKVLSITGKGPFGMFGPDLFGDEKARALDYPVLATSEPGAG
FT                   LEASWAAYDPSEIWTLTNLGSLCADRGAATQAVARGKGWDWVFGGGTARYAAPTVVDPP
FT                   DREPYHAVQPVDTGLDGTFAQVIRRSDIAIADHECPVVADEDWSPQLGRALVFSVPEAV
FT                   LPQPWEGRVPVPEITLFQGSP"
FT   gene            302509..302838
FT                   /locus_tag="Intca_0277"
FT   CDS_pept        302509..302838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0277"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: srm:SRM_00813 conserved hypothetical
FT                   protein containing nucleotidyltransferase domain; PFAM: DNA
FT                   polymerase beta domain protein region; SPTR: Putative
FT                   uncharacterized protein; manually curated; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46833"
FT                   /db_xref="GOA:E6S6U7"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U7"
FT                   /protein_id="ADU46833.1"
FT                   /translation="MTETAAPARGPLSGPTGRLVAAHREELREVLRRHGVTNAQIFGSV
FT                   ARGDDRPGSDLDLLVELPRGTSLFDLAGIQVELEEVLGVEVDLGTIGSLKPRIRPRVER
FT                   DLVAL"
FT   gene            302828..303175
FT                   /locus_tag="Intca_0278"
FT   CDS_pept        302828..303175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0278"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: afo:Afer_0034 protein of unknown
FT                   function DUF86; PFAM: protein of unknown function DUF86;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46834"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U8"
FT                   /protein_id="ADU46834.1"
FT                   /translation="MLYEPFGLDRLYDIADAIAAIRSHVAQGTLSEAVVFDAVRMRLLE
FT                   IGEAVKGLSEELTAREPAIPWRTIARSRDNLAHHYFATELQIVEDTIKADLAPLDEAVA
FT                   RLIAEVERPRG"
FT   gene            complement(303302..303375)
FT                   /locus_tag="Intca_R0006"
FT   tRNA            complement(303302..303375)
FT                   /locus_tag="Intca_R0006"
FT                   /product="tRNA-Gly"
FT   gene            303459..303890
FT                   /locus_tag="Intca_0279"
FT   CDS_pept        303459..303890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecx:EcHS_A2423 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46835"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U9"
FT                   /protein_id="ADU46835.1"
FT                   /translation="MDLVKQDALITHVRERGGHETQVAVTLEQFFDGNDCEWCIAPNRS
FT                   EDLTLGDVRRALVELRGHPDVHDVLVELDQLEFGTYPDDEWPYASGAAVITTLMPDEVD
FT                   ALLLEVEVDPSGGPASSLDWLVDAPAIPAGHHYVGVWWS"
FT   gene            complement(303901..304821)
FT                   /pseudo
FT                   /locus_tag="Intca_0280"
FT   gene            304930..305508
FT                   /locus_tag="Intca_0281"
FT   CDS_pept        304930..305508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0281"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COGs: COG0717 Deoxycytidine deaminase; InterPro
FT                   IPR011962: IPR008180; KEGG: kse:Ksed_26270 deoxycytidine
FT                   triphosphate deaminase; PFAM: deoxyUTP pyrophosphatase;
FT                   SPTR: Deoxycytidine triphosphate deaminase; TIGRFAM:
FT                   deoxycytidine triphosphate deaminase; PFAM: dUTPase;
FT                   TIGRFAM: deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46836"
FT                   /db_xref="GOA:E6S6V0"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V0"
FT                   /protein_id="ADU46836.1"
FT                   /translation="MLLSDKDIRAEVDGGRVVLDPWDPAMIQPSSIDVRLDKYFRLFDN
FT                   HKYPYIDPAQEQPDLTRLVEVGPDEDGFVLHPGEFVLGSTWEKVTLPDDLAARVEGKSS
FT                   LGRLGLLTHATAGFVDPGFSGHVTLELSNVATLPIMLYPGMKIGQLAFFRLSSPAENPY
FT                   GSGVYGSHYQGQRGPTASRSFQNFHRTRV"
FT   gene            305532..306233
FT                   /locus_tag="Intca_0282"
FT   CDS_pept        305532..306233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0282"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="InterPro IPR000073; KEGG: sco:SCO0635 hypothetical
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Putative
FT                   uncharacterized protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46837"
FT                   /db_xref="GOA:E6S6V1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V1"
FT                   /protein_id="ADU46837.1"
FT                   /translation="MPLASLAWDARPARAGAVALVLHGGAVDGREPNHPWSHNVARLVP
FT                   FARALRKVPGPLAVARLRFRYRGWNGAEASPVEDARWALAQIRADYPDAPVALVGHSMG
FT                   GRTALTVADEDNVRLVVGLSPWIERGDPVPRDGRKTVLIHGDRDIITPLSASRRIVEGL
FT                   LDDGRDATLIRVARGDHAMLVRAGLWSTLVVDIVGSTFARELGGWSEPRSGPIGAVVAR
FT                   AVHGSGGILDI"
FT   sig_peptide     305532..305576
FT                   /locus_tag="Intca_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            306393..307511
FT                   /locus_tag="Intca_0283"
FT   CDS_pept        306393..307511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0283"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1125 ABC-type proline/glycine betaine
FT                   transport systems ATPase components; InterPro IPR003439:
FT                   IPR003593: IPR017871; KEGG: kse:Ksed_26260 glycine
FT                   betaine/L-proline transport ATP binding subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: Putative ABC
FT                   transporter ATP-binding subunit; PFAM: ABC transporter;
FT                   TIGRFAM: glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46838"
FT                   /db_xref="GOA:E6S6V2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V2"
FT                   /protein_id="ADU46838.1"
FT                   /translation="MIRFERVTKTYGAGTAGATTAVDDLTLEAPTGRITVLVGPSGCGK
FT                   TTTLRMVNRMITPTSGTITIDGRDTAALDVAELRRNIGYVIQHAGLFPHRTVVDNVATV
FT                   PRLLGVDRRTARARAMELIERVGLDPSLARRYPAQLSGGQQQRVGVARALAADPPVMLM
FT                   DEPFSAVDPVVREQLQNEFLRLQSDLGKTILFVTHDIDEAIKLGDQVAVLRVGGVLAQL
FT                   DTPARLLADPVDDFVAEFVGRDRGYRALAFEDAPELALTTEPTTRLGAPGDEVRAIGQP
FT                   WVLALGADGDPVGWVRADAVTTTVDATLLHRGGTVARSDGSLRALLDAALSSPSGRGVV
FT                   ADRDGRFLGTILASQVVPAIEARREHKEVPAS"
FT   gene            307508..308155
FT                   /locus_tag="Intca_0284"
FT   CDS_pept        307508..308155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0284"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: nml:Namu_1405 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC-type glycine betaine transport,
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46839"
FT                   /db_xref="GOA:E6S6V3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V3"
FT                   /protein_id="ADU46839.1"
FT                   /translation="MSWALDHLGEILSRAGQHAWLAGIPLVLGLLIALPLGWLAARKAW
FT                   LKGPLLSGTGLLYTIPSLALFILLPSILKRGILDPVNVIVAMTIYTVALLTRTVADALS
FT                   SVDPSTRAAATAMGYGGFARFRAVDLPLAVPVLAAGLRVAAVSNVSIVSVASLIGVNQL
FT                   GYFLTNGYARSFATEVWVGIIACVALAVVFDVAIHGIARLLTPWARAAEARS"
FT   sig_peptide     307508..307627
FT                   /locus_tag="Intca_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            308152..308937
FT                   /locus_tag="Intca_0285"
FT   CDS_pept        308152..308937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: kse:Ksed_26240 ABC-type proline/glycine betaine
FT                   transport system, permease component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC transporter-associated permease; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46840"
FT                   /db_xref="GOA:E6S6V4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V4"
FT                   /protein_id="ADU46840.1"
FT                   /translation="MIDDLVTWLQDPAHWSGPDGVPARLSEHVVYTAVTVLVAVVLAVP
FT                   LGAWVGHTGRGRWLVTGANALRAVPSLGLLFAISMLVGPLIQSSLAFTLPSIIVLVILA
FT                   IPPLLSGSYAGVESVDPAARDAARGMGMRGPQVLAQVELPIAMPLLLSGLRSATLQVIA
FT                   TATIAASISLGGLGRYLIDGLAARDLSQMVAGSVLVALLALFTDGALALVQRFLVSPGI
FT                   SGRRTRVGPTDVARIGSPRAGVSSTPRGTSPAVSPNGSD"
FT   sig_peptide     308152..308280
FT                   /locus_tag="Intca_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            308940..309863
FT                   /locus_tag="Intca_0286"
FT   CDS_pept        308940..309863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0286"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG1732 Periplasmic glycine
FT                   betaine/choline-binding (lipo)protein of an ABC-type
FT                   transport system (osmoprotectant binding protein); InterPro
FT                   IPR007210; KEGG: nml:Namu_1403 substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: ABC-type glycine betaine transport,
FT                   substrate-binding protein; PFAM: Substrate binding domain
FT                   of ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46841"
FT                   /db_xref="GOA:E6S6V5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V5"
FT                   /protein_id="ADU46841.1"
FT                   /translation="MPRTRTLLAGLLAAAVLPLAACGSAEDPLAPSQPAGTNAGTGGAS
FT                   SVTIGSADFPESALLGEIYAQALEAKGVTVQRQFNIGNRETYLKAIEGGEVDILPEYTG
FT                   SLTNYFDKTVTATNPDEVYDALKSKLPGGLTVLAKSTAEDKNSMVVTKETADAWSLKAI
FT                   PDLVAHQDELSIAAPPEFRTRQQGLVGLKEVYNLEPKEFRPLASQATVEALKNGQVKAA
FT                   NIFSTDPSIAANGFVVLEDPELLFGSDNVVPLVRDDVAGSVQAPLDAVSAKLDTTALAD
FT                   MVKQVVVDKKDASVVAKEWLTGAGLI"
FT   sig_peptide     308940..309071
FT                   /locus_tag="Intca_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            309975..310739
FT                   /locus_tag="Intca_0287"
FT   CDS_pept        309975..310739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0287"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073;
FT                   KEGG: kse:Ksed_22440 predicted hydrolase or acyltransferase
FT                   of alpha/beta superfamily; PFAM: alpha/beta hydrolase fold;
FT                   SPTR: Alpha/beta hydrolase fold protein; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46842"
FT                   /db_xref="GOA:E6S6V6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V6"
FT                   /protein_id="ADU46842.1"
FT                   /translation="MSIAHRVVGSGPRTVIVSHGWFGSSEGWGLFPDYLDGDANTYLFA
FT                   DLRGYGARRDVEGNQTLDEIADDLIALADEHGAERFALLGHSMSGAFIQRVLARVPERV
FT                   EALVALSPVSSSPFPFDDAGRELFWGAVDDRDKRYAIIDYTTGNRNCAPWVNRMVDFSL
FT                   ATSTRDAFANALEAWANPDFADEVRGSDAPVLVLVGEHDPALSADYARAYWLPLFTKAK
FT                   IEVIPNAGHYAMFETPVNLATRIDDFLKDVGS"
FT   gene            310742..312076
FT                   /locus_tag="Intca_0288"
FT   CDS_pept        310742..312076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0288"
FT                   /product="cytochrome P450"
FT                   /note="COGs: COG2124 Cytochrome P450; InterPro IPR001128:
FT                   IPR017972: IPR002397; KEGG: gob:Gobs_1911 cytochrome P450;
FT                   PFAM: cytochrome P450; SPTR: Cytochrome P450; PFAM:
FT                   Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46843"
FT                   /db_xref="GOA:E6S6V7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V7"
FT                   /protein_id="ADU46843.1"
FT                   /translation="MSETAEATRLLHDPSTYVDGVPFGVLADLRREHGVVRVEEPAQVG
FT                   WPEGPGYWLVLRHPDVVRVLREPRTFSSWLGGTQIRDPATPADLAFVRRMMLNMDPPEH
FT                   SRLRRMLAKSFTPRAVAALEGQIGAHARTIVDRMLDGPRECDFAKDVAADLPLLALADI
FT                   LGVPPSDRWLMFDWSNRVIGWQDPDYASSAAFTGEGGSDLAAAALAVRPSPGPDGRMPD
FT                   PRSRAGMPDLYTYAAGLGERKRADPGHDVMSILMAQRDDSAGGDGHVSVEEFENLFWLF
FT                   AVAGNETLRNGLPGAMIGLLDNPDAQEALRRDPARIAPAVDELLRWWTPVMTFRRTATV
FT                   DTEIAEQPIAAGDKVVVSFASANRDEAVFADPDGLDLDRNAKAHLAFGHGPHFCLGAHL
FT                   ARVQMSALFTEVLTRTSWIQAAGEPAHLRSNFQRGVKRLPVRWTA"
FT   gene            312134..313156
FT                   /locus_tag="Intca_0289"
FT   CDS_pept        312134..313156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4025 NB-ARC domain-containing
FT                   protein; SPTR: Putative WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46844"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V8"
FT                   /protein_id="ADU46844.1"
FT                   /translation="MPTISPDAQRVAVQHYGPGQTLELRSAADGAVRWSKTLEDLGDQS
FT                   PEGPLEDMADGVVWLDASTLAVVGATQWLELDADSGAIEKAHPFPDQLPFITEVRDFGG
FT                   GRFGVSVEGDQTLVIDRSRPTDGGQRIDGYLFGHPGTGRAVTVVEHKADNTMALTPLRS
FT                   TRDPRPAGGSVTVDGFAPWVSFTRDGAQLVVCVENRVELRDARTGALRRTFVGHSGSVM
FT                   QARVAGSARPGLDGRAGRRDRFGELPLGECPGDCQVAATAMSPDGATAYGSVEYIVDMG
FT                   PGDRGVVVAWDAATGERRATWPTPWPAYSISVTLSGRTALLNGRWGWGLMDLSSGALVW
FT                   "
FT   gene            313153..313686
FT                   /locus_tag="Intca_0290"
FT   CDS_pept        313153..313686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0290"
FT                   /product="WD40 repeat, subgroup"
FT                   /note="InterPro IPR019781: IPR001680: IPR019782; KEGG:
FT                   gob:Gobs_1160 WD40 repeat, subgroup; PFAM: WD40 repeat,
FT                   subgroup; SPTR: WD40 repeat, subgroup; PFAM: WD domain,
FT                   G-beta repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46845"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V9"
FT                   /protein_id="ADU46845.1"
FT                   /translation="MSRDDGLHLVDLRDGRVVTTRTSDDLAASFTWTADGRTLVAGTMG
FT                   GRVHFVDPSTLADRAPSRLVVGGFVIDLATSPDGKLIASLGTDGDVMLWDPATMRPYGR
FT                   PVTGMRLWGLLSFSSDSDTVRVLFENGTRTDIDVDPDDWVRAGCRVWGRDLSAEESAVI
FT                   RPGQPPRSTCAGLI"
FT   gene            complement(313880..314068)
FT                   /locus_tag="Intca_0291"
FT   CDS_pept        complement(313880..314068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46846"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W0"
FT                   /protein_id="ADU46846.1"
FT                   /translation="MHEGLDQAGTATHAGYTDEMEPTFRATVYVNISHCGVEVGTTHDP
FT                   FHLTDVQSAVEYTEQHD"
FT   gene            complement(314186..314905)
FT                   /locus_tag="Intca_0292"
FT   CDS_pept        complement(314186..314905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_3734 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46847"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W1"
FT                   /protein_id="ADU46847.1"
FT                   /translation="MFGRPAATPQPLDTVPDGVPVLSRGRHRNPRKGACFMEMASYLAG
FT                   ERWSDHPKCTHAVLASLARCVNDALGDVRRQELAVMIPEVVGLNPDDRRVAPLLMRRAA
FT                   LAALPIASAERQNIMALAVMGAERHLNDLAGRDPDELTPETTAALAAVPGAEKWAHDFV
FT                   RRVGTRDLRAEAAAKVVALAVNGIARACVDDPSADLVRLLRQAIDDTKAVAAEQAASRT
FT                   TAALPMAMQEVRSQAAH"
FT   gene            complement(315017..316279)
FT                   /locus_tag="Intca_0293"
FT   CDS_pept        complement(315017..316279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0293"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="COGs: COG3284 Transcriptional activator of
FT                   acetoin/glycerol metabolism; InterPro IPR003018: IPR001867;
FT                   KEGG: nca:Noca_2091 transcriptional regulator; PFAM:
FT                   transcriptional regulator domain-containing protein; GAF
FT                   domain protein; SPTR: Transcriptional regulator; manually
FT                   curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46848"
FT                   /db_xref="GOA:E6S6W2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W2"
FT                   /protein_id="ADU46848.1"
FT                   /translation="MAMQPYRDRGVRAQVAESWVRSAAAGVQADTVDAPITLAADVLHD
FT                   HREAHPLAAVFPALDDVLGQAARDCDAIMAVSDAAGQLLWVCGTPSVLRRAEAIGFVEG
FT                   SNWDERVAGTNAPGMALRLDAPVRIIGAEHFRRSVQRWSCAATPIHDPSDQSLLGVLDI
FT                   TCADELVVPQTMAMVRAAARMAEAELARELLVRSRPGGSGTERQRPGLGAMLEVLGRDE
FT                   ALLRVDDGHGRQSTLRLSRRHSEILLLLAAAPRGLSGDELAVLLYEDDVSPSTLRVELG
FT                   RLRSLLGDELLASRPYRLVADVSSDWLAVESHLAAGAIGQALRAYRGPLLPRSAAPGVS
FT                   RLRDGLAGSVRRAVLASREADLMSTWTRSSWGADDYEMWQAQLSALGTRSPLRPLVTAQ
FT                   LARLDRELGTGTEPSGIRTAR"
FT   gene            316439..317962
FT                   /locus_tag="Intca_0294"
FT   CDS_pept        316439..317962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0294"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590: IPR016160; KEGG: nca:Noca_2092 aldehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; SPTR: Aldehyde
FT                   dehydrogenase (NAD(+)); PFAM: Aldehyde dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46849"
FT                   /db_xref="GOA:E6S6W3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W3"
FT                   /protein_id="ADU46849.1"
FT                   /translation="MTIYAPPGSADSLVSVEPRYGHFIGGNWVEPKKGEYFENISPVTG
FT                   RAFCEVGRGTEEDIEAALDAAHAAAPAWGRTSLGDRSLILNRIADRIEENLEMLAVAET
FT                   WENGKAVRETLAADLPLAVDHFRYFAGVLRGQEGSSSEIDENTVAYHFHEPLGVVGQII
FT                   PWNFPILMAVWKLAPALAAGNCVVLKPAEQTPWSILKVVELIGDLLPAGVLNVVNGFGV
FT                   EAGKPLASSPRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNVFFDDVAQERD
FT                   AFYDKALEGFTMFALNQGEVCTCPSRALVQRSIYADFVPDAIARVEKIVQGNPLDTTTT
FT                   MGAQASNDQLEKILSYIDIGRQEGAKVLTGGERNVLDGDLAGGYYVTPTVFEGSNSMRI
FT                   FQEEIFGPVLSLTGFDDEADALSIANDTLYGLGAGVWTRDGSRAYRMGRGIKAGRVWTN
FT                   CYHQYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSPDALGFF"
FT   gene            317967..318425
FT                   /locus_tag="Intca_0295"
FT   CDS_pept        317967..318425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0295"
FT                   /product="protein of unknown function DUF779"
FT                   /note="COGs: COG3564 conserved hypothetical protein;
FT                   InterPro IPR008497; KEGG: sen:SACE_2914 hypothetical
FT                   protein; PFAM: protein of unknown function DUF779; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF779)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46850"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W4"
FT                   /protein_id="ADU46850.1"
FT                   /translation="MDETRLSRVELTREAADLLRRLTARHGPLMFHQSGGCCDGSAPMC
FT                   YPANEFLTSDADVLLAALVVPDVQDAVPFWMSRVQYEYWKHTHLTVDVVPGRGSGFSVE
FT                   APEGVRFLIRSRLLTDAEAEAWGIQPPSLLGPEALFGPPGAAPPGLRH"
FT   gene            complement(318640..319437)
FT                   /locus_tag="Intca_0296"
FT   CDS_pept        complement(318640..319437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0296"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107:
FT                   IPR001972; KEGG: pac:PPA1973 stomatin/prohibitin-like
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: SPFH domain / Band
FT                   7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46851"
FT                   /db_xref="GOA:E6S6W5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W5"
FT                   /protein_id="ADU46851.1"
FT                   /translation="MPGFIAPVLAVLVIVAAVIATSLRVIPQYERGVVFRLGKLRPLYQ
FT                   PGLHLLVPGVFRLQRVDLRVVTLTIPPQEVITKDNVPARVNAVVLFNVVDPEAAVMQVE
FT                   NYAVATSQIAQTTLRSVLGRADLDTLLAHRDDLNRDLREIIELQTKPWGVDVSVVEIKD
FT                   VEIPEQMQRAMAREAEAERERRAKVINARGELQASGELKQAADVLSQSPASLQLRYLQT
FT                   LLELGADQNSTVVFPLPMDIVGPLLNRLAPPPANPPANPPASS"
FT   sig_peptide     complement(319378..319437)
FT                   /locus_tag="Intca_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(319443..320123)
FT                   /locus_tag="Intca_0297"
FT   CDS_pept        complement(319443..320123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3182 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46852"
FT                   /db_xref="GOA:E6S6W6"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W6"
FT                   /protein_id="ADU46852.1"
FT                   /translation="MRTPSVTVLLVSGYSAVLLVVAWLFDRMGARSAERSARWRTGNFI
FT                   YHEDQDAWKCHQDQWLWPASFDPDKRVIRYEGQHAICGRCPVKTECSPTPGPRELTRQV
FT                   DPWPHSEAGRFHRGIALAVASVAVFMPTAMLLGAHGAGDVIVLVTTVAVGIIAGVPLAQ
FT                   HLWNAPTNFPQHLRSDASSDAPGMPEPTADAAVAPLDHLLDRYQTRWASDRRRVDLPDP
FT                   KTRK"
FT   sig_peptide     complement(320025..320123)
FT                   /locus_tag="Intca_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(320132..322441)
FT                   /locus_tag="Intca_0298"
FT   CDS_pept        complement(320132..322441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0298"
FT                   /product="nitric oxide reductase, NorZ apoprotein"
FT                   /note="COGs: COG3256 Nitric oxide reductase large subunit;
FT                   InterPro IPR000883; KEGG: mjl:Mjls_1539 nitric-oxide
FT                   reductase subunit B; PFAM: cytochrome c oxidase subunit I;
FT                   SPTR: Nitric oxide reductase; PFAM: Cytochrome C and Quinol
FT                   oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46853"
FT                   /db_xref="GOA:E6S6W7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W7"
FT                   /protein_id="ADU46853.1"
FT                   /translation="MVATPTQRDTSQRQMLVGKGWVQGVALVMLFGFFVMGILAYRTYT
FT                   ASMPQPDKVVSQSGETVFTTEDITAGQVIFQARGLMQYGSIMGHGGYLGPDFTAEYLRH
FT                   ATEFTEHQIRDSGAQDPRTLNVEEWRTNRYDETTGVLTFTDNQVSAFQDAKAYYTGFFG
FT                   ENSTKYGLKPRLITDPQQIHQLTAFFAWTAWASAAERPGFDYSYTNNWPMEPRVENGPT
FT                   PDLLVWSGLSLIALIGGTGLLFAIYGRWSRKIGWHSEEAPAIAFRQPGTVGLTLAQRAT
FT                   AWFFFVIALLFLIQVVVGAAAEHYRADILSFFGFDLAQWLPYNLARTWHVQLSLFWTAA
FT                   GFLAAGIFLTPLISGREPKGQHRIAYALLGALAVVVFGSLTAEALSIHGVEWAKGPLFQ
FT                   QQWEYLDLPRIFQILLTVGMILWITMIFRGIRSRLKGESKGNMPWLFFFSALAIPAFYA
FT                   VGLLASSETHLTVAEFWRFWVVHLWVEDFLELFTTVMVAYIFVMLGVVREKIALGIIFM
FT                   DVILYSMGGVIGTMHHLYFSGTPVEHMALGAFFSAAEVIPLTFLTVEAWAFMQLGARQE
FT                   AKTSAPFPHRWAVMFLVAVGFWNFLGAGVFGFLINLPIVSYYEIGTALTANHGHAAMMG
FT                   VYGMLAVGLAMFALRYLIPPDKWPEKWAKVSFWSLNIGLAWMVFATLLPLGVLQLYHSV
FT                   GQGYYEARELAFITNNTNALLEWGRMPGDLIFIIGGVLPFLWITWLGLRHYRDGTVVDE
FT                   LPQDVLFVELEPVKKK"
FT   sig_peptide     complement(322322..322441)
FT                   /locus_tag="Intca_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(322651..323331)
FT                   /locus_tag="Intca_0299"
FT   CDS_pept        complement(322651..323331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3173 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46854"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W8"
FT                   /protein_id="ADU46854.1"
FT                   /translation="MTDHLDSRALRGTDTYGQRFMRPGTYRYALGPAGTGRYTQDHPYV
FT                   ITVGEGEPKRGEMRQTLVVVHREGRTLVPDQPKLSINAGDMVMWHAPGAGTRPFVVVGE
FT                   KEFFTSERLVNESGYTHAFTSEGVYEWADAHGSGARGVVRVTNPDVSTAKGQRAWARSQ
FT                   RQGTVVMVNDGQAEPAEVDVVVGQTVFFAVVAGPGITITDQSLLEHDRPGKGGAFYRKA
FT                   APVR"
FT   gene            complement(323345..324148)
FT                   /locus_tag="Intca_0300"
FT   CDS_pept        complement(323345..324148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3174 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46855"
FT                   /db_xref="GOA:E6S6W9"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W9"
FT                   /protein_id="ADU46855.1"
FT                   /translation="MSEIIAAIDEGAANDFLDIVVAGVGPQSTSGSSSLGPFGASYSVT
FT                   GTLTNGTVDLIPPDTIRVADLRLDWTATLTLSIDLGDFLPEIHIPQVCVTIPCVGKVCT
FT                   PAIDITWPTLSVPLSFGDFVKATVDLGIVVGLAGGVWKVEGVVQGVPSLSFGPGTAAIV
FT                   TAIGLAVAAAVAWVPFIGPFLAGLAIAVASAIGVAGLTGWLGPIISPFISGTRFPVYDQ
FT                   PEWFEVLPSAGASDPAVFVHLDAIGAEVQHNAPEDELVLTADISA"
FT   gene            complement(324158..324880)
FT                   /locus_tag="Intca_0301"
FT   CDS_pept        complement(324158..324880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3175 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46856"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6X0"
FT                   /protein_id="ADU46856.1"
FT                   /translation="MSLTESSEVFVSAHETAINDLVTAICQTRPHLLSYGSPAFVPASD
FT                   VYDTQMPPILFPGSGGIEWHVRFSIPHLDLFDEDSPLPPELSLGPGQFSLSTTVELCVD
FT                   CRKGGRRDDGGKDDGGKDDGHDHPDEPNRDRPWDDKPSKVEHPVCTKLDVFAVGHLVGT
FT                   STAGGPAVGFALDAVEIVDIHPDELESVLECLLAQMLRAALAQVRLPVSALQAGAFSLT
FT                   PTVGPLIDTDVVLARGNL"
FT   gene            complement(324964..327327)
FT                   /locus_tag="Intca_0302"
FT   CDS_pept        complement(324964..327327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0302"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017: IPR017900: IPR017896; KEGG: kse:Ksed_26190 Fe-S
FT                   oxidoreductase; PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; SPTR: Putative
FT                   iron-sulphur-binding reductase; PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46857"
FT                   /db_xref="GOA:E6S6X1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6X1"
FT                   /protein_id="ADU46857.1"
FT                   /translation="MTVLQIIAIVISLAITVVGVALLTKTINHYVATFRLGQPEYRGDD
FT                   KGARTVTLVREFLGHTRMSRLPVVAIAHWFTMVSFGILFFTLINAFGQLFEPSWTLPLI
FT                   GHFPPYEWITEFFAWTGLLGIVLLMAIRQQNHPRSAAGEHGRRSRFFGSTWWQAYYVEL
FT                   TILGVTLCILALRVLEYALAKVEGLDTASALNFPMTAWLGESFTGLSVAALEGAIVVIA
FT                   TLKILISMAWMITIALNPTMGVAWHRFLAFFNIFWKRHADGRTSLGELQPIRVNGEPLD
FT                   FENVDDLDEDAALGVGKIEDFTWKGLLDFTTCTECGRCQSQCPAWNTDKPLSPKLLVMS
FT                   LRDHAHAKAPWLQASEEVRAKGIDAGSFSERTKAAVAVDQLVGETGYDITDPLGAYQPY
FT                   GAPDGGGAVIDQDVLWSCTTCGACVEQCPVDIEHVDAIVDMRRYKNLIESAFPSELGGL
FT                   FKNLEKNANPWGLAPRLRMDWAKDLPFDVPQVGGSGSSDVEALEDVDYLFWVGCAGAYE
FT                   DRAKKTTRAVAELLHLADVRFAVLGDGEACTGDSARRAGNEFLFQMLAQQNVEVLNEVG
FT                   ATKIVVTCAHCFNTIKNEYPQLGGTYEVLHHTQLLNRLVREKRLTPVARPGDGDGLGMS
FT                   RAGSTGSKVTYHDPCYLGRHNQVYAPPRELLQILPGVEYAEMERSGEKSFCCGAGGARM
FT                   WMEEKLGTRINTNRTEEALATGADRIAIGCPFCKVMLTDGLNAAVQEGKKAEGEVEVVD
FT                   VAQMLLAAVRRGDGGASVEQAHAVPDAPTPEPAI"
FT   sig_peptide     complement(327259..327327)
FT                   /locus_tag="Intca_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            327566..328495
FT                   /locus_tag="Intca_0303"
FT   CDS_pept        327566..328495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0303"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro IPR001926:
FT                   IPR005856: IPR005859: IPR001216; KEGG: bcv:Bcav_2609
FT                   cysteine synthase A; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; SPTR: Cysteine synthase; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-phosphate dependent enzyme; TIGRFAM: cysteine
FT                   synthase A; cysteine synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46858"
FT                   /db_xref="GOA:E6S7G3"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G3"
FT                   /protein_id="ADU46858.1"
FT                   /translation="MPIYDDVTKLIGNTPLVRLNKVTDGAEATVAAKLEFYNPASSVKD
FT                   RIGVAIVDAAEASGELRPGGTIVEATSGNTGIALAMVGAARGYDVVLTMPESMSKERRA
FT                   LLRAFGAELVLTDPATGMKGAVERAEQIAAERGGVLARQFANEANPEIHRKTTAEEIWK
FT                   DTDGQVDIVVAGIGTGGTITGVGQVLKARKPGVKIIAVEPEESAILNGGQPGPHKIQGI
FT                   GANFVPEVLDTTVYDEVIDINASTAVEYARRAATEEGLLVGISSGAAIAAAVQVAARPE
FT                   SKGKTIVVIVPSFGERYLSTILFEGLVD"
FT   gene            328511..329221
FT                   /locus_tag="Intca_0304"
FT   CDS_pept        328511..329221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0304"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="COGs: COG1045 Serine acetyltransferase; InterPro
FT                   IPR001451: IPR005881: IPR018357; KEGG: bfa:Bfae_12330
FT                   serine O-acetyltransferase; SPTR: Serine acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase; TIGRFAM: serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46859"
FT                   /db_xref="GOA:E6S7G4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G4"
FT                   /protein_id="ADU46859.1"
FT                   /translation="MTTAAKREDVAPTPAHATPLKLVRTPDGEPAQRHTAKKTSYAAGL
FT                   GLVRKVTQRVREDLDGALERDPAASSRLEVALTSPGLHAIWAHRGLHELWKLPGGRLPA
FT                   RVLATVTRSVTGVEIHPAAQIGRRFFIDHGMGVVIGETAEVGDDVMLYHGVTLGGRSME
FT                   HVKRHPTVGNRVTIGAGARVLGPVLVGDDTQIGANAVVVKDVPSGAVAVGVPAELRFPK
FT                   RDATNHWLDPAMFI"
FT   gene            complement(329399..329489)
FT                   /locus_tag="Intca_R0007"
FT   tRNA            complement(329399..329489)
FT                   /locus_tag="Intca_R0007"
FT                   /product="tRNA-Ser"
FT   gene            329692..330630
FT                   /locus_tag="Intca_0305"
FT   CDS_pept        329692..330630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0305"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR000489: IPR006390; KEGG: pfr:PFREUD_02120
FT                   dihydropteroate synthase
FT                   ((2-amino-4-hydroxy-7,8-dihydropteridin-6-yl)methyl-
FT                   diphosphate:4-am inobenzoate
FT                   2-amino-4-hydroxydihydropteridine-6-methenyltransferase);
FT                   PFAM: dihydropteroate synthase DHPS; PRIAM: Dihydropteroate
FT                   synthase; SPTR: Dihydropteroate synthase
FT                   ((2-amino-4-hydroxy-7,
FT                   8-dihydropteridin-6-yl)methyl-diphosphate:4- aminobenzoate
FT                   2-amino-4-hydroxydihydropteridine-6- methenyltransferase);
FT                   TIGRFAM: dihydropteroate synthase; manually curated; PFAM:
FT                   Pterin binding enzyme; TIGRFAM: dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46860"
FT                   /db_xref="GOA:E6S7G5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G5"
FT                   /protein_id="ADU46860.1"
FT                   /translation="MSGLRPVDPVPAPPLVLRGRTFDAGRPAVMAIVNRTPDSFFGGNR
FT                   HADLDSAKRALEEALALGADIIDVGGVRAGQEGEPVDEDEEVRRVVPFLEWARRAHPDV
FT                   ILSLDTWRSGVALAAAGAGVDMVNDTWAGADPDLVRVAARLGAGYVISHTGGLPPRTDP
FT                   VAVTYGDDPLDVVRDVVTTLADGARAAELSGIPPERILVDPTLDFGKTTMHSLEVLRHT
FT                   ADVAALGYPVLQALSRKDFVGESLDVPVEDRLEGSLAATAVAAWLGATVFRAHDVRATR
FT                   RVVDMVATIRGDRPPVHARRGTPQTGSANSR"
FT   gene            330856..331059
FT                   /locus_tag="Intca_0306"
FT   CDS_pept        330856..331059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0306"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="COGs: COG1278 Cold shock protein; InterPro
FT                   IPR002059: IPR012156: IPR011129: IPR019844; KEGG:
FT                   xce:Xcel_1267 cold-shock DNA-binding domain protein; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein;
FT                   SPTR: Cold shock protein; PFAM: 'Cold-shock' DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46861"
FT                   /db_xref="GOA:E6S7G6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G6"
FT                   /protein_id="ADU46861.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAQDGGGPDVFVHYSAIQSNGYRSLDEA
FT                   QRVEFEVTQGPKGPQADAVRPL"
FT   gene            complement(331157..332716)
FT                   /locus_tag="Intca_0307"
FT   CDS_pept        complement(331157..332716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0307"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="COGs: COG1316 Transcriptional regulator; InterPro
FT                   IPR004474; KEGG: kse:Ksed_26120 cell envelope-related
FT                   function transcriptional attenuator common domain protein;
FT                   PFAM: cell envelope-related transcriptional attenuator;
FT                   SPTR: Cell envelope-related transcriptional attenuator;
FT                   TIGRFAM: cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family; PFAM: Cell envelope-related
FT                   transcriptional attenuator domain; TIGRFAM: cell
FT                   envelope-related function transcriptional attenuator common
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46862"
FT                   /db_xref="GOA:E6S7G7"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G7"
FT                   /protein_id="ADU46862.1"
FT                   /translation="MTVHDRRETAPVGRRSARHQLRTHFRRSMRLVALSAAIPGTGLIR
FT                   TRARMAGWAIFLAFLLAIAVGVALIVSQGAKDVGLYVLSHPDVLQGLGVLLAVGGLFWC
FT                   ASIIATAVAARPDRLDRTRTRVLAVFTTLLVGLVGAGTYKGAEAALITTDTIRGVFSAE
FT                   GLRPGEGAKVVNEPDVDPWRDTPRVNLLLMGSDAGIGRTGTRPDSMIVASVDTRTGRTA
FT                   LISVPRNFEWAPLPADSPLRERWPGGFYGGTHDQPDCPRKAADAADPCAINAIWTEVDQ
FT                   FREANPDAYADEVVPGRSETRDVVGEVLGLKIDHLVVIDLQGFMDLVNAMGGVEVNVKL
FT                   GGFDGKTPLPYGQKFADGSYAHYFDDLGPQQLNGYQALWYARTRAADNDDHRQRRQRCV
FT                   VQAVVDQVDPAFMLAKYASIAHILKENVYTDIPGANLPAFAELVERVQKAKITSLGFTD
FT                   KNGFPYSSNPDYQLVRELVQKAIDPPTKKSKPKPAVTTPTEATIPTPSTTVTEPADVDE
FT                   CA"
FT   gene            complement(332809..334374)
FT                   /locus_tag="Intca_0308"
FT   CDS_pept        complement(332809..334374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0308"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="COGs: COG1316 Transcriptional regulator; InterPro
FT                   IPR004474; KEGG: kse:Ksed_26120 cell envelope-related
FT                   function transcriptional attenuator common domain protein;
FT                   PFAM: cell envelope-related transcriptional attenuator;
FT                   SPTR: Cell envelope-related transcriptional attenuator;
FT                   TIGRFAM: cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family; PFAM: Cell envelope-related
FT                   transcriptional attenuator domain; TIGRFAM: cell
FT                   envelope-related function transcriptional attenuator common
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46863"
FT                   /db_xref="GOA:E6S7G8"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G8"
FT                   /protein_id="ADU46863.1"
FT                   /translation="MSDQPDRPPATSGGRRMLRRELSTGFRRALGLTALGTLLPGAGLT
FT                   RTRSRAWGWFLLLTFLGSIATVVVLAATRGVTKVGLVIASNTRYLLILTLVLAVGGLVW
FT                   CASIIATAVQSRPRRLDRARTRSLAIFTTLMVAVVGGTAYKGAEFALIGRDTVGVIFKA
FT                   SGLKPGQGAKVVNEPDVDPWRDTPRVNILLLGSDAGVGREGTRTDSMIVASTDTKTGRT
FT                   VLISLPRNLQRVPLPETSKLRAWWPGGVYGIPNCPRQEKEASDACMLNAIWMEVDAFRA
FT                   QNPGAYPADDEAPGRSEIRDVIGEVLGLKIDHTVVVDLEGFRQLINAMGGVTINVKLGG
FT                   YDGKTPIPYGPLTANGTYAHAFDKPGPMKMNGYQALWYARSRAADDDYNRMSRQRCVVQ
FT                   AVVNQVSPTAMLGQYAEIARIARENIYTDIPAENLPAFVELVERIQKAGKYVSVGIDPT
FT                   HGINTGNPDYDKIRTIVQQAITPPAPKPRSTSTTGGQQTPTRTPAPGTTTTPTTDPADV
FT                   DPCA"
FT   gene            334547..334636
FT                   /locus_tag="Intca_R0008"
FT   tRNA            334547..334636
FT                   /locus_tag="Intca_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(334743..335240)
FT                   /locus_tag="Intca_0309"
FT   CDS_pept        complement(334743..335240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_7098 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46864"
FT                   /db_xref="GOA:E6S7G9"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G9"
FT                   /protein_id="ADU46864.1"
FT                   /translation="MSEHAPYDREETRGERLDRNFDEQLQEARIAQAGVQILFGFLLTL
FT                   PFQQRFETLTDFQRKIYLGTLLASAVAVVLFTAPVAVHRVLFRQGLKDFIVAYTSKLAS
FT                   VGLVALALSVVGGLVLVLDVLIAHTLAMWVGGAVAALTVVLWYLVPAARKRRVAPPEKP
FT                   ES"
FT   gene            complement(335380..337218)
FT                   /locus_tag="Intca_0310"
FT   CDS_pept        complement(335380..337218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0310"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="COGs: COG1274 Phosphoenolpyruvate carboxykinase
FT                   (GTP); InterPro IPR008209: IPR022272: IPR018091; KEGG:
FT                   gob:Gobs_4876 phosphoenolpyruvate carboxykinase (GTP);
FT                   PFAM: phosphoenolpyruvate carboxykinase (GTP); PRIAM:
FT                   Phosphoenolpyruvate carboxykinase (GTP); SPTR:
FT                   Phosphoenolpyruvate carboxykinase [GTP]; PFAM:
FT                   Phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46865"
FT                   /db_xref="GOA:E6S7H0"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H0"
FT                   /protein_id="ADU46865.1"
FT                   /translation="MKGLAKLTTTPKTEQTTHAGLQAWVDEVAELTQPRDIRWITGTPE
FT                   EWTELTDQLVEAGTLVRLNEEKKPNSFWCASDPSDVARVEDRTFICSVEERDAGPTNNW
FT                   MAPDEMKAIMTDLYRGSMQGRTMYVIPFVMGHLDAKVPMFGVEITDSAYVAVSMLVMAR
FT                   CGEKVLRKIEETNASFVPALHSVGAPLAEGEQDVTWPCSDTKYIVHFPEERTIWSYGSG
FT                   YGGNALLGKKCYSLRIASAMARDEGWMAEHMLILKLTNPQGKVHYIAAAFPSACGKTNL
FT                   AMIDPTIPGWKAEMVGDDIAWMRFGEDGRLYAVNPEAGLFGVAPGTGESTNPNAMATVN
FT                   QGNSVFTNVALTDDGDIWWEGMTDEKPAHLTSWLGEDWTPESDKPAAHPNSRFCTPIAQ
FT                   CPIAAPEYDNPDGVPISAILFGGRRKTTIPLVYESRDWTHGTFVGATLSSETTAAATGA
FT                   VGVVRRDPMAMLPFLGYNATDYFGHWLQIGKQADASKLPRIFGVNWFRRDEDGSFLWPG
FT                   YGENSRVLKWIVDRLEGDAEAVETPIGLVPAPGALDIDGLDVTEEHLAKAGAVRPEEWA
FT                   EELPLIEEWFTKFGDELPAELWAEFDGLKARINAAQ"
FT   gene            337709..337781
FT                   /locus_tag="Intca_R0009"
FT   tRNA            337709..337781
FT                   /locus_tag="Intca_R0009"
FT                   /product="tRNA-Arg"
FT   gene            338005..338205
FT                   /locus_tag="Intca_0311"
FT   CDS_pept        338005..338205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0311"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR010093; KEGG: sti:Sthe_2833 phage
FT                   transcriptional regulator, AlpA; SPTR: Phage
FT                   transcriptional regulator, AlpA; TIGRFAM: DNA binding
FT                   domain protein, excisionase family; TIGRFAM: DNA binding
FT                   domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46866"
FT                   /db_xref="GOA:E6S7H1"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H1"
FT                   /protein_id="ADU46866.1"
FT                   /translation="METTAQAPTLLLNLNEVATHLRCTRRSVERQIARRRLRVVRIGRA
FT                   VRVEREELDRFIASSRDCDGR"
FT   gene            338195..339394
FT                   /locus_tag="Intca_0312"
FT   CDS_pept        338195..339394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0312"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: nml:Namu_0644 integrase family
FT                   protein; PFAM: integrase family protein; SPTR: Integrase;
FT                   PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46867"
FT                   /db_xref="GOA:E6S7H2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H2"
FT                   /protein_id="ADU46867.1"
FT                   /translation="MAGRRQKDSETHTTKYRGKDGRWHARVTVGRRIDGQLDRRHLQRK
FT                   TKRELDEAVRALERDRDAGKRTWLQGEQTLGGWLEHWITAILPLSVRWKTLSTYQSLMK
FT                   VHVIPKMGAARLADVRPEALELLYGQLLNEGRSAHVVHAVHRVLRSALGEAVRRHHLSQ
FT                   NPATVARPPRVATVEIDPLTSDECRSLLEAARGTPNAARWSVALALGLRQGEALGLSWD
FT                   DVDLDAGVIHVRRAVQRRTWQHGCGSKPGGQPACGHGRGGYCPQRRAGGLMLVELKTRA
FT                   SRRLIVLPGPLLSELQAHRSDQLRRQEERRGLWDGTHNLVFATDVGGLIDPARDFKDWK
FT                   NLLKAGGVRTVRLHDARHTAATLLLVQGVDLRTVMSIMGWTEMATAQRYVHAVSCLLCT
FT                   "
FT   gene            339456..340529
FT                   /locus_tag="Intca_0313"
FT   CDS_pept        339456..340529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0313"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: gbr:Gbro_4728
FT                   integrase family protein; PFAM: integrase family protein;
FT                   integrase domain protein SAM domain protein; SPTR: Putative
FT                   transposase; PFAM: Phage integrase, N-terminal SAM-like
FT                   domain; Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46868"
FT                   /db_xref="GOA:E6S7H3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H3"
FT                   /protein_id="ADU46868.1"
FT                   /translation="MSVLYPCLIRSRRPLGEVVVRVGVPLVDEYLEFLQGRCRPNTVVA
FT                   AAYDLRVFFGVVGKEPREVVPADVLGFITAQRTGRLEPGPVQAVVADGEPAGVATSTVA
FT                   RRLSSISGFFGYLQARGDVVVNPVPRGLPTRRERQRPSQGVPLTRRVWRLSRILTPAEV
FT                   DALTGALRTHRDRAMVAAMVLGGLRRCEVLGLRMGDVRVAERRLFIAEGKGGHQRLVPV
FT                   SSRFFTELASYLEAERPRATGTDRVFVVLRGPNRGNPLSVRGIDEVLAGARRRAGLAHA
FT                   TCHELRHTCLTRLREAGMALEAVQAQAQAGHDSIESTRIYLHLADDWLASQYRKAAEVI
FT                   DAQVFAGHPDGSGGSRR"
FT   gene            340526..341868
FT                   /pseudo
FT                   /locus_tag="Intca_0314"
FT   gene            342187..343491
FT                   /locus_tag="Intca_0315"
FT   CDS_pept        342187..343491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0315"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1373 ATPase (AAA+ superfamily); KEGG:
FT                   fal:FRAAL3336 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46869"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H4"
FT                   /protein_id="ADU46869.1"
FT                   /translation="MILDSLVPRRVSELLAGLVAVEPVIALHGPRSVGKSTVLRRFAAD
FT                   VGGSVLDLDDIAVREAVVGNLASVAGGPAPVCVDEYQRVPDILDALKARLNREGSLPGT
FT                   AVITGSTRQDALPATAQALTGRLHSLTIWPLSQGEIVGIREDLLETLGADADGVVSQVP
FT                   SSKTVRRDYVERVCAGGLPLALRRSGAARARWFDDFVRASVERDALELSRIRERQAMTE
FT                   LLGLVAAQTGQLLNLSAAAEKLGVSRATVESHLRLLEDLFLVVRLPAWGKTLRSRVSVK
FT                   PKVHVVDSGLAARLLRLTPDKLAGLDPASLADFGHLLETFVVGEIRKQASWLDEPVTLG
FT                   HWRTSDGVEVDLVIEYDDGTVVAVEVKASERAPGSDFRGLAQLRDALGPRFAGGIILTT
FT                   GARSYTYSDRLHVMPIDRLWTPVTPEPRTALPHGD"
FT   sig_peptide     342187..342264
FT                   /locus_tag="Intca_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            343752..344192
FT                   /locus_tag="Intca_0316"
FT   CDS_pept        343752..344192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU34080 putative ABC transporter
FT                   (permease); SPTR: Putative uncharacterized protein yvfS"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46870"
FT                   /db_xref="GOA:E6S7H5"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H5"
FT                   /protein_id="ADU46870.1"
FT                   /translation="MVAAFFALLGATAGDDDTAFTWVVAGLFVIAAALRVLIWFRGLAA
FT                   RALISTEQYLVVMRRGRVERWMPWAAMTVIRVCPGDLLPEWHRGGGTWFTVTGEPVTAM
FT                   RPISPFAGELGEYLVRRRDRAHATATIEAAADAHGVRLIVSQ"
FT   sig_peptide     343752..343793
FT                   /locus_tag="Intca_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            344369..344728
FT                   /locus_tag="Intca_0317"
FT   CDS_pept        344369..344728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_4550 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46871"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H6"
FT                   /protein_id="ADU46871.1"
FT                   /translation="MLVLVGTLLIVTTAAYRYAYGTWWQAPERIPYCGRTYIAVTPHLS
FT                   LADIRQRERQTSLPGDQPYAVVPIGKAPPIVGAEMLAAVTPVAQREKLGVPCAMGLYVK
FT                   TGDDQYTSYGITGGP"
FT   sig_peptide     344369..344425
FT                   /locus_tag="Intca_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(344836..345084)
FT                   /locus_tag="Intca_0318"
FT   CDS_pept        complement(344836..345084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_2904 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46872"
FT                   /db_xref="GOA:E6S7H7"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H7"
FT                   /protein_id="ADU46872.1"
FT                   /translation="MEKAVWSSVLGVVVGVLLTAFDLWFPLVAGAVCVAVGITSRRARP
FT                   IAFGLGVGLCLGLFVYIALGLLQVQGSPSESGTGSAG"
FT   sig_peptide     complement(344992..345084)
FT                   /locus_tag="Intca_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(345391..346309)
FT                   /pseudo
FT                   /locus_tag="Intca_0319"
FT   gene            complement(346693..346878)
FT                   /locus_tag="Intca_0320"
FT   CDS_pept        complement(346693..346878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0320"
FT                   /product="protein of unknown function DUF1508"
FT                   /note="COGs: COG3422 conserved hypothetical protein;
FT                   InterPro IPR010879; KEGG: kfl:Kfla_0634 protein of unknown
FT                   function DUF1508; PFAM: protein of unknown function
FT                   DUF1508; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function (DUF1508)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46873"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H8"
FT                   /protein_id="ADU46873.1"
FT                   /translation="MAGKFELYKSASGEYRFRLKATNGQIIATGEGYKTKASALNGIES
FT                   VRKNAQTAQVDDQTAS"
FT   gene            complement(346972..347952)
FT                   /locus_tag="Intca_0321"
FT   CDS_pept        complement(346972..347952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3445 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46874"
FT                   /db_xref="GOA:E6S7H9"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H9"
FT                   /protein_id="ADU46874.1"
FT                   /translation="MRSDPARLPDPPQTRAPSVEGVAVILTAVAALMPTLLSAQGMIFV
FT                   GVDVLGLAVAVALSLAVFLELALVSSALLARAAVFRGRSARADLVSTWVFSAISGMFSA
FT                   AHELLGPAGEAGLRDWQPDARAALAAGVRVAAPLVAVWLWHRILTGDRHDRDTAPTRRE
FT                   AKRHRLMLAVATAGLDLQRVQHAQPNSRATLRAHRRLDRHHRALLKHIPATDKQLSGQL
FT                   SQWLSEVGRVEHLAGHFASRDVVPNANARERLVPGRDLPADSAAAVDDPAARLEVAVAL
FT                   VRRDQTVSGQDVADAFTQRGWKATPRTGQRWLAKARTFLEASASG"
FT   sig_peptide     complement(347836..347952)
FT                   /locus_tag="Intca_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            348317..348871
FT                   /locus_tag="Intca_0322"
FT   CDS_pept        348317..348871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3427 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46875"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I0"
FT                   /protein_id="ADU46875.1"
FT                   /translation="MTSNARTGVIGLAIVAVLATGGCTDQGLPPATTSSPSATGTTPIT
FT                   TSTTMTAQDPELAAAEATVEKLWKLVDALGADKQRSLDELNTVARDQTLEIWRELLTKR
FT                   RREAIRQTGSTSIVSTEASSARGKLTVDTCFDVSKTNLLDTDGKSVVSENRASRVRYTS
FT                   VVERGSNGNYYVVQDKAVETC"
FT   sig_peptide     348317..348427
FT                   /locus_tag="Intca_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            349135..350451
FT                   /locus_tag="Intca_0323"
FT   CDS_pept        349135..350451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0323"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COGs: COG3464 Transposase and inactivated
FT                   derivatives; InterPro IPR002560; KEGG: rha:RHA1_ro00013
FT                   transposase; PFAM: transposase IS204/IS1001/IS1096/IS1165
FT                   family protein; SPTR: Transposase; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46876"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I1"
FT                   /protein_id="ADU46876.1"
FT                   /translation="MRATTAFNKMLAIPGAHVTGVVFTPDGIVVDLGRRAKRLRCPCGW
FT                   STRAVYDRSRRSWRGLDLGTAKVFLRASIRRLMCRRCGRVRTEAVPWARPGARFTRDFE
FT                   DVVAWLAQRMDKSAVTRLLRCSWEAVANIVTRVVAEQLDETRLRDLYRIGVDEVSYRKG
FT                   HRYLTVVADHDRDGAVVWVGEGKSAATLGAFYEQLGEDGCAQVQAVSMDLGAAFKKATD
FT                   AHAPTARQCVDPFHLIALANEAINKARRWAWNIERDKARHAAAQAGPKRRGRPPAGSPP
FT                   PTRDQARWVKHTRWALLKDPEHLNASQLQVLHELRRSHSVLYRCWQLKEGLRDLYRLAD
FT                   PADAPEHLNCWPGPAAAGSPPSSPCPRPSGPTATGSSPPCSSAYPTPSSRASTQDPPDQ
FT                   PSRLRTPQRRRPHRDDLPLLRRTDHPATHTKVRRTAFKA"
FT   gene            complement(351236..351670)
FT                   /locus_tag="Intca_0324"
FT   CDS_pept        complement(351236..351670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0324"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="KEGG: mgi:Mflv_0689 transposase IS116/IS110/IS902
FT                   family protein; SPTR: Putative IS110 family transposase;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46877"
FT                   /db_xref="GOA:E6S7I2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I2"
FT                   /protein_id="ADU46877.1"
FT                   /translation="MEAYDGERVLEMVFIGVDPHKLSATIEVVDDRVLATGRFGTDRAG
FT                   YAAMRRHVAAYRERVWAVEGSNGAGRPLAQRLLADGEHVVDVRASLSRRARALDTGHNR
FT                   KTDAHDAHAVAVVAVRTTGLRVLAYDVELEALRMLVARSE"
FT   gene            352205..353956
FT                   /locus_tag="Intca_0325"
FT   CDS_pept        352205..353956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0325"
FT                   /product="Domain of unknown function DUF1994"
FT                   /note="COGs: COG2247 Putative cell wall-binding domain;
FT                   InterPro IPR018532: IPR007253; KEGG: sna:Snas_5967
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1994; cell wall binding repeat 2-containing protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: Putative cell
FT                   wall binding repeat 2; Domain of unknown function
FT                   (DUF1994)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46878"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I3"
FT                   /protein_id="ADU46878.1"
FT                   /translation="MHPWSRLTSFLAAGVVSFAAAVAAAPPVQAAPVTAASLPAMLSVQ
FT                   AEDGAHDYSRDYFPLWIDADRDGCNTRYEVLIAESTTQVTVGAGCSLSGGAWLSPYDAA
FT                   TWTDPADVDIDHMVALAEAWRSGAWAWTTDQRTQYANDLDVDYALVAVTDNVNQAKGDQ
FT                   DPAEWLPPYIPFQCQYVIDWALVKYRWSLSIDPAEEAAVVAMLSGACGDTIVTLPTQQV
FT                   STTTPAGGAVTGFPDGITRLAGATRYETAIQVSQRYAPGVPAVYVATGTNFPDALSAAA
FT                   AAAQVGGPLLLTSPTALPSAVKTEITRLNPARIYLLGGTAAVSSAVATTLATIAPVTRY
FT                   DGADRYATGLNIVNSTFASAATAMIATGRSFPDALAATGAAGKVDAPVILVDGTRSTVT
FT                   SDTLSALTRLGVRHVTVAGGTAVVSTGIVTQLQSLGLTVTRYGGSDRYATAALINNAYF
FT                   PTGSTDTMFLATGTNFPDALAGAALAGRLGAPQYVTAAACAPAPIHDSVAALAPGKTAV
FT                   LGGTAVVSDIAAMNWECPPGKLFPDPVTPGAFCASTYSGWYGYTTTGTLMRCTTTATDS
FT                   RLRWRAA"
FT   sig_peptide     352205..352294
FT                   /locus_tag="Intca_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            354072..354305
FT                   /locus_tag="Intca_0326"
FT   CDS_pept        354072..354305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oaa:100084570 similar to Astacin-like
FT                   metallo-endopeptidase (M12 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46879"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I4"
FT                   /protein_id="ADU46879.1"
FT                   /translation="MRERRPLPIPTPYAAELAPSDTGVRSEVSLTHTPLRAGTPRGLTR
FT                   FAACLPRIQNQFARKPGCEASHRSSFVSSIRG"
FT   gene            354347..355909
FT                   /locus_tag="Intca_0327"
FT   CDS_pept        354347..355909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0327"
FT                   /product="Pyrrolo-quinoline quinone repeat-containing
FT                   protein"
FT                   /note="COGs: COG4993 Glucose dehydrogenase; InterPro
FT                   IPR019551: IPR002372: IPR018391; KEGG: scl:sce5403 putative
FT                   polyvinylalcohol dehydrogenase; PFAM: Pyrrolo-quinoline
FT                   quinone repeat-containing protein; PQQ-dependent
FT                   enzyme-like; SMART: Pyrrolo-quinoline quinone
FT                   beta-propeller repeat; SPTR: Putative polyvinylalcohol
FT                   dehydrogenase; PFAM: Pyrrolo-quinoline quinone coenzyme
FT                   N-terminus; PQQ enzyme repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46880"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I5"
FT                   /protein_id="ADU46880.1"
FT                   /translation="MVRIMRRARLALVAGVSGALLMVGQAAAAPGGNGWNSAGGDRSNT
FT                   RNAASETKISPSTVGDLTPKWVLTAGGDVSATPAVDGTRVYVPDWAGNLYAVDRMTGEV
FT                   AWQASIPDITGVPGNKARATPAFTDTTLVVGDQGPFGGGGRVIALDKATGAARWVTQVD
FT                   SNPGAIITQSATIFDGVVYVGVASQEEAYSALVPGYDCCTFRGSLVALDLATGSILWKT
FT                   YMTPEDFPGVAVWGSSPAVDPKRGTVYIATGNNYDVPQDVLDCVAAAGTDPVAQRACLP
FT                   PEDLFDSIVALDMRTGAVKWATHAISYDAWTVSCIFGNPSNCPSPAGPDYDFGQAPALF
FT                   KVASGPAKGRELLGAGQKSGQYWALDPDTGAVVWETQAGPGGTAGGLQWGSAVDGRRIY
FT                   TANANSNLVEFPDGSGDTSGVWSALDPSTGAILWQTRPTHGGSTSGPATTANGVVFGCA
FT                   LDADGYMYALDAATGEILWSFESGGSCLSGAAISNGMVYWGSGYSNFGFGTANNKLYAF
FT                   GLN"
FT   sig_peptide     354347..354430
FT                   /locus_tag="Intca_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            355989..356345
FT                   /pseudo
FT                   /locus_tag="Intca_0328"
FT   gene            complement(356358..356603)
FT                   /locus_tag="Intca_0329"
FT   CDS_pept        complement(356358..356603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_1753 FG-GAP repeat-containing
FT                   protein; SPTR: Amyloid protein a variant 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I6"
FT                   /protein_id="ADU46881.1"
FT                   /translation="MKGKSGQAGSLQDVDGDGDLDLVVQIEDTDGTYSLGDATAYLTAK
FT                   TYSGENVKVPTRSESSPPPAEDTHVGARASRHTAGT"
FT   gene            complement(356600..357121)
FT                   /locus_tag="Intca_0330"
FT   CDS_pept        complement(356600..357121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0330"
FT                   /product="C-type lectin domain protein"
FT                   /note="InterPro IPR001304; KEGG: plt:Plut_0367 VCBS; PFAM:
FT                   C-type lectin domain protein; SMART: C-type lectin domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Lectin C-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46882"
FT                   /db_xref="GOA:E6S7I7"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I7"
FT                   /protein_id="ADU46882.1"
FT                   /translation="MTWHQARSAAAERTQGGPLCAGHLATITTADEQAFLFSTFGEGLH
FT                   TTWLGGYQTDGATEPAGGWTWITGETWGYTNWLLGEPNNSGGEDALAFLGTNGKWNDAP
FT                   ELYNYGASGGYVVEYEGRQVAMTSSPEATTTASTTTATVSSRWPSSPRPRSTRPRSTPP
FT                   RSLSMAPASK"
FT   gene            357326..357616
FT                   /pseudo
FT                   /locus_tag="Intca_0331"
FT   gene            357682..358581
FT                   /locus_tag="Intca_0332"
FT   CDS_pept        357682..358581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0332"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="COGs: COG3386 Gluconolactonase; InterPro IPR013658:
FT                   IPR005511; KEGG: rer:RER_51080 lactone hydrolase; PFAM:
FT                   SMP-30/Gluconolaconase/LRE-like region-containing protein;
FT                   SPTR: SMP-30/Gluconolaconase/LRE domain protein; PFAM:
FT                   SMP-30/Gluconolaconase/LRE-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46883"
FT                   /db_xref="GOA:E6S7I8"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I8"
FT                   /protein_id="ADU46883.1"
FT                   /translation="MTERAVHSVISGMSYTECPRWHEGRLWFADFYTDAIYSVTEAGED
FT                   LRTEVEVPAQPSGLGWLPDGRLVFVSMKDRKVMRRESDGSVVVHADVTDAVTGHPNDMV
FT                   VDGEGRCWLGNFGFDLMGGADVETASLLRIDPDGSVTEVAHDLWFPNGSVVTGDGGTLI
FT                   VDETFGNRISAFTIQSDGRLGERRDWARFGDLPTSRVVAEAVPQAVLAPDGCCLDAEGC
FT                   LWVADAVGGRVCRVAEGGEILEEIMPGSGVFACMLGGSDGRTLFLSCAPDFDEHARSAA
FT                   REAEIRAVRVDVPHAGLP"
FT   gene            358922..359554
FT                   /locus_tag="Intca_0333"
FT   CDS_pept        358922..359554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0333"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="InterPro IPR002934; KEGG: xce:Xcel_2886 DNA
FT                   polymerase beta domain protein region; PFAM: DNA polymerase
FT                   beta domain protein region; SPTR: DNA polymerase beta
FT                   domain protein region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46884"
FT                   /db_xref="GOA:E6S7I9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I9"
FT                   /protein_id="ADU46884.1"
FT                   /translation="MDLSQPLSTVAPTLDADALTVLARTDTPLTGRGIASLVRRGSRPG
FT                   IQAVLNRLVEHGLVTAQPAGSATLYRLNREHLLAEPLLAMVTANATLTRRIRDEIGSWN
FT                   HPAVAAALFGSYARGQAHAGSDIDLFLVRPDGTDEGAPGWRAQVDSLEVRVRAWTGNLL
FT                   EVLEVDEREVAAMGARKDRLVEELLNDALQLVGPEPRHLFRSRRSAR"
FT   gene            359551..359928
FT                   /locus_tag="Intca_0334"
FT   CDS_pept        359551..359928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0334"
FT                   /product="HEPN domain protein"
FT                   /note="InterPro IPR007842; KEGG: nca:Noca_3210 hypothetical
FT                   protein; PFAM: HEPN domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46885"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J0"
FT                   /protein_id="ADU46885.1"
FT                   /translation="MSALTQARDHLNKAREFLEAAEIDLDLEFFSAATSHAVIAGINSK
FT                   DAICLKLTGRTTKGDKHHEAVAELKPAGPEGADVAATMSRLLKLKTKAQYLAPAIGRKD
FT                   ASKAVEWATRMVEQAIAEVSR"
FT   gene            complement(360850..361059)
FT                   /locus_tag="Intca_0335"
FT   CDS_pept        complement(360850..361059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0335"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="KEGG: kfl:Kfla_4023 putative RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; SPTR: Putative RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46886"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J1"
FT                   /protein_id="ADU46886.1"
FT                   /translation="MRKRPGARLSHLATSSTEDFLVADQDYAVLAVLGDAVDTAARRWP
FT                   AASTPDNPSAGLLTTSRRRSLRLG"
FT   gene            complement(361065..362834)
FT                   /locus_tag="Intca_0336"
FT   CDS_pept        complement(361065..362834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0336"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG3284 Transcriptional activator of
FT                   acetoin/glycerol metabolism; InterPro IPR002078: IPR003018:
FT                   IPR002197; KEGG: sma:SAV_1392 transcriptional regulator;
FT                   PFAM: sigma-54 factor interaction domain-containing
FT                   protein; GAF domain protein; helix-turn-helix Fis-type;
FT                   SPTR: Putative transcriptional regulator; PFAM: Bacterial
FT                   regulatory protein, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46887"
FT                   /db_xref="GOA:E6S7J2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J2"
FT                   /protein_id="ADU46887.1"
FT                   /translation="MADSAMEVAREQYLAAQGRSSTVRPMVIASWQRSIGHQVNMTRLD
FT                   APFVEDPDLDTPLVKAASPILEALHEQLANEPVATMLTDKSGLVLERRVTHEGLTTRLN
FT                   HVSLAPGHVYAEEFVGTNGIGTALASARPTVISGPEHYVEELRFFHCAAVPILHPTRRV
FT                   ALGAFNLTATVASGSGSMALALAASTARQIERELALISSQREYVLFERYLETCRAIRHT
FT                   PVLAFNADVVMMNDRLRASITGGDQTALLSHAREIAQDGSLADGRTLILPSGLVVEIRR
FT                   SPVGNDEAQEAGEVLQVRLVGRPRSSVRAHPPRRISGLVGSDPAWVKSVAEAEAAYRAR
FT                   SWICIFGEAGAGKVHLIGAIHRAHGGTPPLVLDPPVEESPETECAWVASLALSVTDPEN
FT                   VVIVRNAHWMSARLRTLVVDQLSLRSPANSARIVLTAQASAVAPEDELVTLCGTHIDIP
FT                   PLRHRHDDVLALIRFFLRRYRPHEDLHLSPATEHALQRYPWPENVRQLEQTVRLLSRRH
FT                   TKSTIEPTDLPPEFRVQGRSKLTTLEEVERDAILKGLVEHDRNVLQTARDLGISRATIY
FT                   RKMRRYGIDTTRL"
FT   sig_peptide     complement(362748..362834)
FT                   /locus_tag="Intca_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            363033..364058
FT                   /locus_tag="Intca_0337"
FT   CDS_pept        363033..364058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0337"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR013154: IPR013149: IPR002328; KEGG:
FT                   sma:SAV_1393 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: Putative alcohol
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES-like
FT                   domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46888"
FT                   /db_xref="GOA:E6S7J3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J3"
FT                   /protein_id="ADU46888.1"
FT                   /translation="MKAVRLVGYEQQPQLMDVPDPTPSSPLDVVIRIGGAGVCRTDLHI
FT                   IEGQWEEKSGVALPYTIGHENAGWVEAVGSAVTNVKPGDPVILHPLATCGLCRACRAGD
FT                   DVHCVNSSFPGIDSDGGYAEYLRTTARSVVRLDDSLEPADVAALADAGLTAYHAVAKAA
FT                   RVLRPGDTAVAIGAGGLGHIGIQVFKALSPARLVVVDRSPEALELASELGADVTLRADG
FT                   TQVEAIQELTQGNGAEAILDFVGEGGAVEDGVQMLRRAGNYYVIGYGGEIRVPTIDVIS
FT                   TEINFIGNLVGSYNDLVELMVLAAEDRVRLHTQRYALSDFQKALDDLDAGLVRGRAILV
FT                   P"
FT   gene            364085..365692
FT                   /locus_tag="Intca_0338"
FT   CDS_pept        364085..365692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0338"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   sma:SAV_1394 ABC transporter solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Putative multiple sugar ABC transporter solute-binding
FT                   protein; PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46889"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J4"
FT                   /protein_id="ADU46889.1"
FT                   /translation="MKSRRTQAALGIVVGIAVTTAACTGGGSQTTQKPDKTAMFGSGSD
FT                   ISYAKYGSDYPSTTTKDVPGKCSYESISKRDYSDVTLKVIANAVPVMGEPAQLHAKQFH
FT                   DITGAKVDVVNVPFGELYQKILTPLQAGQAAYDVMFYPSLWIGDMAPYLAPVPQDYLQT
FT                   SGMKDVSKAFMDVATWNGTVVQYPVDGDRHYLKVRTDLLEDPKNQADYKAATGQTLEIP
FT                   KTWEEYQRVATFLTGRDFPGGRKGYGSAEVTKRDDLMFSAFISRAAAYAKNADVKGGFF
FT                   FDVETMKPLINTPGFVKALDMFKAAKSTWPPGGANFGLGDEILSFGGGQAAMSYSWDDA
FT                   FIQAQQENSSIRNKVAAAQLPGSAEVWNRKTNSWDKPSTPNQAPYFTWGWTSAVAKSSK
FT                   NQQAAFDFLCFFSNEANTSLDLTIGRFGVNPYRNSHFDAAFWEKQGWSTATAETYVKTF
FT                   ADMEKNTNRVFDLRVPGVNQYMSSLAAGVASALAGQKSSQQALDDVAKEWTDITTQVGK
FT                   DKVQAAYRNVVKLEDNVG"
FT   sig_peptide     364085..364165
FT                   /locus_tag="Intca_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            365781..366656
FT                   /locus_tag="Intca_0339"
FT   CDS_pept        365781..366656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0339"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG: sma:SAV_1395
FT                   ABC transporter permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative multiple sugar ABC transporter
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46890"
FT                   /db_xref="GOA:E6S7J5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J5"
FT                   /protein_id="ADU46890.1"
FT                   /translation="MTSVRRYKAVFLLPGLLTLFFIIIFPLLFTIRVSFSSWNVSSPEL
FT                   DFIGGANFARMLQDERFRASILHLFVLAGGSVALQYLLGFALALAVWRDVRGRRFLRVL
FT                   FLVPMMTTPVVMAAIWQMIFHESLGPVNDVLTRVGLDPVGWLTSSTPSYVSLMTVEVWQ
FT                   WTPFMFLLLLAGLLSLPHEPFMAAAIDGAGPVRTFFKVTLPLMAPVSVTALIIRLIEAS
FT                   KMSDSIYVLTSGGPGSATETPGYYLYIRGLKEQQTGYSGALSITYLVLMIVTLTIVSAL
FT                   LVRAFRTKVD"
FT   sig_peptide     365781..365888
FT                   /locus_tag="Intca_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            366658..367500
FT                   /locus_tag="Intca_0340"
FT   CDS_pept        366658..367500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0340"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: sma:SAV_1396
FT                   ABC transporter permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative multiple sugar ABC transporter
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46891"
FT                   /db_xref="GOA:E6S7J6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J6"
FT                   /protein_id="ADU46891.1"
FT                   /translation="MPRLYPIFKYAFITVWACFVAGPFLWALTTSFKDDNGVQHGATYL
FT                   PWVQYRPTTLAWRNIFGGAGGVDVIKPFLNSLIVTVSASVVALILGSLAAYGLSRYTYR
FT                   FGPMKNPDIVFFFVSQRIMPPIVLVIPFFFLLQFGGLLDSIPGLVIVTVSLLLPISVWV
FT                   MVDFFDNIPKEIDEMAMLEGCTPLGAFTRAILPNSLPGLTVAAMFCAVFGWNDFFFAFR
FT                   LTFTEVQTLPQAVVALNSSIPPWWTLSAASLFGVAPLVLLAIMVERYLSKGNLSGAVR"
FT   sig_peptide     366658..366756
FT                   /locus_tag="Intca_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            367497..368576
FT                   /locus_tag="Intca_0341"
FT   CDS_pept        367497..368576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0341"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR013611:
FT                   IPR003593: IPR017871; KEGG: sma:SAV_1397 sugar ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; Transport-associated OB domain-containing protein;
FT                   SMART: AAA ATPase; SPTR: Putative multiple sugar ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46892"
FT                   /db_xref="GOA:E6S7J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J7"
FT                   /protein_id="ADU46892.1"
FT                   /translation="MSLTLTGVSLAVDGAAHLDSIDLDFQAGRIYTIIGRTLAGKTTLL
FT                   RALAGLSPVDTGRIELDGADMQDVPPWKRDTAMVYQQFINYPHLSVMDNVCFPLKRAGL
FT                   DAAEVRQRAEENLEKVGLTPFAHRRPRQLSGGQQQRVALARALARRSRILLLDEPLVNL
FT                   DYKLREQLREDLRGLFSGVGDAIVVYTTTEPTEALMLGDEVVVMHEGRVLQVAAPAEVF
FT                   ERPLNTDVARIINDPPMNLFDGVVAGDWISFGGLAEIHCPAHLAGLPDGPYRFGLRATD
FT                   IRPSSRSPVSGEVTFVEISGSETFVHLSVGDAALVMRAEGIHDLAIGDPERVELRAERL
FT                   FVFGPDGRLRVAPETNERF"
FT   sig_peptide     367497..367529
FT                   /locus_tag="Intca_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            368581..369663
FT                   /locus_tag="Intca_0342"
FT   CDS_pept        368581..369663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0342"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR013611:
FT                   IPR003593; KEGG: sma:SAV_1398 sugar ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase; SPTR: Putative multiple sugar ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46893"
FT                   /db_xref="GOA:E6S7J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J8"
FT                   /protein_id="ADU46893.1"
FT                   /translation="MARIDLTDVGHAYSRGDGSEDWALKPLSLSFDSGKTYALVGPSGC
FT                   GKTTMLNIISGLIRPSQGRVSFDGVDVTARPTRHRNIAQVFQFPVIYRSMSVRDNLAFP
FT                   LECRGWEQPRIDTRVGSVAEALGLSHRLDRAARHLSADEKQLISLGRGLVRDDVAAVLM
FT                   DEPLTVIDPQLKFSLRRKIRELSEQFQPTVIYVTHDQYEAMSFAQEVLVMRHGRIMQQG
FT                   TPEQLFESPRSTYVGYFVGSPAMNYLDAAWDGSAATVAGVPVTPAWAPPVRAGARFQLG
FT                   IRPEYVRLVQRSGPNTLPATLHSVRDHGPTRVCHVDIGGQSATVKVPREHPIPSEPLLY
FT                   LEMPRAKVLPYVEGELAVVD"
FT   gene            complement(370079..370543)
FT                   /pseudo
FT                   /locus_tag="Intca_0343"
FT   gene            370542..370700
FT                   /pseudo
FT                   /locus_tag="Intca_0344"
FT   gene            complement(370918..371550)
FT                   /locus_tag="Intca_0345"
FT   CDS_pept        complement(370918..371550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0345"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: rop:ROP_pROB01-03010 putative methyltransferase;
FT                   PFAM: Methyltransferase type 11; SPTR: Methyltransferase
FT                   type 11; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46894"
FT                   /db_xref="GOA:E6S7J9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J9"
FT                   /protein_id="ADU46894.1"
FT                   /translation="MKKDAYGRLARLQDAALEPLNAPLREIAVRVSGVGGGSRVLDVGC
FT                   GTGTQLERYLAAGCDVSGIDTSPAMLARARERLGSAADLRLADAQRIPFEDAMFDVVTA
FT                   TLVLHELRPLECEAVGKEMARVLTDSGRLVVIDFSPGPLRGLKGWGLRGFSVLAELTAR
FT                   HLQRSRTFLAAGGVPRLAELLGMELQHTKFVGGGNMAVYVLTRRGTG"
FT   gene            complement(371622..373232)
FT                   /locus_tag="Intca_0346"
FT   CDS_pept        complement(371622..373232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_3436 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46895"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K0"
FT                   /protein_id="ADU46895.1"
FT                   /translation="MGATVTVNDLLDGHVALDVQCLDRIYLNGYVPNLQVPGQVVSFMT
FT                   THLGLPLPSPAIMEKIGTAFRRSVRKFADTRGVPVVKFAKGVRKVEVMRRYLNAQAKTG
FT                   ASGVAAIGVAQEYQNVYASSERQGRNGMPWFSFHKADRRVTCFYFYLWDADFGPGFIKV
FT                   CAYFPYPVKVWLNGHEWAKRQATLAGIGFTELSNGFATCDDPAALQAICDRLGPEVIGA
FT                   FFDRWMSVLPLPLTDHDRSAGYWWELSMRQVEVSRTIVFDAPRQARAFFEALVVDNLDI
FT                   GRPESVELIFTGPPKRGRPFKIGCQPKTKVVTRDTDVTVNAFFKHSRLKQYLKDGRALR
FT                   IETVINCPDDLQCHRRLIHLHELQSKARDVNARLLDTERVGQGCVLASPAFERVAQSTL
FT                   TEDGRRSPALRFGDPRVMALLGALCVGLNALGFTNRSLRAQVSHLLGVPYTVNQMSYDL
FT                   ARLRSNGLIGRRPGANTYDLTPDGQRVAIFYTKVHDRLLRPLIAANTRPAPLELRQALR
FT                   TIDRHVRGYIDTARLGTAA"
FT   gene            complement(373232..373393)
FT                   /locus_tag="Intca_0347"
FT   CDS_pept        complement(373232..373393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbz:LbrM25_V2.0520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46896"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K1"
FT                   /protein_id="ADU46896.1"
FT                   /translation="MNLHSTTGTEPERLTLPAADPTGVLLTHAPNEASPLTAEVRGWFV
FT                   VSGGITLG"
FT   gene            complement(373491..374969)
FT                   /locus_tag="Intca_0348"
FT   CDS_pept        complement(373491..374969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0348"
FT                   /product="transposase IS4 family protein"
FT                   /note="COGs: COG3666 Transposase and inactivated
FT                   derivatives; InterPro IPR002559; KEGG: cef:CE2290
FT                   hypothetical protein; PFAM: transposase IS4 family protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: Transposase
FT                   DDE domain; Transposase domain (DUF772)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46897"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K2"
FT                   /protein_id="ADU46897.1"
FT                   /translation="MPDDDDAQALFELSEQVTAPAPTGSVAGVRKTFRAFAPDQDLLLP
FT                   PSLDEWLPADHLARFIADLVDEHLDLSRIHASYTKAKGGPPYDPRLMVRILLYGYTTGV
FT                   RSSRQLEAACVDVVAFRWLAAGAGPDFRSIGRFRKRHLAALGHLFVQALALCQAAGMVK
FT                   LGRVALDGTKLRANASRRKAMSYARMSEKEKILAQEVSDLLAQAEETDQAEDAKFGKDR
FT                   RGDELPEELRRRESRLARIREAKAALEAEARERAEAAAREKAAARGEGAESSAQRVADA
FT                   VAAAVPKPKAQRNFTDPESRIMKTADGSFHQCFNAQAVVDDTHQVIVAAEVSDCAADVA
FT                   NLIPMTEQVTANTGAAPREMVADAGYCSADNLAQAAAVTAATGTEFFIATGRSKHDAPI
FT                   PTSPRGRIPTAASPRERMARKLTTKKGRAAYARRKVIVEPVFGQMATLQNGKQLLLRGL
FT                   DGARGEWLLLAACHNLRKLHRHVGTGGLAGLATT"
FT   gene            375110..376720
FT                   /locus_tag="Intca_0349"
FT   CDS_pept        375110..376720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_3436 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46898"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K0"
FT                   /protein_id="ADU46898.1"
FT                   /translation="MGATVTVNDLLDGHVALDVQCLDRIYLNGYVPNLQVPGQVVSFMT
FT                   THLGLPLPSPAIMEKIGTAFRRSVRKFADTRGVPVVKFAKGVRKVEVMRRYLNAQAKTG
FT                   ASGVAAIGVAQEYQNVYASSERQGRNGMPWFSFHKADRRVTCFYFYLWDADFGPGFIKV
FT                   CAYFPYPVKVWLNGHEWAKRQATLAGIGFTELSNGFATCDDPAALQAICDRLGPEVIGA
FT                   FFDRWMSVLPLPLTDHDRSAGYWWELSMRQVEVSRTIVFDAPRQARAFFEALVVDNLDI
FT                   GRPESVELIFTGPPKRGRPFKIGCQPKTKVVTRDTDVTVNAFFKHSRLKQYLKDGRALR
FT                   IETVINCPDDLQCHRRLIHLHELQSKARDVNARLLDTERVGQGCVLASPAFERVAQSTL
FT                   TEDGRRSPALRFGDPRVMALLGALCVGLNALGFTNRSLRAQVSHLLGVPYTVNQMSYDL
FT                   ARLRSNGLIGRRPGANTYDLTPDGQRVAIFYTKVHDRLLRPLIAANTRPAPLELRQALR
FT                   TIDRHVRGYIDTARLGTAA"
FT   gene            complement(377062..377325)
FT                   /locus_tag="Intca_0350"
FT   CDS_pept        complement(377062..377325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0350"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="COGs: COG2026 Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system; InterPro IPR007712:
FT                   IPR012753; KEGG: gob:Gobs_3715 addiction module toxin,
FT                   RelE/StbE family; PFAM: plasmid stabilization system; SPTR:
FT                   Addiction module toxin, RelE/StbE family; TIGRFAM:
FT                   addiction module toxin, RelE/StbE family; PFAM: Plasmid
FT                   stabilisation system protein; TIGRFAM: addiction module
FT                   toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46899"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K4"
FT                   /protein_id="ADU46899.1"
FT                   /translation="MTYRIDVAPAALRQLRKLDPAARRRVQAAIELLAEQPRPSAAKKL
FT                   TGGEGEWRVRTGDHRIIYEIHDQVLLLFVVAIGHRRDIYSRR"
FT   gene            complement(377322..377576)
FT                   /locus_tag="Intca_0351"
FT   CDS_pept        complement(377322..377576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0351"
FT                   /product="prevent-host-death family protein"
FT                   /note="InterPro IPR006442; KEGG: aau:AAur_0708
FT                   prevent-host-death protein; SPTR: Prevent-host-death
FT                   protein; TIGRFAM: prevent-host-death family protein; PFAM:
FT                   Phd_YefM; TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46900"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K5"
FT                   /protein_id="ADU46900.1"
FT                   /translation="MTVSDARARLADVVDAARVQHDPVYLTRRGQRVAAVIDADDLDRL
FT                   IAAAEDLADIEAARAARAEIADGEAAIPWEQVKADLGLA"
FT   gene            complement(377744..378133)
FT                   /locus_tag="Intca_0352"
FT   CDS_pept        complement(377744..378133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0352"
FT                   /product="death-on-curing family protein"
FT                   /note="COGs: COG3654 Prophage maintenance system killer
FT                   protein; InterPro IPR003812: IPR006440; KEGG: kra:Krad_2677
FT                   death-on-curing family protein; PFAM: filamentation induced
FT                   by cAMP protein Fic; SPTR: Death-on-curing family protein;
FT                   TIGRFAM: death-on-curing family protein; PFAM: Fic/DOC
FT                   family; TIGRFAM: death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46901"
FT                   /db_xref="GOA:E6S7K6"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K6"
FT                   /protein_id="ADU46901.1"
FT                   /translation="MSNEDLDYLSLEDLLEIATGVMDEVVVRDVGLLAAAAARPRVTVF
FT                   GDDAYPTFEDKAAALLHSLVRNHALVDGNKRLAWSATRVFCLLNGRDLTYDVDDAEGLM
FT                   VDAAAGQLDVPQIASWLGAHMEATS"
FT   gene            complement(378130..378327)
FT                   /locus_tag="Intca_0353"
FT   CDS_pept        complement(378130..378327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0353"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="KEGG: kra:Krad_2676 CopG domain protein DNA-binding
FT                   domain protein; SPTR: CopG domain protein DNA-binding
FT                   domain protein; manually curated; PFAM: Ribbon-helix-helix
FT                   protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46902"
FT                   /db_xref="GOA:E6S7K7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K7"
FT                   /protein_id="ADU46902.1"
FT                   /translation="MAMNLRLTDAESEALRAKAEQEGRSMQEVARSAIAQYVSDRPQRL
FT                   AAAIQRVRTEDHDLLERLSQ"
FT   gene            378326..379060
FT                   /locus_tag="Intca_0354"
FT   CDS_pept        378326..379060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0354"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR011663; KEGG: nda:Ndas_2625 transcriptional regulator,
FT                   GntR family; PFAM: UbiC transcription regulator-associated
FT                   domain-containing protein; SPTR: Transcriptional regulator,
FT                   GntR family; manually curated; PFAM: UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46903"
FT                   /db_xref="GOA:E6S7K8"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K8"
FT                   /protein_id="ADU46903.1"
FT                   /translation="MPTWYHRGTISAERPTGRALGAPQWAERRSLSGNQARYERLGKTD
FT                   VDPYLGGEASITTEVLEYAVLEAPDSVPVLAGRSALRVLRRRATNGEPYAVIRTWMPAE
FT                   FAAAIPSTSLENASVHERFATALQRPVTGGRRQVRAVAATPQVARQLGIAEGDPLLLLE
FT                   GQSVDREGRLLEVFQTWHRADLVTFDVAATPGPRPAVTEPHPAEASVGLDQRVDAIAAA
FT                   IKSVQQSLEAIRASLDEVRRDL"
FT   gene            379727..381358
FT                   /locus_tag="Intca_0355"
FT   CDS_pept        379727..381358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0355"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873:
FT                   IPR020904: IPR020845; KEGG: svi:Svir_34080 AMP-binding
FT                   domain protein; PFAM: AMP-dependent synthetase and ligase;
FT                   SPTR: Putative acyl-CoA synthetase; PFAM: AMP-binding
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46904"
FT                   /db_xref="GOA:E6S7K9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7K9"
FT                   /protein_id="ADU46904.1"
FT                   /translation="MTDVLDPTLSHTRGETDIPLLEQTIGDNLDATAARFPDREALVDV
FT                   SQGRRWTYAALLADVDRLARALLAIGVKTGDRVGIWAPNCSEWTLVQYATAKMGAILVN
FT                   INPAYRAHELHYVLGQAGISTLVAAESFKSSNYREMIDEVRHDVASLERVIYIGTDDWD
FT                   STLAEADRVSATELSGIQAALKPSDPINIQYTSGTTGFPKGATLSHRNILNNGFFVGEL
FT                   CRYTEADRVCIPVPFYHCFGMVMGNLACTTHGACMVIPAPGFDPTATLKAVQDEQCTSL
FT                   YGVPTMFIAEWSLPSFADYDISSVRTGIMAGSPCPAPLMKQLIASGIEEMTICYGMTET
FT                   SPVSTQNRTDDTFEQKTGTVGRVHPHLEIKIVDPGTGETVRRGQAGEFLTKGYSVMLGY
FT                   WEQPDKTAEAIEDGWMHTGDLGVMHDDGYVEITGRIKDMVIRGGENVYPREIEEFLYTH
FT                   PDILDAQVIGVPDSKYGEELCAWVRMREGAEPLTAEALREFCTGQLAHYKIPRYVEVVD
FT                   EFPMTVTGKIRKVEMRELTAKRLGLV"
FT   gene            381490..382533
FT                   /locus_tag="Intca_0356"
FT   CDS_pept        381490..382533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6800 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted membrane
FT                   protein (DUF2157)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46905"
FT                   /db_xref="GOA:E6S7L0"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L0"
FT                   /protein_id="ADU46905.1"
FT                   /translation="MAVGLEIVLTRGVAEGVITGEQAERLRHLGEDGTGPVPGEGAWQS
FT                   PTRRGPSLVTEALGYLGGIILLVGAILIGSQYWPDVDPLVRLGVVVLVAVAFVVAGGLV
FT                   PRGLDAVGTRLRSVLWALSVAAGTGAAAILFYDVVDLDDDHVPVLMFLLATVYALALWT
FT                   WRPTGLQLAVAAAGTAVTAGLLVMLLVESFDAAIAGVLVVGVVWLALGWAAVIRPPRAA
FT                   LVVGAGIVFLGSQMYVVGGSGPIWAVLASAGLVGVALYHRDLIILGIGSLGLLFALPNL
FT                   IYEWFPSVVAAAVSLLVVGGLLVVAALYTARRGRQHPGDGPAKGPANGAAGGPANGPAT
FT                   TPAGQER"
FT   sig_peptide     381490..381537
FT                   /locus_tag="Intca_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            382701..384638
FT                   /locus_tag="Intca_0357"
FT   CDS_pept        382701..384638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_6783 SNF2 superfamily protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46906"
FT                   /db_xref="GOA:E6S7L1"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L1"
FT                   /protein_id="ADU46906.1"
FT                   /translation="MPDNMQTILWIVLALVVVALVIWLLVSSSRRRKLEARQRADAAAL
FT                   RARAEEQRSRVQVVEDRASVVGAIADDARAEAEAKAAEAARLERQAEHERAAAEAARHE
FT                   RETLVREADRLDPDVRTDDEGYRVDRSGHRLEGDGQRAEERGAFGRPGGAPGSVAAGVA
FT                   LGSAGAAAAPTDRPGGPRPFTEEEDEPDLADAENPFAGRDDSESRAEHVADAAVQLAAD
FT                   ERAPETADPDWVNSPVEDIDDDELAASAAEETAAEDWINGPEQTSGGAPPYTSEGAPAV
FT                   EVDEAGAVAPGAAAGTGPASTTDAREDEAMTNEDADWVNGPVEDVDQEEIDASAAAETD
FT                   AADWINGPSDDEAVTSHGGSPQDAGSAAFEEQLAADPMTVDHVDVPALDDRDDVVVGGG
FT                   TPSDDPGDHRGQPWSTDLTTPGGAGSTSAATSGAAQEPAAPAGHGEEQEQASRAEVRWN
FT                   DEQEPDAAGEDGAEAHAARNPGPIEHSGDAPLLDDAAGTDEGDEATSESSESSESELEA
FT                   EAEAVAERSQPPFGRDERLDVEPAAEPAGSEVPPLDDSGLLDQDETPAAPPQERRISNF
FT                   DEVRDGGFGIGSAAPLDDRAQPLGHAVKGYRDSNTFLAPGASGYEDREPDVWFFNEEAA
FT                   RRAGFNPTSE"
FT   sig_peptide     382701..382808
FT                   /locus_tag="Intca_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(384810..386060)
FT                   /locus_tag="Intca_0358"
FT   CDS_pept        complement(384810..386060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0358"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1541 Coenzyme F390 synthetase; InterPro
FT                   IPR000873; KEGG: chl:Chy400_1182 coenzyme F390
FT                   synthetase-like protein; PFAM: AMP-dependent synthetase and
FT                   ligase; SPTR: Coenzyme F390 synthetase-like protein; PFAM:
FT                   AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46907"
FT                   /db_xref="GOA:E6S7L2"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L2"
FT                   /protein_id="ADU46907.1"
FT                   /translation="MSVDGSHTLTEAVEAYAAELAPAVGDVVRRAASVVPAFAERVLQA
FT                   GLTVDDLAAGDLTALPILTKDDVLAQQQADPPFGGLLAPGAGVRRIFQSPGPIYEPELD
FT                   ETDPWRWASALAAAGIGSGDVVLNCFGYHLSPAGAMFEEGCRAVGAVVVPGGIGNQDLQ
FT                   ARAIADLGVTAYVGLPSYLKALIDRFDELGLPVDRWRLRKALVTAEPLPDSLRALLQER
FT                   VPTVLMSYGTAEVGLIGYETAPGSGLLPGPGLHVEVCDLATGAPVSDGEGQVVVTLQRL
FT                   DYPLIRFGTGDLSAWMTGADGSARLAGVLGRVGEAVKVKGMFLHPRQAASVMSGVGGVA
FT                   AWRFVIDRVNHKDELACEVVLDDPVNAGESGGDAERVLEQVRSSVRSGLRFAANVRRVE
FT                   ALPEGDFGRIVDARTWD"
FT   gene            complement(386072..386926)
FT                   /locus_tag="Intca_0359"
FT   CDS_pept        complement(386072..386926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0359"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="COGs: COG0410 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro IPR003439:
FT                   IPR003593: IPR017871; KEGG: chl:Chy400_1183 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46908"
FT                   /db_xref="GOA:E6S7L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L3"
FT                   /protein_id="ADU46908.1"
FT                   /translation="MTSTPVSGTVAGAVAPGPATTDLLTINNVEVIYDDVILVLRGLSL
FT                   AVPEGKIVALLGSNGAGKSTTLKAISGLLPTEHGEVTDGSILFGGKNVTHLDAAERVRL
FT                   GLSLCMEGRHIFEHLTVEENLISGAYFRGRIDIQSDLAEVYALLPKLSDMRARVAGYLS
FT                   GGEQQMLAIGRALMAKPKLLMLDEPSLGLAPLLVKEIFAFIKRVNEEMGLTVLVIEQNA
FT                   RRALEVADHGYIMEQGRIVLEGTAQELQENPDVKEFYLGLGESGGRKSFRDVKHYKRRK
FT                   RWL"
FT   sig_peptide     complement(386864..386926)
FT                   /locus_tag="Intca_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(386923..388140)
FT                   /locus_tag="Intca_0360"
FT   CDS_pept        complement(386923..388140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0360"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR000709; KEGG: rca:Rcas_0542 ABC-type branched-chain
FT                   amino acid transport systems periplasmic component-like
FT                   protein; SPTR: ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46909"
FT                   /db_xref="GOA:E6S7L4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L4"
FT                   /protein_id="ADU46909.1"
FT                   /translation="MKFSTRIAAVATTAAAALALSACGGAATDTSPGDGGSGDTAPIKI
FT                   GIIADRTGATGDVGTPYNDGMLGYIDWINAKGGIKGHQIDADSNDYAYLVPRAEELYKK
FT                   YVNDGAVAIQGWGTGDSEALRTKVAADKLPFMSASYAEPLTDPKQSAYNFVVAPTYSDQ
FT                   MRVALNWIAKDAGGKAEVAVFHNDSPFGLAPVADGQKWVTEKGLNLGYKAYPMPKTPNQ
FT                   VGLLTQAKSQGAKYIVIQNVSSPAAQVAKDIKAQGLDMKIVCLNWCSDELFIKTAGADN
FT                   AEGHVMVQPFAPPTAEKPGHKVIDDYLKSKGSSLADKGLHYAQGWYTMDVMAKGIEKAL
FT                   DAGGELTGESIKKALESVSVDTGGVVGAGTVSFTADSHRGSTGTGIYEVKAGQMVELAA
FT                   NQTPES"
FT   sig_peptide     complement(388063..388140)
FT                   /locus_tag="Intca_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(388233..389291)
FT                   /locus_tag="Intca_0361"
FT   CDS_pept        complement(388233..389291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0361"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="COGs: COG4177 ABC-type branched-chain amino acid
FT                   transport system permease component; InterPro IPR001851;
FT                   KEGG: chl:Chy400_1185 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46910"
FT                   /db_xref="GOA:E6S7L5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L5"
FT                   /protein_id="ADU46910.1"
FT                   /translation="MATATGIHHRTYRSELRLRHTKAEYFRLALMLVLLLAAPYVLDKY
FT                   WLGIANVILISVIGAVGLNILVGFTGQISLGQGGFLAVGAFTSVIISDRAGVPVPISIA
FT                   IAVLMTAAVGAFFGLPALRLKGLYLAIATLASQEIIMFVVRRWEWLTEGKGYLEVERLH
FT                   VGGFQVERQMFEVQWYWILLALATLAVVVARNLFRTTLGRSFMAVRDQDIAAEAIGVNI
FT                   TRAKVTAFAVSSGFVGLAGALTAHYTETVTWERFTLDVSVLYLAMIIVGGLGSIAGAVY
FT                   GAIFMGLLPALLTELVDVLGSSLPSLSDQLPALRNAVFGIAIIVFLLVEPRGLDRIWTR
FT                   MKDYVRFWPFRY"
FT   gene            complement(389295..390167)
FT                   /locus_tag="Intca_0362"
FT   CDS_pept        complement(389295..390167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0362"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="COGs: COG0559 Branched-chain amino acid ABC-type
FT                   transport system permease components; InterPro IPR001851;
FT                   KEGG: chl:Chy400_1186 inner-membrane translocator; PFAM:
FT                   inner-membrane translocator; SPTR: Inner-membrane
FT                   translocator; PFAM: Branched-chain amino acid transport
FT                   system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46911"
FT                   /db_xref="GOA:E6S7L6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L6"
FT                   /protein_id="ADU46911.1"
FT                   /translation="MNTFISLTIYGLSDGALLALAALGFVLIYKATRVINFAQGEFLLV
FT                   GAYMFYTGFVVMRLPLIFAAVFGVLVAIVLGVVVERFILRPLIGEHAISVIMVTIGLSS
FT                   VLKALVQIFYGTSVREQPPILPTGSIQVAGATVPVNRLIVIGIAVIVLFAFSAFFQRSR
FT                   HGVAMRAVADDQQAALTMGISVKRIFSLAWVLAAVSALIAGVLLADLSAVEQGIAAFGL
FT                   MVFPVVILGGLDSVPGTVVGGLVIGMLKQYVSGYADPGLAEVIPYIVLVAILVVRPYGI
FT                   FGETRIERV"
FT   gene            complement(390164..392200)
FT                   /locus_tag="Intca_0363"
FT   CDS_pept        complement(390164..392200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0363"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); InterPro IPR000873: IPR020845; KEGG:
FT                   rrs:RoseRS_0623 AMP-dependent synthetase and ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; SPTR: AMP-dependent
FT                   synthetase and ligase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46912"
FT                   /db_xref="GOA:E6S7L7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L7"
FT                   /protein_id="ADU46912.1"
FT                   /translation="MSTEKTPYAADLAPSEPSGSRGASPAAYGTASGDTFPRLLAGLAA
FT                   QRPNDTALQEKRYGIWQPLTWAQYNKRVRDFAHGLAALGVERGQIVAVLGDNRPEWLIA
FT                   ELAAQSLGASVVGVYPTSIGEELHHILTHSRARVVIAEDQEQVDKLIRLRSEAADLPME
FT                   TVVYYDPHGLEAYTDEFLTDFTAVEAQGREWGDEHPGWLDEQIASGRPEDVAVICTTSG
FT                   TTSRPKLAELSHANLLAMAEHLTTIDPIGARDRYVSFLPFAWIGEQMLAVACGLSRGLT
FT                   LSFPEDSATQKTDLREIGPNVMFSPPRIWESMLSEVQVRIDEAGWLKRKVFGWGYAIGD
FT                   RVAEQRIHGKAKAIDPLYWLADQVALRPVRDQLGLARIDHAYTGGAPLGPDVFRFFHAI
FT                   GVNLKQIYGQTEICGIAVVHRDDDIAFASVGTPIPGTEIRITDEGEILLRSASVFRGYH
FT                   RNPEATAEAVDADGWLHTGDAGFLDEQGHLVVIDRAKDVLTTSDGTRFSSAFIENKLKF
FT                   SPYVEEAVTFPTDHGMTAMITIDPMTTGSWAEHERLSYTTYTDLAGKQEVRDLIAEEVL
FT                   RANEDLPESIRIKRFVLLHKQFDPDDDEITRTRKVRRNVIAERYADIINGLAGGSDDVT
FT                   IRSLVTYQDGSQVERNLVLKIVDMSTFRAPEGRGRRPVWSGRR"
FT   gene            complement(392200..393048)
FT                   /locus_tag="Intca_0364"
FT   CDS_pept        complement(392200..393048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0364"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="COGs: COG0411 ABC-type branched-chain amino acid
FT                   transport systems ATPase component; InterPro IPR003439:
FT                   IPR003593; KEGG: rrs:RoseRS_0622 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter; Branched-chain
FT                   amino acid ATP-binding cassette transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46913"
FT                   /db_xref="GOA:E6S7L8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L8"
FT                   /protein_id="ADU46913.1"
FT                   /translation="MTTGLTRAYQHSLNSSAVPSGQPALEVKDIGLRFGGVHALADVGF
FT                   TVTQGHIHAVIGPNGAGKSSLLNCVSGLYHPQHGSIVLHTGVEGTSHELTKLPPYKIAR
FT                   LGVARSFQNIELFSGLTVLENLMLGRHIHMSKSVLASLVWLGPARRQEIAHRALVEEVI
FT                   DLLSLQPFRHKSVGSLAYGIQKRVELGRALCLQPALLLLDEPMAGMNAEEKEDMARYIL
FT                   DVHELAGVTVILIEHDMAVVMDISNRVSVLDFGRLIADGTPDEVKANPKVVEAYLGAEE
FT                   H"
FT   gene            393210..393968
FT                   /locus_tag="Intca_0365"
FT   CDS_pept        393210..393968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0365"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471: IPR014757; KEGG: rop:ROP_71890 putative IclR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   IclR; SMART: regulatory protein IclR; SPTR: Putative IclR
FT                   family transcriptional regulator; PFAM: IclR
FT                   helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46914"
FT                   /db_xref="GOA:E6S7L9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7L9"
FT                   /protein_id="ADU46914.1"
FT                   /translation="MPPTEVGDRDSRGSLGTVRNAVTLLELLGEGPAYQQLTDLADRSG
FT                   MSVPTVHRLLRSLVLADLVEQDPRSSRYSLGPELVRLSHRYLARLPILGALAPYLAQLR
FT                   DLVRATVVVQTLVRSAVVTIDRVDGPDAGLYREPHSVRNPLTTATGRLLGARAGDDEWK
FT                   TMLELCPESDRARAEASREAWASAPWLLVEGNPLGPPGHVAVPLLGGQGTALATLAATV
FT                   APGTSREDVEAVAGHLARAGAAAVRTLGHA"
FT   gene            393961..395859
FT                   /locus_tag="Intca_0366"
FT   CDS_pept        393961..395859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0366"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR000873; KEGG: cai:Caci_4507
FT                   acetate/CoA ligase; PFAM: AMP-dependent synthetase and
FT                   ligase; SPTR: Acetate/CoA ligase; PFAM: Domain of unknown
FT                   function (DUF3448); AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46915"
FT                   /db_xref="GOA:E6S7M0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M0"
FT                   /protein_id="ADU46915.1"
FT                   /translation="MPDAVLRCDEAAWRRAAELVGWSTPFRSVCETRDGRPVWFPGGRL
FT                   NASVTCVDRHAAVDPDRVAISWEGEPGDRRVITYAELLDEVSSLAKGLRSIGVRSGDVV
FT                   ALHLGLVPEAAVAMLACARIGAVHAVLPAPLPAEALADRLESLGASVLFTQDGAWRHGT
FT                   VLPLKVRADEALTAVAGIEHTIVVRRTGMDVAWYEGDRWYHDLVAADRTRGRRSARGHR
FT                   GAEAAVDRSALDAPRGVGRVGGEAVDLPSDHPIYLISQAHRRGRPVVVTHGLANSLVTA
FT                   AALHEWGVGEGQRLWSAGDVSWLAVQTHGIYGPLARGVTTVLYEGTLDVPTHARAWEIM
FT                   RRHRVTTMMTTPSVLRTMRGWAPALADTSRVESLRRVVLYAEPSDPDLRSWAASDLGHH
FT                   PITVADGWGQVELGGICHLSRPLDPDLLPSVAPEIIDDTGRPVPEGEAGELVLTEAWAG
FT                   AMLPGAGDVAAATDHHWTTRPGLYTTGDRVRRTPEGSLEFLGRTDEVVSLSGQLVSISE
FT                   VRQTLLDHPFVQRADVIERRDTQGGRYLAAAVVLDPATAAAQDLSAVARDLNETVRDNL
FT                   GGVARPRMLVFVDRFGDELRGDERRRALAGLPLGDTPELKRITWAQVLAAADLSTP"
FT   gene            396078..397601
FT                   /locus_tag="Intca_0367"
FT   CDS_pept        396078..397601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0367"
FT                   /product="multicopper oxidase type 3"
FT                   /note="COGs: COG2132 Putative multicopper oxidase; InterPro
FT                   IPR017909: IPR011707: IPR011706: IPR002355; KEGG:
FT                   sli:Slin_6866 bilirubin oxidase; PFAM: multicopper oxidase
FT                   type 3; multicopper oxidase type 2; SPTR: Bilirubin
FT                   oxidase; PFAM: Multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46916"
FT                   /db_xref="GOA:E6S7M1"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M1"
FT                   /protein_id="ADU46916.1"
FT                   /translation="MGAKDGARPGVNRRLLLQGAVGAGGLIALGGLGAARSMVSAAAPP
FT                   VKGSLNKLFIPLPAHATTELTAAPGLTDLGGGSMGMALLYNGHLPGPTFVVPKGQLVSV
FT                   PFTNGLDAPTTVHWHGLIVPTAADGQPHDAIVPKSSYLYQFTVNQRAGMSWYHPHPHLA
FT                   TASQVAYGLAGGFIIRDDVEDALNLPSDPYEVPLVIRDANVDKAGNLSYNGKASGFTGS
FT                   IALVNGTRDAQLEVDRTWYRFRILIGSNSRLFNLTLSSGASFRLIGNDGGLLPTAVDVL
FT                   AMELSPGERVDVLVDCTGIGAGETVNLVDTNSGWTLLRLTGTGALNAPTSVGRIPADGD
FT                   ALCVDIPTLVAPADVTRRTFSFDGMTRINGLVYDMDRISFEVPENTVEEWVFRTNGNAP
FT                   HPVHIHGASFQVVSRTGGRRKLFEWEAGWKDTVLLHDRETVTVRIRFDGGHRGRYLMHC
FT                   HKLEHEDAGMMLNFMVVDPNAQLGASPAAYDTAVPGPHGMAAQGHVSHK"
FT   sig_peptide     396078..396200
FT                   /locus_tag="Intca_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            397612..399372
FT                   /locus_tag="Intca_0368"
FT   CDS_pept        397612..399372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0368"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR005148: IPR015945: IPR008909: IPR001278: IPR
FT                   001412; KEGG: tfu:Tfu_0269 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46917"
FT                   /db_xref="GOA:E6S7M2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M2"
FT                   /protein_id="ADU46917.1"
FT                   /translation="MVSPLVALTPKVQSAIAAALGDDFREADPVLRPSQFADVQVNAAL
FT                   ALGKKVGAAPRDVAARIVAALDLDGVAEKVEVSGPGFVNITFSDAWLASLLADVDQDDR
FT                   LGVPVEEPQNIPIDYSAPNVAKEMHVGHLRTTIVGDSLARTLEHLGHHVIRQNHIGDWG
FT                   TPFGMLIEHLLEVGEDSPEAELLVTDPNAFYQAARAKFDAAEQADPDGSAGDFDIRARA
FT                   RVVKLQAGDPETLEHWHRLVGMSKVYFNKVYQALGVTLGDENLAGESTYNHLLADVCGE
FT                   LEAKGLATVSDGALCVFLDGYTGREGKPVPLIIRKSDGGYGYPTTDLATIKYRVGDLGA
FT                   HRVLYVIGAPQALHLNMVWDTARLAGWLPDDVTPVHIQIGNVLGEDRKILKTRSGSSLR
FT                   LMALLDEAVAKARGLIDETRPDLSEEERATIARQVGIGAVKYADLSVAHNSEYVFDLDR
FT                   MVSLTGNTGPYLQYVVARVRSIFRQAGLDPLTQHAPITLGTPHERALGQQLLGFGDVVT
FT                   EVGAEYEPHRLCGYLFELAQAFSAFYENCPVLKAETPELRESRLTLSALVLRTMVTGLD
FT                   LLGLESPEQM"
FT   sig_peptide     397612..397692
FT                   /locus_tag="Intca_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            399501..400736
FT                   /locus_tag="Intca_0369"
FT   CDS_pept        399501..400736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0369"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="COGs: COG3710 DNA-binding winged-HTH domains;
FT                   InterPro IPR001867: IPR000073; KEGG: msm:MSMEG_3856
FT                   transcriptional regulator, CadC; PFAM: transcriptional
FT                   regulator domain-containing protein; alpha/beta hydrolase
FT                   fold; SPTR: Transcriptional regulator, CadC; PFAM:
FT                   Transcriptional regulatory protein, C terminal; alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46918"
FT                   /db_xref="GOA:E6S7M3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M3"
FT                   /protein_id="ADU46918.1"
FT                   /translation="MRFTFGDVVLDTDRFLLERGGEPVHVQPQVFDVLSHLVRHRERVV
FT                   PKTELLDAVWGNRFVTESTLTSRIKTARRVVGDDGALQRVIQTVHGRGYRWIAEVETEG
FT                   IGPGDGPDIPPDPPLRREQHIRFCEASDGVRIAYATVGEGPPLVRAAHWITHLDYEWHS
FT                   PVWRHWMEGLSRGRTFIRYDERGCGLSDHDPEDISFESFVRDLETVVDELGLERFPLMG
FT                   LSQGGPVAIEYAVRHPERVSRLILIGAFATGRLVRAGTAAELREAQMQGELMQLGWGRD
FT                   DPSFRLYFSSTFMPDAPPQMWSDFAALMRRTTSAENALRLNNVSIAMDVRESATKVSVP
FT                   TLILHGRHEVRIPFSQGRELAARIRGSRLVPLDTRNHLLQADEPAWRHLLREIDAFLAE
FT                   DESTSRPAEVHR"
FT   gene            400798..402078
FT                   /locus_tag="Intca_0370"
FT   CDS_pept        400798..402078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0370"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR006076: IPR003042; KEGG: sen:SACE_3335 monooxygenase,
FT                   FAD-binding; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   Monooxygenase, FAD-binding; PFAM: FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46919"
FT                   /db_xref="GOA:E6S7M4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M4"
FT                   /protein_id="ADU46919.1"
FT                   /translation="MNIRRAGAEAGKEPRTVTADVVVVGARVAGAATATHLARAGHDVL
FT                   MLDRGAFPSDTVSTHVIARSGMVLLSRLGVLQQLVEEGAPPLRRVEFASRLGSVQRDIK
FT                   DRYGTDFVLAPRRYALDDVLQRTALAAGARLHEGFSVDVVLTDATGRAIGVHGHDERGP
FT                   VEVRAAHVVGADGLSSRVARCLGAQPTVVRPAFGACQYAYFAGAWDAVEYHLGDGVFAG
FT                   VFPTHGGEACVWAITPEAVARRYRNGRRGGHGHPTRGGADAALAHLLRDRLPDLADRLG
FT                   PGSQQGPVRGMLRMPNHFRRAHGPGWSLVGDAGYHRDAITGHGISDALCQAELAAAAIE
FT                   ASLRCPSQEAEALADYEGHRDRMSLPIFETTVALAAFPDQSTFIELQRRLAVEIDELAE
FT                   ELYDRPLPVGAPNHPSPEMKEAATHVH"
FT   sig_peptide     400798..400890
FT                   /locus_tag="Intca_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            402068..402628
FT                   /locus_tag="Intca_0371"
FT   CDS_pept        402068..402628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0371"
FT                   /product="OsmC family protein"
FT                   /note="COGs: COG1765 redox protein regulator of disulfide
FT                   bond formation; InterPro IPR003718; KEGG: ade:Adeh_2254
FT                   OsmC-like protein; PFAM: OsmC family protein; SPTR:
FT                   OsmC-like protein; PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46920"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7M5"
FT                   /protein_id="ADU46920.1"
FT                   /translation="MSTETAHRNGVDTPTLFATLDAVRETPAAAHFQFRAHNEWIDGTH
FT                   SLSRIHDFFGVGEERTHERVFTFDADHPAVLVGRDRGPTPVELLLHAIAACITAGIANI
FT                   ASARKVTLTEVRSTVRGDIDLNGILGLQDVRNGFQHVTVTFQVKGDAPEAVLREIVEQS
FT                   RQRSAVYDVMANGVPVDLRVEVG"
FT   gene            complement(402730..402903)
FT                   /locus_tag="Intca_0372"
FT   CDS_pept        complement(402730..402903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_2347 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46921"
FT                   /db_xref="UniProtKB/TrEMBL:E6S817"
FT                   /protein_id="ADU46921.1"
FT                   /translation="MCRPANCRTCGKTTWAGCGQHVDQVMRHVPQAQRCGGHAKESSGS
FT                   SGGVFGRLFGRG"
FT   gene            403048..403422
FT                   /locus_tag="Intca_0373"
FT   CDS_pept        403048..403422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0373"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017936: IPR013766: IPR017937: IPR006662: IPR
FT                   005746; KEGG: nml:Namu_1297 thioredoxin; PFAM: Thioredoxin
FT                   domain-containing protein; SPTR: Thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46922"
FT                   /db_xref="GOA:E6S818"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6S818"
FT                   /protein_id="ADU46922.1"
FT                   /translation="MSTRNLTYADFESVVSAEGIVLVDFWASWCGPCRMFAPVYEAASE
FT                   THADITFGKVDTEAEQQLAAAARITSIPTLMAFRDGILVFSQPGALPAAALEQVVQAVR
FT                   DLDMEDVRRQVEAQSAKADA"
FT   gene            403500..403904
FT                   /locus_tag="Intca_0374"
FT   CDS_pept        403500..403904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0374"
FT                   /product="protein of unknown function DUF302"
FT                   /note="COGs: COG3439 conserved hypothetical protein;
FT                   InterPro IPR005180: IPR016796; KEGG: nml:Namu_0357 protein
FT                   of unknown function DUF302; PFAM: protein of unknown
FT                   function DUF302; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46923"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:E6S819"
FT                   /protein_id="ADU46923.1"
FT                   /translation="MDHAITVTTGLPFEAALQATRERLSEEGFGILSEIDLAGTLKAKI
FT                   GADLPPQVILGACRPPLAHAAIQAEPSIGVFLPCNVVVRVDEAGRTVVQAMNPDFMTQI
FT                   ASGAALADVAADAKARITRALDAVAAAPVS"
FT   gene            complement(404156..405307)
FT                   /locus_tag="Intca_0375"
FT   CDS_pept        complement(404156..405307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0375"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006092: IPR006091: IPR006090: IPR006089; KEGG:
FT                   nca:Noca_4293 acyl-CoA dehydrogenase domain-containing
FT                   protein; PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; SPTR: Acyl-CoA dehydrogenase; PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46924"
FT                   /db_xref="GOA:E6S820"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S820"
FT                   /protein_id="ADU46924.1"
FT                   /translation="MDLSLNEDQLGFKALAREFLDKEVVPHRAEWDRRESVDTAIIPRL
FT                   GEIGFFGLTIPEEYGGLGGDYITYCIGMEELGRADSSVRGIVSVSMGLVGKVILSHGTE
FT                   EQKHQYLPGIANGTLLGCFGLTEPDNGSDPGNLKTRARRDGSDYVINGQKIFITNGTWA
FT                   DVCLVFARTGGDGPKGVSAFLVPTDSPGFEAREIHGKLGLRGQATAEIFLTDVRVPESA
FT                   RLGAEGEGFKIAMHSLDKGRVSVGAGCTGIIQGCLEEVVKYTTERKQFGRPIASFQLIQ
FT                   EIIAEISVDVDAARLLTWRAADLIERGEPFGVEASKAKYFASEAAVRAANGALQAFGGY
FT                   GYVDEYPIQKYMRDARVMTLYEGTSQIQKLLIGRAETGISAFL"
FT   gene            complement(405353..406201)
FT                   /locus_tag="Intca_0376"
FT   CDS_pept        complement(405353..406201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0376"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR001753: IPR018376; KEGG:
FT                   nml:Namu_0873 enoyl-CoA hydratase/isomerase; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; SPTR: Enoyl-CoA
FT                   hydratase/isomerase; PFAM: Enoyl-CoA hydratase/isomerase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46925"
FT                   /db_xref="GOA:E6S821"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6S821"
FT                   /protein_id="ADU46925.1"
FT                   /translation="MESQNPATRVVGSTGGGATPGSAYASLETLLTEVTDGVLLVTFNR
FT                   PDVRNAINRQVQHDLRTVLDQARGDDDVHSVVLTGAGEKAFIAGADISQVAGYTKATAL
FT                   DSDLQRLFDLVEDFPKPTIAAVNGYALGGGCEVAMACDIRIASQTARFGLPETALSVLP
FT                   GAGGTQRLARLVGTGRAIELILTGRMVDADEALRIGLVTQVAPGEQLLDAARAVAATIA
FT                   ARGPLATRLAKLVIRAGMDADQRTGQVVERLAQAVLYESDDKREGTDAFLSKRPAAFHG
FT                   R"
FT   sig_peptide     complement(406127..406201)
FT                   /locus_tag="Intca_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(406204..407403)
FT                   /locus_tag="Intca_0377"
FT   CDS_pept        complement(406204..407403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0377"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase;
FT                   InterProIPR020616: IPR020617: IPR002155: IPR020615: IPR
FT                   020610: IPR001412: IPR020613: IPR012793; KEGG:
FT                   nml:Namu_0875 beta-ketoadipyl CoA thiolase; PFAM:
FT                   Thiolase-like; SPTR: Beta-ketoadipyl CoA thiolase; TIGRFAM:
FT                   beta-ketoadipyl CoA thiolase; acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase, C-terminal domain; Thiolase, N-terminal
FT                   domain; TIGRFAM: acetyl-CoA acetyltransferases;
FT                   beta-ketoadipyl CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46926"
FT                   /db_xref="GOA:E6S822"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6S822"
FT                   /protein_id="ADU46926.1"
FT                   /translation="MSTAYLVAGVRTPIGRYAGGLAPVRTDDLAAHAVSSLVDRFPAID
FT                   WGRVDDVILGCANQAGEDNRNVARMAGLLAGLPVQVPGLTVNRLCASGLDAVGAAARAI
FT                   RAGDADLVIAGGVESMTRAPLVMPKPDSAWSRRAEVHDTTIGWRFVNPRMDERYGTDSM
FT                   PGTAQIVADEYDISREDQDAFALRSQERAAKAIASGRLAREIVPVEIQGRKGAVSVVDT
FT                   DEHPRTTSLEALANLRPIFPGGSVTAGNASGVNDGAAALLVASEAAVSRYGLTPLARIT
FT                   TSLSVGVEPRVMGMGPDPAVKALLARTGLEVGDIDLFELNEAFASQSLAVLRALGLPDD
FT                   AEHVNPNGGAIALGHPLGMSGARLALTAAVELADRGVRRALATMCVGVGQGGALLLEAV
FT                   "
FT   gene            complement(407400..409025)
FT                   /locus_tag="Intca_0378"
FT   CDS_pept        complement(407400..409025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0378"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR000873:
FT                   IPR020845; KEGG: nca:Noca_4296 cyclohexanecarboxylate-CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-binding
FT                   enzyme; TIGRFAM: cyclohexanecarboxylate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46927"
FT                   /db_xref="GOA:E6S823"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S823"
FT                   /protein_id="ADU46927.1"
FT                   /translation="MTFETRLNDELIAKYTDGGFWVNRLITDYLDEWAERTPDKVAFID
FT                   SRRQVTYAELRAEVDRCALGLLELGIEPGDVVSFQLPNWIDWVVLHYACTRIGAISNPL
FT                   IPIYREREVAFMVGLAGSKLIVVPREFRGFDHVSLVESLKPDWPALDHILVVGGPEAPA
FT                   SWEVFMSTPWEERRDPAELAALRPDPNDVTLLIFTSGTTGEPKGVMHSHNTVVAANNPL
FT                   PERLGISTESVIHMASTLAHLTGFLYGARLPVQNGATGILQDIWDPKEFIGLVERHGIT
FT                   YTSAATPFLHDVLSVPDVNQHPMSTLSRFCCMGAPIPRALVRRAKELLPSMAVLGGWGQ
FT                   TENALVTLGIPGDPEEKVVETDGYPWPGMQIRTVDFDGVPVPAGTEGRLQVQGPFLFVG
FT                   YANRMKMTQDSFEGDWFDTGDLAIIDEDGYVKLSGRTKDVIIRGGENIPVAYVENALYE
FT                   DPRIESVAIVGLPDPRLQERAAAVVTLTPGSTLSFEEMQVLLKEKGIAKQYWPERLEVI
FT                   DALPRTASGKIQKFQLRDRFGETS"
FT   gene            complement(409036..409782)
FT                   /locus_tag="Intca_0379"
FT   CDS_pept        complement(409036..409782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0379"
FT                   /product="2-hydroxycyclohexane-1-carbonyl-CoA
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="COGs: COG4221 Short-chain alcohol dehydrogenase of
FT                   unknown specificity; InterPro IPR002198: IPR020904:
FT                   IPR002347; KEGG: nml:Namu_0877 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46928"
FT                   /db_xref="GOA:E6S824"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S824"
FT                   /protein_id="ADU46928.1"
FT                   /translation="MNRLEGKIAIVTGAARGLGRGIAERLAAEGAVVVVTDVNADGAQQ
FT                   TATELGGSALGLGCDVSDYGSVAAMVADVKDRFGRVDVLVNNAGWDKAAPFLDLDQDLW
FT                   PKIIGINLYGVLNTMKAVLPIMAEQGSGSVVNISSDAGRVGSSGEAVYSAAKGGVIAFT
FT                   KSTAREMARKQVRVNVICPGPSDTQLFAEFAGDNQGLRDALTKAIPLRRLGQPSDVAGA
FT                   VAYFASDDSVYVTGQTLSISGGLTMS"
FT   gene            complement(409833..410984)
FT                   /locus_tag="Intca_0380"
FT   CDS_pept        complement(409833..410984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0380"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006092: IPR006091: IPR006090; KEGG: nca:Noca_4298
FT                   acyl-CoA dehydrogenase domain-containing protein; PFAM:
FT                   acyl-CoA dehydrogenase domain-containing protein; SPTR:
FT                   Acyl-CoA dehydrogenase domain protein; PFAM: Acyl-CoA
FT                   dehydrogenase, C-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, N-terminal domain;
FT                   TIGRFAM: cyclohexanecarboxyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46929"
FT                   /db_xref="GOA:E6S825"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S825"
FT                   /protein_id="ADU46929.1"
FT                   /translation="MHYAFDEDQDTYAHEVRKFAVKTLAPHYQSDDKAAEFRRQLALDM
FT                   AAMGLTGLRIPEEYGGQEATAVIAGIAAEEVGREDFNAGYLIINTALISDIIVRNATDE
FT                   QKAAWLPGIASGETIPCICITEPGHGTDAASLELKATPSADATGWTLHGEKTSITLGMA
FT                   SDRAVVLARTGGPGARGVSAFWVDLHHPSVSRSAFDDLGSRAIGRASLHFDGTPVSRAD
FT                   LIGEEGAGFVSVMQGFDYSRAIIGLLCIGAAQASLDEAIQWARDREAFGAPIGTFQGVS
FT                   FPLAEAATYLKGARHVCFEALWRKDTDQEHSAEAAMAKFWAPKLAADVIHQCLLTIGHI
FT                   GYSSEHKVGQRLRDVIGLEIGDGTAQVSKLVISRNLLGRKYAP"
FT   gene            complement(411036..411833)
FT                   /locus_tag="Intca_0381"
FT   CDS_pept        complement(411036..411833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0381"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="COGs: COG0447 Dihydroxynaphthoic acid synthase;
FT                   InterPro IPR001753: IPR018376; KEGG: nca:Noca_4299
FT                   1,4-dihydroxy-2-naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; SPTR: 1,4-Dihydroxy-2-naphthoate
FT                   synthase; PFAM: Enoyl-CoA hydratase/isomerase family;
FT                   TIGRFAM: naphthoate synthase (dihydroxynaphthoic acid
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46930"
FT                   /db_xref="GOA:E6S826"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6S826"
FT                   /protein_id="ADU46930.1"
FT                   /translation="MSNYEDITYVVEDSAAIVTINRPDRYNAFRAKTVDELIKAFRSAW
FT                   ADHQVRSVILTGAGEKAFCTGGDVKQRAETGDYGPSESGMFEIGYLHKLIRDIPKPVIA
FT                   AVNGVAVGGGHVLHVLCDVSIAADTARFGQAGPKVGSFDAGFGSAYLARVVGEKKAREI
FT                   WYWCRIYDAQEALAMNLVNKVVPAAELLAEAKSWAAEISDKSPTAIKFLKQSFNADTDH
FT                   QAGFSNMAMTALDIFVASEEGMEGAAAFAEKRKPDFGSKVNWH"
FT   gene            411964..412566
FT                   /locus_tag="Intca_0382"
FT   CDS_pept        411964..412566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0382"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG1309 Transcriptional regulator; InterPro
FT                   IPR001647: IPR006665; KEGG: nml:Namu_0880 transcriptional
FT                   regulator, TetR family; PFAM: regulatory protein TetR;
FT                   SPTR: Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46931"
FT                   /db_xref="GOA:E6S827"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:E6S827"
FT                   /protein_id="ADU46931.1"
FT                   /translation="MATAVTRQERMQRRRVEIIQAAVELFQELGFHAATTHQVAERAGL
FT                   SVGLIYQYFGNKEDLLRSVIVDILGQFRDRIPSAIAAAGPDPVARLRAGYRAYVDVIDE
FT                   NREGALLTYREGLTLSPDGRDEIKKLEIETAAPLRDVILEGIASGAFTDVDAELVVHNL
FT                   VLTAHGWALKHWRLAKTYDVDGYADRQLDLLLRAIRP"
FT   gene            complement(412642..413391)
FT                   /locus_tag="Intca_0383"
FT   CDS_pept        complement(412642..413391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0383"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG2181 Nitrate reductase gamma subunit;
FT                   InterPro IPR003816; KEGG: nca:Noca_1349 respiratory nitrate
FT                   reductase gamma subunit; PFAM: Nitrate reductase gamma
FT                   subunit; PRIAM: Nitrate reductase; SPTR: Respiratory
FT                   nitrate reductase gamma subunit; TIGRFAM: respiratory
FT                   nitrate reductase, gamma subunit; PFAM: Nitrate reductase
FT                   gamma subunit; TIGRFAM: respiratory nitrate reductase,
FT                   gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46932"
FT                   /db_xref="GOA:E6S828"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E6S828"
FT                   /protein_id="ADU46932.1"
FT                   /translation="MSTFLWVIFPYICLAVFVVGHWWRYRYDKFGWTTRSSQLYESRML
FT                   RWGSPLFHFGLLGVVGGHVIGLVIPQSWTEAVGMSETLYHWVAVIGGMISGLMVLAGLV
FT                   ILIYRRRTVGPVFSATTPMDKTMYFFLALVIVLGMWNTIASSIFGLGGSEGHAFNYRES
FT                   VSLWFRQIFYGQPDPGLMANAPLGFQLHALVAFFLFALWPFTRLVHVFSAPLGYVTRPY
FT                   IVYRSKDEREGTAVGTRAPKRGWERVQ"
FT   sig_peptide     complement(413332..413391)
FT                   /locus_tag="Intca_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(413388..414164)
FT                   /locus_tag="Intca_0384"
FT   CDS_pept        complement(413388..414164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0384"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="COGs: COG2180 Nitrate reductase delta subunit;
FT                   InterPro IPR020945: IPR003765; KEGG: nca:Noca_1348
FT                   respiratory nitrate reductase chaperone NarJ; PFAM:
FT                   TorD-like chaperone; SPTR: Putative nitrate reductase delta
FT                   subunit; TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase delta subunit;
FT                   TIGRFAM: nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46933"
FT                   /db_xref="GOA:E6S829"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S829"
FT                   /protein_id="ADU46933.1"
FT                   /translation="MNPFRRLAKSQSSRLRDDHLQAAWQAVSLLLDYPSEESVGRHPLI
FT                   RRAIAPLPDAVRMPLTSFLDHVASQPLQAVQREYVETFDHTRKCCLYLTYFTFGDTRRR
FT                   GVALVQFKQAFQKSGVELSADELPDHLGVVLEFGATADREAAWKLLGDYRAGIEMLQVA
FT                   LDDRTSPWSAVIEALRATLPELDGDGLTAVARLIEAGPPQEEVGLDGYALDPRLTENPA
FT                   ERHPNPSGALAPVSPPTTRVTESVSLGSTIRVGAPS"
FT   sig_peptide     complement(414099..414164)
FT                   /locus_tag="Intca_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(414161..415813)
FT                   /locus_tag="Intca_0385"
FT   CDS_pept        complement(414161..415813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0385"
FT                   /product="respiratory nitrate reductase beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG1140 Nitrate reductase beta subunit;
FT                   InterPro IPR017896: IPR006547; KEGG: kfl:Kfla_4151 nitrate
FT                   reductase, beta subunit; SPTR: Nitrate reductase, beta
FT                   subunit; TIGRFAM: nitrate reductase, beta subunit; TIGRFAM:
FT                   nitrate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46934"
FT                   /db_xref="GOA:E6S830"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:E6S830"
FT                   /protein_id="ADU46934.1"
FT                   /translation="MKIMAQMAMVMNLDKCIGCHTCSVTCKQAWTNRAGTEYVWFNNVE
FT                   TRPGLGYPRTYEDQETWEGGWVRKANGRLTLRAGGRWKKLATIFSNPKLPSIEDYYEPW
FT                   TYDYATLLSSPASSTFPVARPQSLISGKQMNIQWSANWDDDLGGSLEHAAKDPMLKGIE
FT                   DKVKFEFEQTFMFYLPRICEHCLNPSCAASCPSGAIYKRSEDGIVLVDQDKCRGWRMCV
FT                   SGCPYKKVYFNHKTGKAEKCTFCYPRIEVGIPTVCAETCVGRLRYIGLMLYDADKVLEA
FT                   ASVENDHDLYEAQRDVFLDPNDPAVAHAAEQAGIPLDWIEAAKKSPVRRLIQDYKVALP
FT                   LHPEYRTMPMVWYIPPLSPVVDVVRDTGFDAEDKGNLFAAIEALRIPVEYLANLFTAGD
FT                   VEPVNDVLRKLAAMRSFMRDINLGGDPDASIAEAVGMDAESMYEMFRLLAIAKYDDRYV
FT                   IPTAHVEQAHGLEELATECPVDFDYEPTTGIFGEGSGDLTPVAVENFRMLEERQKSDEL
FT                   VAGGSKRGRVNLLNWDGKGAPRGLFPHRKKQDR"
FT   gene            complement(415840..419550)
FT                   /locus_tag="Intca_0386"
FT   CDS_pept        complement(415840..419550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0386"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG5013 Nitrate reductase alpha subunit;
FT                   InterPro IPR006656: IPR006657: IPR006655: IPR006468; KEGG:
FT                   nca:Noca_1346 respiratory nitrate reductase alpha subunit
FT                   apoprotein; PFAM: molybdopterin oxidoreductase;
FT                   molydopterin dinucleotide-binding region; PRIAM: Nitrate
FT                   reductase; SPTR: Respiratory nitrate reductase alpha
FT                   subunit apoprotein; TIGRFAM: nitrate reductase, alpha
FT                   subunit; PFAM: Molybdopterin oxidoreductase; Molydopterin
FT                   dinucleotide binding domain; TIGRFAM: respiratory nitrate
FT                   reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46935"
FT                   /db_xref="GOA:E6S831"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:E6S831"
FT                   /protein_id="ADU46935.1"
FT                   /translation="MNASPTGLTETGLDGPLSEALVGTRRFFTKAKVSEDKRSMEAKGG
FT                   RTGDAFYRDRWSHDKVVRSTHGVNCTGSCSWKVYVKDGIITWEAQQTDYPSPGADRPDY
FT                   EPRGCPRGAAFSWYTYSPTRVRYPYVRGVLLEMYRAAKSAHGGDPVLAWGSIVEDPDKS
FT                   RRYKKARGKGGLVRATWEEVTELVAAAHVYTVKRFGPDRIAGFSPIPAMSPVSYASGAR
FT                   FLELVGAPMLSFYDWYADLPNASPQMFGDQTDVPESGDWWDAGYLIMWGSNVPLTRTPD
FT                   AHWMTEARYRGQKVLAVAPDYAENVKFADEWVTTAPGTDGALAMGMGHVILKEYFVDQQ
FT                   VPFFADYNKRFTDLPYLISLVRGDDGTYRPGKYLVAGDIEGGPKSDSENAMWKPAVLDA
FT                   ATGEVAIPNGSIGDRFGDEGLGRWNLELGDLDPALSLYGHHDEAVEVSLPRFDAADGRV
FT                   AHESRGVPVRRVGDHVVTTVFDLLLAQYGVAREGLPGAWPTGYDDPSVPATPAWQQQHT
FT                   SVPAEQVTRLAREWAQNAIDTTGRGMILLGAGTNHWFHSDQIYRAILLLTTITGTQGRN
FT                   GGGWAHYVGQEKIRPIMGFQHMAFALDWQRPPRHMNQTAYWYVHTSQYRYDTFSADDLD
FT                   SGTGVFAGKSVMDLLAQSVRLGWTPSYPTFDRSSLDLADDAEAAGMEPPAYVVQQLKEG
FT                   KLHFAVEDPEAENNYPRILSLWRSNLLGSSAKGNEYFLRHLLGTDSAATAEEAGPDQRP
FT                   ATIRWADEAGEGKLDLLMTIDFRMTSSTIFSDVVLPAATWYEKHDLSTTDMHPFIHSFN
FT                   PAINPPWQTKSDWDAWKAVAKKFSELAVDHLGTRKDVVAKPLWHDTPEAMATVHGVVKD
FT                   WRAGECEPVPGKTMPVLAVAERDYTAIYDKMITIGPLLEKVGMLTKGVAYDVKREVEIL
FT                   RGRNGVQHGGVGNGQPKVETDVQMADAMLHLAGVSNGHLATQGFRFLEKRTGTQLADLA
FT                   AEHEGKQITFADTQVAPVPVITSPEWSGSESGGRRYSPFTINIERSKPFHTLTGRQQFY
FT                   VDHDWFLGMGEMLPVYRPPLNMTTLFGESPIGEQNELGVSVRYLTPHNKWSIHSEYQDN
FT                   LFMLSLSRGGQSVWMSDRDAAKIGVKDNDWIEMVNRNGVVAARAIVSHRMPEGTVYMHH
FT                   AQDRLIDVPLTERDHKRGGIHNSLTRILLKPNHIVGGYAQLAYFFNYIGPIGNNRDEVT
FT                   MIRRRTAPVEY"
FT   gene            complement(419547..420362)
FT                   /locus_tag="Intca_0387"
FT   CDS_pept        complement(419547..420362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0387"
FT                   /product="putative transcriptional regulator"
FT                   /note="COGs: COG2345 transcriptional regulator protein;
FT                   KEGG: nca:Noca_2106 transcriptional regulator; SPTR:
FT                   Transcriptional regulator; PFAM: IclR helix-turn-helix
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46936"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S832"
FT                   /protein_id="ADU46936.1"
FT                   /translation="MAQTASVSAGPGTDLLGSPVRRTIVDTLANLPTGVDPESGAVIPH
FT                   PGLRAQDLANRLGLHVTTVRFHLDQLVAAGLLRTSFQRRKEAGRPRKLYAIEQGSLGHV
FT                   TSDQSYRMLTELLVETLSSGSDAMPNTPEEAGARWGRRHVLDGHVGLIGQQAARSPGRW
FT                   LGKIGQMVDLLREWGYSPEVSTTNDGRTARVALHDCPFLPLAKDNTAVVCGIHRGLIRG
FT                   VLEALGEDSTEVGLTPFVAPSLCIAALTTHSSFEHPTTLNHPPRQGDHP"
FT   gene            420700..422199
FT                   /locus_tag="Intca_0388"
FT   CDS_pept        420700..422199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0388"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2223 Nitrate/nitrite transporter; InterPro
FT                   IPR011701: IPR001412; KEGG: stp:Strop_0176 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46937"
FT                   /db_xref="GOA:E6S833"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S833"
FT                   /protein_id="ADU46937.1"
FT                   /translation="MSGSSAGSTGRTRVLVMSTTAFTVMFAVWMMFGILGIPIQKELGL
FT                   SNVELAWVSAVAILNGSMWRLPAGMLTDRIGGRKVTVAMLLATAVPAYFVSQATSYLML
FT                   LVLAFLVGFAGNLFSVGIAWNAAWYPRERQGFALGVFGAGNVGASVTKFIGPAIITGTA
FT                   GATYLFGVDGGWRLVPAIYAVLLVAIAVLTWVVTPHHDRMPGRSQPVATMLTPLKDVRV
FT                   WRFGLYYVAVFGAYVALSVSLPKYYVDNFGVDLWTAALLTATFIFPASLLRPVGGWFSD
FT                   TFGARRGMYFTFTAMLVTSGILMMPNGHVVIQQADGTLTEHWNYSIGLVPFAILVFLLG
FT                   CAMGIGKAAVYKHIPEYFPRSVGPVGGLVGMLGGLGGFALPPLFAYSNSWLGFASSTFL
FT                   VIFLLTLACAVWMHWTVVHMLHEGSPHLSDWFEPPPAHNPLIEAAHAEPLDASEPTGSP
FT                   SLHVGTTTTSAPTTTTAPTTTPETAHAPATGTEKQTTEARA"
FT   sig_peptide     420700..420777
FT                   /locus_tag="Intca_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            422196..423590
FT                   /locus_tag="Intca_0389"
FT   CDS_pept        422196..423590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0389"
FT                   /product="nitrate/nitrite transporter-like protein"
FT                   /note="COGs: COG2223 Nitrate/nitrite transporter; KEGG:
FT                   saq:Sare_0190 nitrate/nitrite transporter-like protein;
FT                   SPTR: Nitrate/nitrite transporter-like protein; PFAM: Major
FT                   Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46938"
FT                   /db_xref="GOA:E6S834"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S834"
FT                   /protein_id="ADU46938.1"
FT                   /translation="MTTKTAPATGEWLEAWDPENEQTWDKSLAWRTLWVTTFVLTLAFI
FT                   AWFLPSAIIPKLNLLGYSFSKGQLYWMAAMPGLAAGLLRLVWMVLPPIMGTRKMVSLTS
FT                   LLLIASTLGWGVRVQSPTAPYWELMVLAFLAGIGGGAFSGFMPSTSYFFPRRMQGTALG
FT                   LQAGIGNFGVSIVQLLTPYLIAIGALGIFGGSQMLEMPGKPTQQVWYQNAAFVWIPLMV
FT                   VGAILAWTMLKSVPIKANVRQQFDIFSNQDTWWMTLLYIMTFGTFSGLSAQFGLLMANL
FT                   YGIGNSEIVKGAGASATLLIDGYAVPDVVKFVFLGPLVGAGARVLFSPLTDRMGGAKWT
FT                   LVSALGLIASIAYTIPALTPDTSSAAALDSGFTRFLWGMLAIFLFAGIGNASTFKQMPM
FT                   IFERRQAGGVIGWTAAIAAFGPFLFGVGLTIMSPTMFYILGIAWAVMCTGIIWWRYARP
FT                   GAPKPG"
FT   gene            complement(423762..424580)
FT                   /locus_tag="Intca_0390"
FT   CDS_pept        complement(423762..424580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0390"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
FT                   racemase; InterPro IPR001753: IPR018376; KEGG: cur:cur_1929
FT                   enoyl-CoA hydratase/isomerase family protein; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; SPTR: Enoyl-CoA hydratase;
FT                   PFAM: Enoyl-CoA hydratase/isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46939"
FT                   /db_xref="GOA:E6S835"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6S835"
FT                   /protein_id="ADU46939.1"
FT                   /translation="MSSDASAAHLSCTVEAGIARVELNRPDKLNGLTLDMLEALATTAR
FT                   RLRDDRALRAVILSGAGDSFCAGLDFATVLKNPRAIATAFVPRPWLGTNTFQEASWAWR
FT                   RLPVPVVAAVHGHCFGGGVQIALGADFRFTTPDAKWSVLEAKWGLIPDMSGIQSLTEVV
FT                   GLDVAKRLTMTGAVISGEEAAAIGLATGVADDPRAAADELVAQIMTRSPDAVAAAKRLF
FT                   DGTWSAGPRRTFARERAEQLRLLLRTPNTRHAQRAALGTETAHFGPRHKR"
FT   gene            424728..426266
FT                   /locus_tag="Intca_0391"
FT   CDS_pept        424728..426266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0391"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
FT                   subunit; InterPro IPR007886: IPR007698: IPR008143:
FT                   IPR004571; KEGG: mva:Mvan_0120 NAD(P) transhydrogenase
FT                   subunit alpha; PFAM: alanine dehydrogenase/PNT domain
FT                   protein; SPTR: NAD(P) transhydrogenase, alpha subunit;
FT                   TIGRFAM: NAD(P) transhydrogenase, alpha subunit; PFAM:
FT                   Alanine dehydrogenase/PNT, C-terminal domain; Alanine
FT                   dehydrogenase/PNT, N-terminal domain; TIGRFAM: NAD(P)
FT                   transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46940"
FT                   /db_xref="GOA:E6S836"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S836"
FT                   /protein_id="ADU46940.1"
FT                   /translation="MQIGVPRETRPRETRVAATPKTVGQLIALGYDVVVERGAGIGASF
FT                   DDAAYVAAGARVVDGSEAWASDIVHKVNAPSDAEITMLRPGAVLVSLMAPALSPDLVEK
FT                   LRAANVTAMAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHQFGSFFTGQVTAAGKV
FT                   PPAKVLVVGAGVAGLAAIGTAGSLGAIVRATDARPEVAEQVESMGGEFLRVQVGELQAS
FT                   SDGYAREMGEDYNRKAAELYAEQCKDVDIIITTALIPGRPAPLLITDEMVATMRAGSVI
FT                   VDMAAANGGNVAGSVADELVVTDNGVKIIGYTDLAGRLPTQASQLYGTNLVNLMKLVTP
FT                   GKDGQLVADLEDTVVRGMTVARDGELLWPPPPIQVSAVPAPVAAAPVAKAPPPPPNPNR
FT                   KFVMMGVGAAAFALIAAFSPASFLSHFTVFALAVVVGFYVIGNVHHALHTPLMSVTNAI
FT                   SGIIVVGALIQLGVSESADVAILALAFVATLVASINIFGGFLVTRRMLTMFRKG"
FT   gene            426270..427640
FT                   /locus_tag="Intca_0392"
FT   CDS_pept        426270..427640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0392"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="COGs: COG1282 NAD/NADP transhydrogenase beta
FT                   subunit; InterPro IPR004003: IPR012136; KEGG: cfl:Cfla_0904
FT                   NAD(P)(+) transhydrogenase (AB-specific); PFAM: NAD(P)
FT                   transhydrogenase beta subunit; PRIAM: NAD(P)(+)
FT                   transhydrogenase (AB-specific); SPTR: NAD(P)
FT                   transhydrogenase subunit beta; PFAM: NAD(P)
FT                   transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46941"
FT                   /db_xref="GOA:E6S837"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:E6S837"
FT                   /protein_id="ADU46941.1"
FT                   /translation="MELSLITAAYIIAAILFILSLAGLSKHETAKDGNVLGMVGMGLAL
FT                   LATLWLAGRSAEWLNWGLIAVAVAIGATIGVTKARKVEMTGMPELIAMLHSFVGLAAVL
FT                   VGYNSFLTGSTDSVHSVEVFLGVFIGAVTFTGSIVAYLKLSAKISGAPLMLPGRHWLNL
FT                   LAGVVSVGLMIWFVAAHSIVPLLVMTAIALAFGWHLVASIGGGDMPVVVSMLNSYSGWA
FT                   AAAAGFMLGNDLLIVTGALVGSSGAYLSYIMSKAMNRKFLSVIAGGFGQDGGKPAGDVD
FT                   YGDHRETNPSEVADLLVHARSVVITPGYGMAVAQAQYPVAELTSRLREKGVNVRFGIHP
FT                   VAGRLPGHMNVLLAEAKVPYDIVLEMDEINGDLPETDVVLVIGANDTVNPSAEEDPNSP
FT                   IAGMPVLEVWKAKDVVVFKRSMAAGYAGVQNPLFFRDNSAMLFGDAKDRVEDIIKAL"
FT   sig_peptide     426270..426359
FT                   /locus_tag="Intca_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            427927..428526
FT                   /locus_tag="Intca_0393"
FT   CDS_pept        427927..428526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0393"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: bcv:Bcav_3642
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; manually curated; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46942"
FT                   /db_xref="GOA:E6S838"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6S838"
FT                   /protein_id="ADU46942.1"
FT                   /translation="MNPAFDASAHVTRARRRADLSQRELAARLGVSQSVVNRWEGGSPM
FT                   SVNRLVTILALAGLRLCVVDGSGRQVDPTPSDVVRDNAGRRFPSHLDVDPPERVPAERV
FT                   LMPRRDRPDPRGWYRLRDKRDARRLSEGAPTDHPTVSGELSRRLDEVRRQRLRARARAR
FT                   EEALPECECLDGCFELACLPGCSCQCEPDRSSGRVS"
FT   gene            complement(428546..429445)
FT                   /locus_tag="Intca_0394"
FT   CDS_pept        complement(428546..429445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfl:Cfla_0847 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Bacterial membrane
FT                   flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46943"
FT                   /db_xref="GOA:E6S839"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:E6S839"
FT                   /protein_id="ADU46943.1"
FT                   /translation="MAILRRSDEIPSGLSPILLPGEQLVTAVHSHWARLVKPVSISALA
FT                   LTIAIVVDANLTPATQPVGNALWLLFFITVVWLLWRILEWRNDWFVATDKRLLLRYGII
FT                   THKVAMMPLIKVTDMSYVRSISGLLFGYGRFIMESAGQDQALRTVEWVPRPDETYRAIC
FT                   AVIFNIGPPPGTATVVEVDDGPEQTPPEGAGPEGGSGGPGGTGGRGGPTDPGGQGAEGN
FT                   PGTRAYGTPSYPDVPPIHNPIQDRLDQYSRAIPIRRVRGGEPLYESDDIRRRRRSADTG
FT                   PVPIRQQDRRPRHEPRSD"
FT   gene            complement(429467..429640)
FT                   /locus_tag="Intca_0395"
FT   CDS_pept        complement(429467..429640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfl:Cfla_0846 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46944"
FT                   /db_xref="UniProtKB/TrEMBL:E6S840"
FT                   /protein_id="ADU46944.1"
FT                   /translation="MGPKAKKIILILVGAFFIYAIFTSPDKAAGIVTNAWGVLVDGFNA
FT                   ILRFFDTLLNSN"
FT   sig_peptide     complement(429551..429640)
FT                   /locus_tag="Intca_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            429805..430779
FT                   /locus_tag="Intca_0396"
FT   CDS_pept        429805..430779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0396"
FT                   /product="Ribosomal small subunit Rsm22"
FT                   /note="COGs: COG5459 rRNA methylase; InterPro IPR015324;
FT                   KEGG: kfl:Kfla_2484 ribosomal small subunit Rsm22; PFAM:
FT                   Ribosomal small subunit Rsm22; SPTR: Ribosomal small
FT                   subunit Rsm22; PFAM: Mitochondrial small ribosomal subunit
FT                   Rsm22"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46945"
FT                   /db_xref="GOA:E6S841"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S841"
FT                   /protein_id="ADU46945.1"
FT                   /translation="MKPPEGELRHALADALRGFSQPELAAATAELVARYRQPRAAARAI
FT                   LSTPERVAAYAAYRMPATHAAMQRILEELAEGGFGPRTMIDLGGGTGAAAWAAAGAFDT
FT                   LESILVLDQVPEALALGKDLVARASTPALRSARFERALVGGGPAGTADLVTASYVLSEL
FT                   SGAQTTMLLDEMMARGRVAVLAEPGTPDGYARIIEARRRFLADGWRLLGPCPHEVDCPL
FT                   GVGDWCHFAARVNRSAEHRRIKGADLSYEDEKFSWVAAAAPGVMEPRARDSRILRHPSK
FT                   RKGLVEFRVCRPDGSAGPAVVSKREGERYRAARDRDWGDTLPG"
FT   gene            complement(430902..431543)
FT                   /locus_tag="Intca_0397"
FT   CDS_pept        complement(430902..431543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0397"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COGs: COG0035 Uracil phosphoribosyltransferase;
FT                   InterPro IPR000836: IPR005765; KEGG: nca:Noca_0275 uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: Uracil phosphoribosyltransferase; TIGRFAM: uracil
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46946"
FT                   /db_xref="GOA:E6S842"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:E6S842"
FT                   /protein_id="ADU46946.1"
FT                   /translation="MDVHVADHPLIAHKLTYLRDKRTDSPTFRRLAEELMTLLAYEATR
FT                   EVRVEPFQIETPVTATTGIKLSNPKPLVVPILRAGLGMLEGMVRLLPSAEVGFLGMQRN
FT                   EVTLEAVTYANRLPDDLTGRQVFVLDPMLATGGSMSDAIHFLIDRGADDITAVCLLAAP
FT                   EGIAHLEESLASTNVPVRVVTGAVDERLNEKGYIVPGLGDAGDRLYGTVD"
FT   gene            431561..432133
FT                   /locus_tag="Intca_0398"
FT   CDS_pept        431561..432133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0398"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR002125; KEGG: cfl:Cfla_0483 CMP/dCMP deaminase
FT                   zinc-binding protein; PFAM: CMP/dCMP deaminase
FT                   zinc-binding; SPTR: CMP/dCMP deaminase zinc-binding
FT                   protein; PFAM: Cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46947"
FT                   /db_xref="GOA:E6S843"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E6S843"
FT                   /protein_id="ADU46947.1"
FT                   /translation="MGRESERPGTDAAATGETYAAWLGEALELAAATAGSDDVPVGAVV
FT                   IGSDGLVIGRGRNVREELGDPTGHAEVIALRSAAAAVGTWRLDGATLAVTLEPCVMCAG
FT                   AAIAARVERIVFGAWDPKAGACGSVWDLTRDPLATHRADVVGGVRAEEAATLLVDFFER
FT                   RRLPGADEPDWTGTVNGVRRQEGGDGP"
FT   gene            432130..433008
FT                   /locus_tag="Intca_0399"
FT   CDS_pept        432130..433008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0399"
FT                   /product="Ketopantoate reductase ApbA/PanE domain protein"
FT                   /note="COGs: COG1893 Ketopantoate reductase; InterPro
FT                   IPR013332: IPR013752; KEGG: gob:Gobs_3881 2-dehydropantoate
FT                   2-reductase; PFAM: Ketopantoate reductase ApbA/PanE domain
FT                   protein; SPTR: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase PanE/ApbA; Ketopantoate reductase
FT                   PanE/ApbA C terminal; TIGRFAM: 2-dehydropantoate
FT                   2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46948"
FT                   /db_xref="GOA:E6S844"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S844"
FT                   /protein_id="ADU46948.1"
FT                   /translation="MTRIGVLGPGGVGGVMAARLARAGGDVVVVAGERTAAAIAAGGLH
FT                   YTGPEGTWDGFVEARSLLVAPVDVLIVATKAMDLAAALQRVPASLLGGSVVVPLLNGVD
FT                   HLPYLRAELPGAQVVASSVSVEATRHRPGVVEQVSGFCDVGVSVVNAEGHGWAQLAEEA
FT                   GCTVTTAPDDATVLWRKLSFLAPLALLTTAAAAPIGPALRRQPQLVRPIVAEAAAAAEA
FT                   FGVTIDPDGIEERLRSLPETMQSSMLKDLLGGRAVELDAIAGPVIRALGHEGAPATVAA
FT                   ATEILARQGAT"
FT   sig_peptide     432130..432198
FT                   /locus_tag="Intca_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433069..433158
FT                   /locus_tag="Intca_R0010"
FT   tRNA            433069..433158
FT                   /locus_tag="Intca_R0010"
FT                   /product="tRNA-Ser"
FT   gene            433481..433747
FT                   /locus_tag="Intca_0400"
FT   CDS_pept        433481..433747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0400"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /note="KEGG: rca:Rcas_3148 hydrogenase (NiFe) small subunit
FT                   HydA"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46949"
FT                   /db_xref="UniProtKB/TrEMBL:E6S845"
FT                   /protein_id="ADU46949.1"
FT                   /translation="MKQAIGAAAVISLAAVLHVSASIGASAHNRAHIILPSGECLIVGS
FT                   EKSVTLPDGSLHDLRPETYPADEIGTAYAADEGNSFLLKGACP"
FT   sig_peptide     433481..433552
FT                   /locus_tag="Intca_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(434318..434944)
FT                   /locus_tag="Intca_0401"
FT   CDS_pept        complement(434318..434944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0401"
FT                   /product="Methyltransferase type 11"
FT                   /note="InterPro IPR013216; KEGG: afw:Anae109_4039
FT                   methyltransferase type 12; PFAM: Methyltransferase type 11;
FT                   SPTR: Methyltransferase type 12; PFAM: Methyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46950"
FT                   /db_xref="GOA:E6S846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S846"
FT                   /protein_id="ADU46950.1"
FT                   /translation="MDTEHFDEKAATWDDDPGKRRQARDVARAVAAAVPVGEGTRLLEY
FT                   GAGTALVTEELLASVGPVSRVTLADNSPGMRAVLREKALSGALPADTAILDLDLEDQSA
FT                   PPDRFDLIVSSMFMHHVRRLPVVLSAFAELLVDGGRVCIADLDREDGTFHTHDFDGHHG
FT                   FDRGELRTGLEQAGLVDVTITDCTHIERDGVTYSVFLATAVKGTD"
FT   gene            435055..437523
FT                   /locus_tag="Intca_0402"
FT   CDS_pept        435055..437523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0402"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0404 Glycine cleavage system T protein
FT                   (aminomethyltransferase); InterPro IPR006076: IPR006222:
FT                   IPR013977; KEGG: nca:Noca_3838 FAD dependent
FT                   oxidoreductase; PFAM: FAD dependent oxidoreductase; glycine
FT                   cleavage T protein (aminomethyl transferase); Glycine
FT                   cleavage T-protein barrel; SPTR: FAD dependent
FT                   oxidoreductase; PFAM: Aminomethyltransferase folate-binding
FT                   domain; Glycine cleavage T-protein C-terminal barrel
FT                   domain; FAD dependent oxidoreductase; TIGRFAM: glycine
FT                   cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46951"
FT                   /db_xref="GOA:E6S847"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S847"
FT                   /protein_id="ADU46951.1"
FT                   /translation="MLVTVGLPDRARVVVIGGGVIGSSVAYHLAHAGWTDVVVLERDRL
FT                   TSGTTWHAAGLMTCFGSTSETSTAIRLYSRDLYARLEAETGQSTGFRPVGLIEAAADRD
FT                   RLEEYRRVAAFQRHLGLEVHEISPTEMAERFPWARTDDLLGGFFVPGDGRVNPVDLTMA
FT                   LAKGARALGVRVVEGVAVTDVLTSGGAVTGVRAAGQTIECEYVVNCTGMWARELGERNG
FT                   VVIPNQAAEHYYLITDTIEGLDPNAPVFEDPSSYGYYREEGGGMMVGLFEPEAAAWRVE
FT                   GIPSDFSFGTLPADWDRMAPFLEKAMARVPITQEVGIRTFFCGPESFTPDLAPAVGEAP
FT                   GIRGYFVAAGMNSVGILSAGGLGRVLAHWITTGRPDVDVTGFNVDRFRVDQLEPAYRAA
FT                   RTAEVLGTVYAAHTPGTQLTSARGRLLSPVHDRLVAQGGLLREVSGWEGADWFAGAGRT
FT                   PEAEPTWGRAPWFEQWEQEHRAVREAVGLMDLSFMAKFRVQGQGAGSLLDRLSAAAVNG
FT                   DPGVITYTQWLNDDGRIEADLTVTKLDDDDFWVVASDTAHGHVRAWLHRFVDATVSITD
FT                   VTVDYAQLNVQGPRSRDVLSELTDADLTTEAFGFRSAGWVELAGTRVLLARITYLGELG
FT                   YELYVPAGDALRVHDAIQSAGTTHGLRPVGLKALASLRMEKAYRDYGHDIDNTDCPLEA
FT                   GLGFALALDKPADFIGREAVLARQAANAAAGGMARRMVQVRLLDPGPLLFHAEIVLRDG
FT                   QPVGYVRAGSYGWTLGSAVGLAMVEGGGQPVTSEWLASGRWEIDVAGTRCAAAVSVRPM
FT                   YDPTSARVRL"
FT   sig_peptide     435055..435150
FT                   /locus_tag="Intca_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(437648..437890)
FT                   /locus_tag="Intca_0403"
FT   CDS_pept        complement(437648..437890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dze:Dd1591_1431 major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46952"
FT                   /db_xref="UniProtKB/TrEMBL:E6S848"
FT                   /protein_id="ADU46952.1"
FT                   /translation="MRKNWLARTALIITLGAAPLALAIPASAATGPAPGTGLTGACNML
FT                   QAILPSGAGMGHAMTVDAPQGNAGMWRAVDVSGCS"
FT   sig_peptide     complement(437807..437890)
FT                   /locus_tag="Intca_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(437919..438296)
FT                   /locus_tag="Intca_0404"
FT   CDS_pept        complement(437919..438296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_6370 short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46953"
FT                   /db_xref="UniProtKB/TrEMBL:E6S849"
FT                   /protein_id="ADU46953.1"
FT                   /translation="MPMLIVLVALVDGQREVTALGVTTADRLAALGVTHVTIARDQRTE
FT                   AVVLDGWAFDAITHAAEASDLVGGGAATQTLQPVLQVLITPEGRPGAHREETSDRAGTR
FT                   TGVRQGVLDPDGAPPSAVHPH"
FT   sig_peptide     complement(438240..438296)
FT                   /locus_tag="Intca_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(438379..441219)
FT                   /locus_tag="Intca_0405"
FT   CDS_pept        complement(438379..441219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0405"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG3899 ATPase; InterPro IPR000792; KEGG:
FT                   sen:SACE_5520 LuxR family transcriptional regulator; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   SPTR: Transcriptional regulator, LuxR family; PFAM:
FT                   Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46954"
FT                   /db_xref="GOA:E6S850"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6S850"
FT                   /protein_id="ADU46954.1"
FT                   /translation="MGPVARAGALVGRTEELSTLQALVRAQAGGAAAAVLVGEPGMGKT
FT                   RLLAASADLLRNHRVFRMTGFEPERQVPLGAALPFLRRIGALGRAGRQLQALLSPADPE
FT                   LGSVEPARLFEAAHRALCEVADPALVIDDLQWLDGLSRALAHYLVRAALDEGVGVLMVC
FT                   ATRPGPESAAFASSLQDLLGDSGHYVELTLGPLAGAEGAELAQALRPGLSSASAQRISS
FT                   AAAGSPFWIELAIRAGGDPGVRSTAIPALLRALGSDAVQCLAAAVIGGRPAESALLGEV
FT                   LAWPEARVAAALSELVNRGVVSAEAGWFGVAHDLVREAALNQLPHEHSRRLHRQFAAVL
FT                   RRRAEGDLQVLMEALEHEGAAGAVSTELASEIASSPQRRVLGQSGLHRLAAIAELPNPD
FT                   GTERLAVDRLLADLAEEIGDSEFALRRLKQLSETLPRRAERASAALAAARHAVELGLVP
FT                   ETVALLARARRDGWDDPWTHVGADALDFARLAWLEHDAPAAQPYRTAAIDAARDLLARA
FT                   GPIESLPLAARQAYVEAINAERVSYLMAGDMTGMLDVADEFVEATRGLGEQHLDARLFL
FT                   SVALRLLNRWPEAESRAVEVRRAARQQVHPGMEAYAGFELALVVYHLGRVAEARKLHED
FT                   ARRLCERIGASFDAADTWLCGLREVIEASAANWRTAVDSLRQQADRHQNPHYRIILRQR
FT                   AALWSARFAPADSRELVVGLLDSADTDARAAGCVRCAADLHVIGAEALARVGEVDSTRR
FT                   LLRAWDAQWPDPNARAAFHRLRADAALAAAAEESRAPELLRQVIASATAAGTRLEELWG
FT                   LIDLGSVLAGADRAAASEAWSTASRLAAELGAVSEQRLVDQRLRAIGVRRVAPSRRSAA
FT                   DASPVATLTRRELDVACLAVTGARNVDIAHTLFISPKTVEQHISRVLAKLGVHNRAELG
FT                   SRYADDLDVAADGTEK"
FT   sig_peptide     complement(441121..441219)
FT                   /locus_tag="Intca_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            441669..442169
FT                   /locus_tag="Intca_0406"
FT   CDS_pept        441669..442169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2435 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46955"
FT                   /db_xref="UniProtKB/TrEMBL:E6S851"
FT                   /protein_id="ADU46955.1"
FT                   /translation="MRRLLAFIAVFTASLLFAAPAALATSPHFVRAAGSINADGSLTVS
FT                   FKEAGLGTNQNIDYTLSADASVTYVCVNRGGANPSASNKTTVAGPVSASGTFASGKNGQ
FT                   VTASLTVSPPSPGDFSCPKGQSLQIASVSYTNVVLSDTTNNVIEPLGTFDSGCLLPRVR
FT                   GAC"
FT   sig_peptide     441669..441764
FT                   /locus_tag="Intca_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(442254..443009)
FT                   /locus_tag="Intca_0407"
FT   CDS_pept        complement(442254..443009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0407"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: cwo:Cwoe_0591 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 11;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46956"
FT                   /db_xref="GOA:E6S852"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S852"
FT                   /protein_id="ADU46956.1"
FT                   /translation="MTESLRETVRATYAAAAKEASASSGACCGTTTFVELNTDDRGRVV
FT                   FGAALYDTEQIEGAEKAVEASLGCGVPTAVADLHPGETVLDLGSGAGGDVLISAKRVAP
FT                   GGKAIGIDMTPEMLELARANAREAGIDNAEFVEGYLEHIPLDEDSVDVVISNCVINLAA
FT                   DKAVVLAEAARVLRPGGRFAVSDVVADEDMDEATRSDMAAFTGCIAGALTEADYRAALA
FT                   GAGFEDIEITRTHSVHRHAWAAIVRARRG"
FT   gene            complement(443006..443206)
FT                   /pseudo
FT                   /locus_tag="Intca_0408"
FT   gene            complement(443203..443922)
FT                   /locus_tag="Intca_0409"
FT   CDS_pept        complement(443203..443922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0409"
FT                   /product="Peptidase M23"
FT                   /note="InterPro IPR016047; KEGG: pfr:PFREUD_17710
FT                   peptidase; PFAM: Peptidase M23; SPTR: Peptidase; PFAM:
FT                   Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46957"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E6S853"
FT                   /protein_id="ADU46957.1"
FT                   /translation="MADGTCPPLTAGEAIVLRLPFEGRWLAQNSPARRVPSHGVDVFGE
FT                   TYAIDFVAVDERGRTASRRDWRTWLATEPPDRFVGFGTPLLAPADGVVVAVHDGETDHV
FT                   ARRSQLALVPYALTQRARLRAGVGAVAGNHVIIELREHRAYLAMVHLRAGSLRVAVGDR
FT                   VTEGQHLAGCGNSGNSTEPHVHLQVMDSADLSVARGLPIAFRDFREWPRGRGEPVLRAT
FT                   GLPGERAVVEPLIGANP"
FT   gene            443992..444360
FT                   /locus_tag="Intca_0410"
FT   CDS_pept        443992..444360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_3206 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46958"
FT                   /db_xref="UniProtKB/TrEMBL:E6S854"
FT                   /protein_id="ADU46958.1"
FT                   /translation="METGRTPEEFFTGHPFALAVFERVLEISRGAAPVAVRVSTSQVAL
FT                   RVRHGFASVWLPGQYLRHPDAEVVVSIALGRHVDSPRFKEVVHPSSKHWIHHLEVRALA
FT                   DLDDEVAGWLREAAERAG"
FT   gene            complement(444474..445325)
FT                   /locus_tag="Intca_0411"
FT   CDS_pept        complement(444474..445325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0411"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="COGs: COG1804 acyl-CoA transferase/carnitine
FT                   dehydratase; InterPro IPR003673; KEGG: gme:Gmet_1711
FT                   L-carnitine dehydratase/bile acid-inducible protein F;
FT                   PFAM: L-carnitine dehydratase/bile acid-inducible protein
FT                   F; SPTR: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; PFAM: CoA-transferase family III"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46959"
FT                   /db_xref="GOA:E6S855"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E6S855"
FT                   /protein_id="ADU46959.1"
FT                   /translation="MREATPPLDGIAVVSIATNVPGPVAAARLTSLGATVTKVEPPSGD
FT                   LITRVAPGYYAELTAGQEVVTLDLKTPEGTIALEALLAAADVFITSHRPSALARLGLDW
FT                   EAVHARHPRLCHVAIVGDPGAGAEVPGHDLTYQAVNGLIFADDGTPRLPATLIADLAGA
FT                   ERAATAAVTALFARERTGTATHHEVALSAAAEAMADPLRHGLTAPGGLLGGALPGYAIY
FT                   AARDGFVACAALEPHFLARLEELLGARDHEGLAAAFGTRTAGEWVEWARDHDVPLEALP
FT                   RA"
FT   sig_peptide     complement(445248..445325)
FT                   /locus_tag="Intca_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(445332..446888)
FT                   /locus_tag="Intca_0412"
FT   CDS_pept        complement(445332..446888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0412"
FT                   /product="protein of unknown function DUF853 NPT hydrolase"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR008571; KEGG:
FT                   krh:KRH_08710 hypothetical protein; PFAM: protein of
FT                   unknown function DUF853 NPT hydrolase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial protein of unknown
FT                   function (DUF853)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:E6S856"
FT                   /protein_id="ADU46960.1"
FT                   /translation="MTDPAAAATQLDEIVSGYSFEGGVIKLGAAVLDGEAHPDAPVQIP
FT                   LNVLNRHGLVAGATGTGKTKTLQLMAEQLSDAGVPVFLADVKGDLSGLASPGEGGDKIT
FT                   QRAASVGMPWEGRGYPAEFYSLGGQGSGVPVRATITSFGPVLLSKVLALNATQESSLGL
FT                   IFHYADKNGLALLDLKDLRAVITYLTSDEGKADLKSLGGLSSATAGVILRNLVTFEDQG
FT                   ADRFFGEPEFDTSDFLRTTAEGKGIISCLELPQLQDRPQLFSTFLMWLLADLFHDLPEE
FT                   GDLDQPKLVFFFDEAHLLFDDASKPFMNAIEQTVRLIRSKGVGVFFVTQSPKDVPADVL
FT                   AQLGNRVQHALRAFTPDDAKALKQAIATYPHTQYDMAKLLTSLGIGEAVVTVLSEKGVP
FT                   TPVAWTRMKAPNSLMDPAPQATVDEIIARSSLTAKYAEVADRESAYELLAKRLESAPTP
FT                   AEEPDPEPTRAQPARPPKEEPGVVEQVVSSGVFRSMLRSAGTVIGREITRSIFGTSRRR
FT                   R"
FT   gene            446919..447239
FT                   /locus_tag="Intca_0413"
FT   CDS_pept        446919..447239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0413"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR014447; KEGG: xce:Xcel_0235 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46961"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:E6S857"
FT                   /protein_id="ADU46961.1"
FT                   /translation="MKPAYSVEVIFKAVGDTRPYPDHGLVTAKDWSNVPPRVVQLGELI
FT                   TTKSTLDLRGLLADDSTFFGDLFPHCVEWEGQLYLEDGLHRALRAALQQRPVLHARVLV
FT                   LS"
FT   gene            447303..447839
FT                   /locus_tag="Intca_0414"
FT   CDS_pept        447303..447839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_25980 hypothetical protein; SPTR:
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46962"
FT                   /db_xref="GOA:E6S858"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:E6S858"
FT                   /protein_id="ADU46962.1"
FT                   /translation="MSLVEDAEALEFRARRRRRATVTLAVLLLGLAGAFYYASTYFRDT
FT                   APKPGPCTTEVAEVPLTPADVTINVYNATSRSGLALTTSRRAVDRGFRIAKVANDPLKK
FT                   TIKESANIRYGADGEESARLLAQHIKGAKLVKDKRKGDTVDLVLGNAWKGFGPAPTPTA
FT                   TGPTLPPCPTVTVAG"
FT   sig_peptide     447303..447404
FT                   /locus_tag="Intca_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(447859..448662)
FT                   /locus_tag="Intca_0415"
FT   CDS_pept        complement(447859..448662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0415"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: kfl:Kfla_5624
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Probable ABC
FT                   transporter permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46963"
FT                   /db_xref="GOA:E6S859"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S859"
FT                   /protein_id="ADU46963.1"
FT                   /translation="MQVSRPERLANYAILMAFAVFALYPLIGIVTAALQPDTQAPGGLP
FT                   NFQQAWDIGRFGSYLRASALVSIFVVGVSTVLSILAGFAFGTMRFRGSEALFYVMLVGI
FT                   MVPAEAIVVPLFFDLRAIGLTDTFWALALPQVAQSVAFGTFWLRAFFRSSNRSIIEAAR
FT                   LDGASTWRILWQVLVPLARPALVTLVVLTFMWTWNEFLIPLVMVPTNESLRTAPLGLGF
FT                   FSGQYTQGFALLAAGAVIVALPVVVLYLFLQRHFIAGMLEGAVRD"
FT   sig_peptide     complement(448567..448662)
FT                   /locus_tag="Intca_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(448662..449570)
FT                   /locus_tag="Intca_0416"
FT   CDS_pept        complement(448662..449570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0416"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   kfl:Kfla_5625 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR: Putative
FT                   uncharacterized protein; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46964"
FT                   /db_xref="GOA:E6S860"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S860"
FT                   /protein_id="ADU46964.1"
FT                   /translation="MSPAPGRARRQVGPPGEPRRIGYLFVLPAFAVYAAFALYPLLKAV
FT                   YLSLWNWDGLTLATWAGLSNYADVLGDDRLRGAFGHALVLMVFFAVLPLLVGLVLAAVL
FT                   HRSQVRGLGFFRTVVFLPQVVAMVVIAVAWRRIYAPGGSLNSLLGAVGLESWTRGWLGD
FT                   YTFALPAVGVVGTWLESGLVTVLLLAGMSRIPKELYEAARLDGAGPIREFLGVTLPSIR
FT                   AEIAVALTLTVIAALKTFDLIYLTTAGGPGHSTTVPSYEVYRQAFEIGQVGLASTIGVI
FT                   LTVIIFAISFVITRIGDRVTD"
FT   sig_peptide     complement(449469..449570)
FT                   /locus_tag="Intca_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(449567..450952)
FT                   /locus_tag="Intca_0417"
FT   CDS_pept        complement(449567..450952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0417"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   kfl:Kfla_5626 extracellular solute-binding protein family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: Sugar ABC transporter substrate-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46965"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6S861"
FT                   /protein_id="ADU46965.1"
FT                   /translation="MNDNQGVTMSRRVLRTIALAGLTGALGLTACTPGSGGTAGPSEPA
FT                   PNASVTTDATSLGEVTLTVWDQEVRGGQEKQMSTLVSQFQQKYPNIKVDRVSRSFDDLT
FT                   KTLRLALSGKDAPDVVQANNTRSQMGAFVTAGELVNLDPWAKAYGWDQRYPASVRAVSS
FT                   YSPDGKTFGSGSLFGLPQVGEVVGIYYSRSKLESLGLQPPTTWAELDAALAAAKDKGEV
FT                   PLVLGNLEKWPAGHVFGVVQGRYVPADQIRALGFGQPGGDWTSPENVKAAQTLVDWVDR
FT                   GYFNSGFNGQDYDPAWQSFTKGEGVFLIAGSWLQADLSAAMKDDVGFMLPPPSEAGGTA
FT                   VTTGGTGLPFAITDKAVNKDAAAAYINFITSPEAMKVLAENGNLPVVETSQQAAPDALG
FT                   KDVFAAFDAVSRADGLVPYLDWATPTMGDTLGATLQDLLAKKLSPADALARLQEDYSEF
FT                   TSK"
FT   sig_peptide     complement(450809..450952)
FT                   /locus_tag="Intca_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(450949..452151)
FT                   /locus_tag="Intca_0418"
FT   CDS_pept        complement(450949..452151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0418"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611: IPR002173; KEGG: art:Arth_2897
FT                   ribokinase-like domain-containing protein; PFAM: PfkB
FT                   domain protein; SPTR: Putative carbohydrate kinase; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46966"
FT                   /db_xref="GOA:E6S862"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6S862"
FT                   /protein_id="ADU46966.1"
FT                   /translation="MDVRTGGSRTSDHVPPRPPRDRPHAARRAGQPGDTDLDVFMSGTV
FT                   FLDIVFTGLEHRPAGGEEVWSTGMGSAPGGIANLAVAASRLGLRTGLAAAFGDDAYGDF
FT                   CWSTLAEQEGVDLSRSRRFPRWHTPVTVSMADATDRGMVTHGHPPPVDLGEMIGEPPRS
FT                   AAAIVDLGPGGGASGPAGTATWVERAHRQGTLVFADLGFDPTGAWDRGVLDRLLHCHAF
FT                   MPNAVEAMAYTRTTTPQEALYAIADLVPLAIVTNGAQGALALDAGTGEEVAVPALRTHA
FT                   LDPTGAGDVFGAALVVGTLGGWPLLERISFASLCAALAVQHFGGSLAAPGWGDIADWWR
FT                   DLRAVAGATAYEQSLLRRFAFLDDVIPIGPIATTRRAEATLAHLSDLPGPPAGTPPGAS
FT                   L"
FT   gene            452311..453660
FT                   /locus_tag="Intca_0419"
FT   CDS_pept        452311..453660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0419"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="COGs: COG1486
FT                   Alpha-galactosidase/6-phospho-beta-glucosidase family 4 of
FT                   glycosyl hydrolase; InterPro IPR001088: IPR019802; KEGG:
FT                   sgr:SGR_1058 putative 6-phospho-beta-glucosidase; PFAM:
FT                   glycoside hydrolase family 4; SPTR: Putative
FT                   6-phospho-beta-glucosidase; PFAM: Family 4 glycosyl
FT                   hydrolase; Family 4 glycosyl hydrolase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46967"
FT                   /db_xref="GOA:E6S863"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S863"
FT                   /protein_id="ADU46967.1"
FT                   /translation="MKLAILGGGGFRTPLVYGALLGDRSERRITEVWLHDVDEDRLDTI
FT                   TAVLHSMAGAVDHPPRVRTGTDLDAALEGADFVFFAVRTGGLAGRTADERVALELGLLG
FT                   QETVGPGGISYGLRTVPVALHVAHRVAAVAPQAWVINFTNPAGLVTEAMSAVLGHRVVG
FT                   ICDSPIAMARKAVRLLGLEGSEARLDYVGLNHLGWLRAVTVGGEDRLPELLGDEARLAR
FT                   MEEGRLFGTEWLRSLGAIPNEYLYYYYFTREAVAQALAAEQTRGEYLVAQQAAFYARVR
FT                   RSPTDPVGAPFAEWERVRLDRNATYMREARAEGEERDEEDAQGGGYEGVALALMAAIAR
FT                   DEPAELILNVRNGSTVPGLPADAVVEVPCRVDHNGPAPHRAAALEGHQLGLVQQVKAVD
FT                   RLVIEAAVTGDAAVAVKAFALHPLVDSVTVARELLAGYRARVPEVGRLFR"
FT   gene            453823..456300
FT                   /locus_tag="Intca_0420"
FT   CDS_pept        453823..456300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0420"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="COGs: COG4409 Neuraminidase (sialidase); InterPro
FT                   IPR000421: IPR017909: IPR012680; KEGG: sgr:SGR_6429
FT                   putative neuramidase; PFAM: coagulation factor 5/8 type
FT                   domain protein; Laminin G sub domain 2; SPTR: Sialidase;
FT                   PFAM: F5/8 type C domain; BNR/Asp-box repeat;
FT                   NPCBM-associated, NEW3 domain of alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46968"
FT                   /db_xref="GOA:E6S864"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:E6S864"
FT                   /protein_id="ADU46968.1"
FT                   /translation="MHTRRAALAGLALTVSIPLTVPLSVPVAMAGAAAATAADQTGITR
FT                   TDLDHTGDGYPVYRIPALTKTTDGTLVAAYDGRPSYGDVPNNIALVVRRSTDDGSTWED
FT                   RQVVRYEAGKPGFGDPSLVTDRVTGRIWLFHAASVNQGYFGSTTGTDDADPNVLHADVS
FT                   WSDDDGLTWQHRRLTSEVKDPQWGGLFAASGEGIQIRRGPHQGRLVQQYAIRYQGGNWA
FT                   ASLISDDHGETWRFGDLLGPGMDENKVVELSDGRLMLNSRAPGGYRKVAYSSDGGETWS
FT                   GLHADDELVDPQNNGSIIRYDADAAPSSPDAAKLLFSNTATQSGRRNLTIRQSCDNGET
FT                   WPIRKVVEPGAAEYSTLTPLGDQQFGLLYERGGYQHISFARFGGDWLDGVCAPLTSRTV
FT                   TAGSPGGTAEVEVKVTSQETGAIDGGRVALDLPSGFTAPEVPVAKLSRGATATVRIPVR
FT                   MPEGAVTNAYPYTARFLSDKGSSQSGGSIVVKGGNVVLSDSTERSYDGATITDLTDRVD
FT                   AVKDLTGGAVTVRFSTTARPAVGTLLSLADPISAVRDVIVSLNGGRPYVEVRTATSTYP
FT                   IRLQSSVDVADGKVHELIAASNAGVTSLILDDAVIAQVDGQGFFADVTALTRPHTLNPS
FT                   GKPNLTLGMNRGHFSVNGGPAAPNSRWGFVGTIHSVEVSDDLRTGEELVPAAGLSIASV
FT                   SSEETAGEDGRAANAVDGNPATIWHSKWTGTAAEYPHQITVDLGQAQPLTALRYLRRAV
FT                   GTNGDIADHVVSVSDDNVSWTQVATGTFAATKGEEEVRFAPQTARYVRLEALSAVNGLQ
FT                   FAAAAELRPVRTS"
FT   sig_peptide     453823..453918
FT                   /locus_tag="Intca_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(456490..457497)
FT                   /locus_tag="Intca_0421"
FT   CDS_pept        complement(456490..457497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0421"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR006132: IPR006131: IPR002292: IPR006130; KEGG:
FT                   sma:SAV_2319 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; SPTR: Ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46969"
FT                   /db_xref="GOA:E6S865"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E6S865"
FT                   /protein_id="ADU46969.1"
FT                   /translation="MTVASLFGRNVLKESDLTPDEFRALLDLAADLKAAKRERREQRRL
FT                   AGLNIALLFEKTSTRTRCAFEVAAADQGASTTYLDPAGSQMGHKESIKDTARVLGRYYD
FT                   GIEYRGAGHDVVETLGAWAGVPVWNGLTDDWHPTQSLCDALTMREHAAKPDSEIAFAYV
FT                   GDARFNMGNSLLVMGAMLGMDVRIAAPRSLWPSEAVVAQAKSYAAESGSRVTLTEDVAE
FT                   GIAGVDFVHTDVWVSMGEAKDVWAERIRLLTPYQVNAELLQLTGNRDVRFMHCLPAFHD
FT                   LETKVGRDVHAEFGRKELEVTDDVFESEASIVFDQAENRMHTIKALLVATLARP"
FT   gene            complement(457570..457657)
FT                   /locus_tag="Intca_R0011"
FT   tRNA            complement(457570..457657)
FT                   /locus_tag="Intca_R0011"
FT                   /product="tRNA-Ser"
FT   gene            457936..459246
FT                   /locus_tag="Intca_0422"
FT   CDS_pept        457936..459246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0422"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701: IPR001958; KEGG: nca:Noca_3966
FT                   major facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46970"
FT                   /db_xref="GOA:E6S866"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S866"
FT                   /protein_id="ADU46970.1"
FT                   /translation="MSTHSTARPTLSSFWQDLPRDGKLLISTVVFQSIGTGLVLPFMVV
FT                   YLNEVRGIALETVGLLLALQAGVGIAVVTPVGALIDRVGPRRVYASSLVALILADILLA
FT                   RATTVNQASVALLLLGYGFGVVWPASSALIGNLIPSELRQRYFGVNFTLLNLGIGIGGI
FT                   IGGRFVDVTRPDTFVAVYLLDALSYIPGLVILLGPLRHARDRVERAADAASVRVSYRAL
FT                   LRDPDLRALLSLVAVAALVSYPQLNAGLPAYARAEGQISTQGLGYAFAVNTLVIVLLQL
FT                   FVLQRIEGKRRTRVAVVMAGTWAVAWSLLGATSIVPGTIVATVLLAACTGIFGLGETML
FT                   QPTTAAMVNDLAPDHLRGRYNALSSLMFSIAFVVGPVIASFLIGHDLGGGYIAFLVGGC
FT                   ALLVIMALAAERRLPAHVNGLRPAPGGSVTAPAPISG"
FT   gene            459275..459367
FT                   /locus_tag="Intca_R0012"
FT   ncRNA           459275..459367
FT                   /locus_tag="Intca_R0012"
FT                   /product="RNA component of signal recognition particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            459511..460722
FT                   /locus_tag="Intca_0423"
FT   CDS_pept        459511..460722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0423"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG0738 Fucose permease; InterPro IPR011701;
FT                   KEGG: sen:SACE_4438 putative DeoR-type transcriptional
FT                   regulator; PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   Putative integral membrane protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46971"
FT                   /db_xref="GOA:E6S867"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6S867"
FT                   /protein_id="ADU46971.1"
FT                   /translation="MSAIAPSVPVVRTARNAVFTAFAINGAAFAAFASRVPDLKHQLVL
FT                   TAGELGLTLLALSLGAVIGLPLSGWFVHRFGAGRSTLGAAAVQSLGLVGVGLAVTAMES
FT                   RALAMAALVLVGVGTGVFDVSMNLEGAAVERLLGRSIMPHFHAAFSAGTVVSALVGAGL
FT                   SFLHVSVLAHLVGVAVLLLAVTPWFLRAFLPREVEDDPTDETRDPAAGGRGRAGLGAAW
FT                   REPRTLLIGVVVFAAAFTEGTANDWIGVALSDGYDLPRWAGVLGFAVFLTAMTAGRVLG
FT                   TRLLDARGRLPVLRVLFVAAVAGSLLVVFGGPVLAFVGAAVWGVGASLGFPVGMSAAAD
FT                   EPRRAAARMSVVSTIGYTAFIAGPPLLGFLGDHVGVLRSLLVVGAMAGLAVAALPAVRE
FT                   ADRR"
FT   sig_peptide     459511..459579
FT                   /locus_tag="Intca_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(460738..461967)
FT                   /locus_tag="Intca_0424"
FT   CDS_pept        complement(460738..461967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0424"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG4552 acetyltransferase involved in
FT                   intracellular survival and related acetyltransferase;
FT                   InterPro IPR000182; KEGG: kfl:Kfla_4406 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46972"
FT                   /db_xref="GOA:E6S868"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:E6S868"
FT                   /protein_id="ADU46972.1"
FT                   /translation="MSDLRVRDVTEADLPAALQIRTRSFGPLRGSEQSWWDGLAAEVLP
FT                   GRMLAVVDESDTMLATGRALPFEQVWGGRHLRMGGVAGVYVEPSARGRGVGTLLGRALV
FT                   ERMVELGDVVSCLFPTAPELYRAVGYEVGGVQPRCSYAAHDVRAVRSRGGGLRPRPAGP
FT                   EDAALVHSLLRAHQERHALSGPMLPTVEKWREYLADDGLINYVLDEEDGRGFVSYSLAD
FT                   EVLTVEEIAAESAEATAALWAVVGSGSSAAPTVRAHLDPRDPARLLLGAVPELDVREHL
FT                   WMLRVLDLPGAMAARGFAPHVTASVDVVVDDPLVPAGSGRWTLTVESGAGRADPADPTD
FT                   GTGGAGASPAAYGLEGEPARLGPRGLSALWCGWTMSRLRVAGLVRGGRPETDRALDAVF
FT                   AGSPHLTEYF"
FT   gene            complement(461964..463658)
FT                   /locus_tag="Intca_0425"
FT   CDS_pept        complement(461964..463658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0425"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="COGs: COG0514 Superfamily II DNA helicase;
FT                   InterProIPR014021: IPR001650: IPR011545: IPR014001: IPR
FT                   018329; KEGG: sro:Sros_5632 ATP-dependent DNA helicase
FT                   RecQ; PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: helicase domain protein; DEAD-like
FT                   helicase; SPTR: ATP-dependent DNA helicase RecQ; TIGRFAM:
FT                   ATP-dependent DNA helicase, RecQ family; PFAM: Helicase
FT                   conserved C-terminal domain; DEAD/DEAH box helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46973"
FT                   /db_xref="GOA:E6S869"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="UniProtKB/TrEMBL:E6S869"
FT                   /protein_id="ADU46973.1"
FT                   /translation="MTSGLARDRRRIRTTARRVFGHDLLLPGQEEGTLALLQGHDVLLV
FT                   APTGSGKSLTYQLAGTLLGGCTVVVSPLLALQQDQIDGLAEGARGLSAARLSSAESDAE
FT                   RTAVLERAAAGDLDFLFLSPEQLANPAVAEALTAVAPTLWAVDEAHCVSVWGHDFRPDY
FT                   FRLGELIARIGPARVVAMTATAARPVRRDIVARLGLAEPRTIVTGFERDNIALEVVRCV
FT                   TGDAQFETVLDTVDDAAASAGSGIVYCRTRKGAERYAAALTERGHRPVTYHAGLSQRRR
FT                   DEAHRAFMDGSADVIVATSAFGMGIDKPDVRFVVHADVPESPDTYYQEVGRAGRDGEPA
FT                   RAVLVYRPEDLSLGRFFAAPVPERADLAAVLDAVGDAGSTEPSAVTEHSPFGARKTGRL
FT                   LNLLELARQTGAGDQRRELVDAAIDRARARRSLDESRVDMMRGYAETARCRAEFLLAYF
FT                   GEQALEPCGHCDCCRAGLDGPPCPVGDQGGYSMGDRVRHGEFGEGMVTDVHGDRITVIF
FT                   EEVGCAPCPRRSSTNTTSSSRRDTPPWAGPQPKRNRASPRGALESGG"
FT   gene            complement(463676..465085)
FT                   /locus_tag="Intca_0426"
FT   CDS_pept        complement(463676..465085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6360 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46974"
FT                   /db_xref="GOA:E6S870"
FT                   /db_xref="UniProtKB/TrEMBL:E6S870"
FT                   /protein_id="ADU46974.1"
FT                   /translation="MTGPVDVSALEVDDEDWLGQADWIVGGQAARAARKQGIYAGYVLV
FT                   LFAAVYGFPLVQALFRTSDRIWLREQLASAGGVLVLAGSVAAILGAGLWAGRFRGPVVP
FT                   PLPWIDLVVTAPVDRALAVRRWWRFAVVATVFVGAVVGLVLGSGLAFAEVTGVAAIAVA
FT                   TLAGAALGVLGARLWLWGQVRSWPGADRGVSVLWRVPDALRALHAESLRAHSANTSTLA
FT                   GSALTGNLRTARLAFARPVRRGRTARLRAGRPIRVLVRRDVLGLRRQPATVLAGAGLST
FT                   IGALVLVWGLTQPAAPAVALGVGMLPLYLGFGAWAEGLRLQADNVGTPSLIGVAAVPEA
FT                   VAHLVVPAVLTSGVLGGAAGLAALTTGLPPVALGVLAAVVPSVALLCGGHLLAAFRGAP
FT                   PTVSGPQGVVLWYLRPGLVVVVLGGVTSYALRGGHGVGSVTATLAICLVVAWGLATVRR
FT                   LTHLHRAFGAT"
FT   gene            complement(465082..465738)
FT                   /locus_tag="Intca_0427"
FT   CDS_pept        complement(465082..465738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0427"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593; KEGG:
FT                   cms:CMS_2559 putative ABC transporter ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   ATP-binding protein of sugar ABC transporter; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46975"
FT                   /db_xref="GOA:E6S871"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S871"
FT                   /protein_id="ADU46975.1"
FT                   /translation="MSRVAVLTGEVRAVAVSKSIATTTLLEPTDLTADPGEGVVLRGPN
FT                   GSGKTTLLRIIGGLLEPTTGTASVGGRPADERDPAVRAAVAALIGTPTTYRDLTLVDHL
FT                   VLVDSTWGHDPGTSDQRGLQLLESLGIGDLDDRFPHELSSGQEQLFRLALTLTRPSRVL
FT                   LLDEPEQRLDTTKRQVVAGLLRARVDEGATLVMACHDPELTAALATRVVDLAPAR"
FT   gene            466097..468436
FT                   /locus_tag="Intca_0428"
FT   CDS_pept        466097..468436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0428"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR003959: IPR003593: IPR012763; KEGG:
FT                   rsa:RSal33209_3356 DNA polymerase III subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; SPTR: DNA polymerase III subunits gamma and tau;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); DNA polymerase III subunits gamma and tau domain
FT                   III; TIGRFAM: DNA polymerase III, subunit gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46976"
FT                   /db_xref="GOA:E6S872"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S872"
FT                   /protein_id="ADU46976.1"
FT                   /translation="MATALYRRYRPESFAEVIGQEHVTEPLMQALRTGRVGHAYLFSGP
FT                   RGCGKTTSARILARCLNCEEGPTPTPCGVCQSCVALARGGPGSVDVIEIDAASHGGVDD
FT                   ARDLRERASYGPAQSRFKIYIIDEAHMVTPQGFNALLKIVEEPPEHVKFVFATTEPEKV
FT                   IGTIRSRTHHYPFRLVPPAKLSSYMESLLEQEHVAVAPGVLSFVVRAGGGSVRDSLSVL
FT                   DQLIAGSGPEGLTYESAVSLLGFTDGELLDATVDALAAADGAATFRQIDRVIESGLDPR
FT                   RFIEDLLERLRDLIIVAAVPEAGQVLRGVPEDQLERMRVQQAAFGPGALSRAADIANSG
FT                   LTEMTGATAPRMQLELICARILLPASSGEAGYGARLDRLERRLEVGGVPSQASSPDHQP
FT                   SRMPLGSPPPVPPVPAPQPPPSSVQDVSPPPPALRASSVQDVPPPPASSVQDVPAPGAG
FT                   RAPSRGPQSSTGGQQEPPPAPADPAPASAPASAGGMDTDAIRRAWPDVLGRIFSRRRIT
FT                   WTFVSQHAQVIGYDGTTLTLGIATAGLTNTFRSGNHAEIVRQALIDELGVDAVVDGIHA
FT                   SEVAPSEVAGSGHPTPATTATDAPGPITPGSHEGGPSGSPGPQRPSGPGGGGGAAGDLR
FT                   NAGGSAGAARAGASTLGVSPGAPPTTGRSLETNAGWGSVSAAAPDWATRPAGAAQTDLP
FT                   TAPPSGSARVATTGATSGASAVRESLGAARRGAHQPEGEPRAPQRPVTDDAAVSDDDED
FT                   IEISGDVGRAVIEKVLGGRVISELDD"
FT   sig_peptide     466097..466141
FT                   /locus_tag="Intca_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            468506..469252
FT                   /locus_tag="Intca_0429"
FT   CDS_pept        468506..469252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0429"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: nca:Noca_2043 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Putative
FT                   methyltransferase, S-Adenosyl-L-methionine (SAM)-MTase
FT                   protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46977"
FT                   /db_xref="GOA:E6S873"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S873"
FT                   /protein_id="ADU46977.1"
FT                   /translation="MAADAYGRFMGRYSEPLAEQFVDWVGVRPGERALDVGSGPGALAA
FT                   RLVDRIGLTAVSAIDPSLPFVSALRARLPGLDVQSAGAERLPFPDDFFDHALAQLVVHF
FT                   MQDPATGIAEMARVTRPGGSVSSCVWDFAGGRAPLSTFWQAVTDLDPGARTEEDLPGAR
FT                   AGDLEGLLEAAGLTEIRSGELVVVVAQRSFEEWWEPYTFGVGPAGEHVASLTDNARDAL
FT                   RDHCRGLLQDAPFDVEATAWAASGTV"
FT   gene            469299..469973
FT                   /locus_tag="Intca_0430"
FT   CDS_pept        469299..469973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0430"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123: IPR000276; KEGG:
FT                   nca:Noca_1494 phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR:
FT                   1-acylglycerol-3-phosphate O-acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46978"
FT                   /db_xref="GOA:E6S874"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E6S874"
FT                   /protein_id="ADU46978.1"
FT                   /translation="MFYSLGRGVLVPLSHALYRPTIEGRENVPRSGGVILASNHLSFID
FT                   SFAIPLVSPRRVRFLAKEEYWTGEGLKGLLQKGFFTAVGMVPVNRHSPTAAQESLDTGL
FT                   EVLRAGDAFGIYPEGTRSRDGRLYRGRTGVAWLALNAQVPVVPVGLIGTQNIQPVGASF
FT                   PKLAKVTVRFGPPIGVERYQGIPAGRARRQLTDDVMAAIAALTGQEQVDAYNEVPVGAA
FT                   DE"
FT   sig_peptide     469299..469346
FT                   /locus_tag="Intca_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            470037..470636
FT                   /locus_tag="Intca_0431"
FT   CDS_pept        470037..470636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0431"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro IPR015967: IPR006171: IPR000093:
FT                   IPR006154; KEGG: bcv:Bcav_0549 recombination protein RecR;
FT                   PFAM: TOPRIM domain-containing protein; Zinc finger
FT                   C4-type, RecR; SMART: Toprim sub domain-containing protein;
FT                   SPTR: Recombination protein RecR; TIGRFAM: recombination
FT                   protein RecR; PFAM: Toprim domain; RecR protein; TIGRFAM:
FT                   recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46979"
FT                   /db_xref="GOA:E6S875"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E6S875"
FT                   /protein_id="ADU46979.1"
FT                   /translation="MYEGAVQDLIDELGRLPGVGPKGAQRIAFHLLQADSDDVSRLVTA
FT                   LTEVKARVRFCEVCGNVAEAERCRICADSRRDHTAICVVEEPKDIVAIERTREFRGTYH
FT                   VLGGAISPIDGIGPDDLRVRELMQRLASGEVQEVIIATDPNLEGEATATYLSRLLRDVG
FT                   LTVTRLASGLPVGGDLEYADEVTLGRAFEGRRRVDA"
FT   gene            470718..471368
FT                   /locus_tag="Intca_0432"
FT   CDS_pept        470718..471368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_0464 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46980"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:E6S876"
FT                   /protein_id="ADU46980.1"
FT                   /translation="MTTDDTTRDDAVPDDVATDSDSDTTAIEDGSAAADELSSLADLTA
FT                   QEASAFLTAITEVASGNSPDTAIPLLTLALSQILVAGARLGAIQDVVLLERYEADPGPD
FT                   DDPDPLRDGLANLLTGIDDYVYVVDPVTSPERVGGSITNDLADIALALTHGLKHYANGR
FT                   TVEALWWWQFSYLSSWGDRALASMRALHSILSHLRLDADDERVAEAEFDALHP"
FT   gene            471576..472334
FT                   /locus_tag="Intca_0433"
FT   CDS_pept        471576..472334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0433"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: bcv:Bcav_3642
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46981"
FT                   /db_xref="GOA:E6S877"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6S877"
FT                   /protein_id="ADU46981.1"
FT                   /translation="MPSASVSRHQPEPLGPLGPLESPDPPAATDLSRVSEVSGLIVRAR
FT                   RRGDLSQRDLATAVGVSQSTIAALETGDREPALALFLRILAEGGLRLAVVDSSGKEVRP
FT                   VASDTVRDNAGRRLPAHLDADPPDRKPWYRLREERDRVRAGAAQDPRLLPDHPTHAELE
FT                   ARRRQQLYGARPPAPGSDRDAGYLECECETECWLGTACPPQCLCQCETTPRLDPCQGRI
FT                   RVSHDSDAIGGSPTSAIDCELRTPGSREPQ"
FT   gene            472331..473602
FT                   /locus_tag="Intca_0434"
FT   CDS_pept        472331..473602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0434"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COGs: COG0527 Aspartokinase; InterProIPR001048:
FT                   IPR002912: IPR018042: IPR005260: IPR 001341; KEGG:
FT                   tcu:Tcur_4886 aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; SPTR: Aspartokinase; TIGRFAM: aspartate
FT                   kinase; aspartate kinase, monofunctional class; PFAM: Amino
FT                   acid kinase family; ACT domain; TIGRFAM: aspartate kinase,
FT                   monofunctional class; aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46982"
FT                   /db_xref="GOA:E6S878"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:E6S878"
FT                   /protein_id="ADU46982.1"
FT                   /translation="MSIVVQKYGGSSVADAESIKRVARRIVETKRQGHQVCVVVSAMGD
FT                   STDELLDLAEQVSAAPPARELDMLLTAGERISMALVAMAIAQLGEEARSFTGSQAGVIT
FT                   DDAHGAARIIDVTPGRIQSALDAGHIAIVAGFQGVSQTTKDITTLGRGGSDTTAVALAA
FT                   ALDADVCEIYTDVDGVFTADPRILPSARKLDVLSMEEMLDLAANGSKILHLRCVEYARR
FT                   YGIPIHVRSSWSQRQGTWIKANPYEGEDAVEAPIIAGIAHDRSEGKITIVGVPDRVGIA
FT                   AKIFGAVADAGINIDMIVQNVSAAETAKTDISFTLPKGDGPKALSVLQAIKGDVEYADL
FT                   RFDDTIGKIALVGAGMKSHPGVSAKFFGALAEAGINIEMISTSEIRVSAVTRAEQLDDA
FT                   VRAVHTAFGLDSTEDAIVYGGTGR"
FT   gene            473687..473953
FT                   /locus_tag="Intca_0435"
FT   CDS_pept        473687..473953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0435"
FT                   /product="sterile alpha domain containing 1"
FT                   /note="KEGG: hsa:90378 sterile alpha motif domain
FT                   containing 1; SPTR: Atherin"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46983"
FT                   /db_xref="UniProtKB/TrEMBL:E6S879"
FT                   /protein_id="ADU46983.1"
FT                   /translation="MTPDEPKLLPDGRVFPPVTPDPPPPPGQEEIIVPDLDFGSAAEAA
FT                   VGSAAEAAKEPGDEPRDEAPHTAPDTAPDPQDGSEPPAGEPTA"
FT   gene            474001..474420
FT                   /locus_tag="Intca_0436"
FT   CDS_pept        474001..474420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_2455 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46984"
FT                   /db_xref="UniProtKB/TrEMBL:E6S880"
FT                   /protein_id="ADU46984.1"
FT                   /translation="MPLSRVAGLVVLAPLVLGTAGCGSPEAATATSAASRFVRLASDDV
FT                   AAACDLLAPATRSKVTEDGGGDCAAGLRSADLPAGSATGPDVDPEIAGHTAMVTTGGQT
FT                   LFLALFDDGWKVIAAGCTRTSADLATPYDCAVRGE"
FT   sig_peptide     474001..474099
FT                   /locus_tag="Intca_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            474502..475191
FT                   /locus_tag="Intca_0437"
FT   CDS_pept        474502..475191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_6555 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46985"
FT                   /db_xref="GOA:E6S881"
FT                   /db_xref="UniProtKB/TrEMBL:E6S881"
FT                   /protein_id="ADU46985.1"
FT                   /translation="MTGQRQREFLKDNALSLAFLLLLLLSLAGQALSGVAEYNDQARTA
FT                   QLQEISVWRYVTSSRFAVDTAENWQSEYLQFAVFIFLTIWLVQRGSSESKKPGEEGRES
FT                   DKKQLLGRYVRDDSPPWARAGGWRTALYSHSLLVIMTTIFVLSWTAQAIAGRVASNEER
FT                   MRELLEPQTLGQYVTSPDFWSRTFQNWQSEMLAIASMAILSIYLRERGSPESKPVGMPH
FT                   DETSADD"
FT   sig_peptide     474502..474609
FT                   /locus_tag="Intca_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(475256..478528)
FT                   /locus_tag="Intca_0438"
FT   CDS_pept        complement(475256..478528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0438"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467: IPR001789: IPR000014: IPR000700: IPR
FT                   005561: IPR013656: IPR003661: IPR003594: IPR013767:
FT                   IPR004358; KEGG: ami:Amir_3954 multi-sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-4 domain protein; response regulator receiver; PAS
FT                   fold domain protein; ANTAR domain protein; SMART: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SPTR:
FT                   Multi-sensor signal transduction histidine kinase; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; Response regulator receiver domain;
FT                   ANTAR domain; His Kinase A (phosphoacceptor) domain; PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46986"
FT                   /db_xref="GOA:E6S8L7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L7"
FT                   /protein_id="ADU46986.1"
FT                   /translation="MTAAPRVPGREIAPDHPGELGARFATIDWSHTPLGPISEWPTELR
FT                   GAVSICLTSRFPMLVWWGPQYVMIYNDGYRPMLGRLKHPAALGSAGKEVWPEIWATIGP
FT                   MLDRVMETGVATWSRDQKLILERNGYPEECYFTFSYSPITSEAGEVGGVFTAVTETTDH
FT                   VLSERRLGTLGVLARRLGEATDAEHVRRLAAEVLLSNPQDHPVVAMVDAAALPDDPRDL
FT                   DVPEELRADVLAAATQAATLQHQVHHDLPSPVHLHDSGLSVAGLHALPIALPGDEELSE
FT                   VLVVGRSSQRTWEPALATYLALCVTHLGTALSAIRTLDTERQRAETLEVLDAAKSSFFT
FT                   NVSHELRTPLTLIAGPVAEALGDPGLTPEQRERLDLVQRNTVRLTRMVDAMLDFGRMAA
FT                   NKLQPLPEPLDVALQTRTMADSFTQAFDRAGLDFVVDCDHAPRTAHLDRDMYERVVLNL
FT                   LSNALKYTPAGSVRLRLECSADGFAVSVADTGIGIRRRDLARIFERFEQLPRRGRARFQ
FT                   GGAGIGLAMVKQLTELMGGSVDVESTLGRGSTFTIRLPWGTPPVESAEPADGRSITPRN
FT                   ADAFLAEAEGWYEPYAAEPAPRTSRPPAVAGSPAGSVPDGAAARPRLLVAEDNRDMRTY
FT                   LRGALESDYDVEMVPDGTTALQRAVASRPDIVLADAMMPGLDGFALTRAIRMNAAVRDV
FT                   PVIILSARAAESDTTEGLTSGADDYVSKPFSVGDLKARLASNLERSRARLRDAAWRRAV
FT                   MESFQDALLITDAEGEVVEVNDAFTQLLGFSADDGPFSVPHPWWPAVQTPTGVAEVDAV
FT                   DVPPTDRANVEQLLAQALQGATITGRECRLVTKDHRDVWVRLSTREVESVGGQPNYVVM
FT                   SLQDVTREHAARARRQAAAALSAEFGRAEDLEQVLEAAVTGFADLFDGDSTVRALAGPE
FT                   EHVFTAAGPVRRADLDDTLWELLTAIEPEVPAPSDRVPGLLISPQNHPSSECRVWVQFR
FT                   RPRRVATDERIVGDLLGQAFALAVDRVVAATAFADRESHLSRAIESHRMIGQAIGILIE
FT                   RHRVTPAEAFTRLKQASQARNIKLREIASRVIETGAEPDEAD"
FT   gene            complement(478648..479211)
FT                   /locus_tag="Intca_0439"
FT   CDS_pept        complement(478648..479211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_3999 hemerythrin HHE cation
FT                   binding domain-containing protein; SPTR: Hemerythrin HHE
FT                   cation binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46987"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L8"
FT                   /protein_id="ADU46987.1"
FT                   /translation="MSSLHSLLSVLQRQHAHIGMLLSRVGDSSGTARHGAVADLLQYVA
FT                   LHESAEQTFMHPVALKSVGDVAAVQGRVVEEREIEAVITRLEGLDPASMDFMIYFGLLE
FT                   EAMSGHTRAEENVEARVLGAVPDHELEHMARGIGLVDVWMDPAARLIGGSVASMPLRPG
FT                   PRDVGFSELHRRSLEAFDAVFRLR"
FT   gene            479306..480343
FT                   /locus_tag="Intca_0440"
FT   CDS_pept        479306..480343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0440"
FT                   /product="DNA topoisomerase IB"
FT                   /note="COGs: COG3569 Topoisomerase IB; InterPro IPR001631;
FT                   KEGG: amd:AMED_4291 DNA topoisomerase IB; SPTR: Putative
FT                   uncharacterized protein; PFAM: Eukaryotic DNA topoisomerase
FT                   I, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46988"
FT                   /db_xref="GOA:E6S8L9"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8L9"
FT                   /protein_id="ADU46988.1"
FT                   /translation="MRLRRSDPGKPGLRRVRRGKGFVVVDTEGRRVDADTMARVKALVI
FT                   PPAWEDVWVCPWPNGHIQAVGTDAAGRRQYLYHPAWHETRDRVKHERVVTLARRLPEAR
FT                   AEISRRLRRPGLGRERVGAVALRLLDAGLFRTGGEEYETENGSHGVATLRKDHVSVRGD
FT                   VVSFCFPAKSGVEREAEVRDPALAKAVASLKRSRGPSERLLQYRTEGGAWCELTSTEIN
FT                   RDFKELVGDDYTVKDLRTWAGTVLAAAAFAERADHGPPASERVRKKVEREVMTLVSEHL
FT                   GNTPAVARRSYVDSRVPDEYAAGRTIARALARASAADRRRLRRGDLAEVTDRAALERAL
FT                   VRLLS"
FT   gene            480708..482312
FT                   /locus_tag="Intca_0441"
FT   CDS_pept        480708..482312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0441"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG1233 Phytoene dehydrogenase and related
FT                   protein; InterPro IPR002937: IPR006076; KEGG: nml:Namu_3691
FT                   FAD dependent oxidoreductase; PFAM: amine oxidase; FAD
FT                   dependent oxidoreductase; SPTR: FAD dependent
FT                   oxidoreductase; PFAM: Flavin containing amine
FT                   oxidoreductase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46989"
FT                   /db_xref="GOA:E6S8M0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M0"
FT                   /protein_id="ADU46989.1"
FT                   /translation="MVGSGPNGLVAANLLADAGWRVVVLEAQDEPGGAVKSAEDVRPGW
FT                   VHDTFSSFYPLAAASPTIQGLGLERHGLEWVRAPASVGHPLPGGRWAVVHPRPEDTAAA
FT                   LDRLHPGDGEAWLRVCALWDRVGADLVGALLTPFPPLRAGLRLGAKVPRLGGLAFAREL
FT                   LLPVRRLGDEWFGGEGPKLLLAGNAAHADIAMDAPGSGLLGLLLAMLGQSHGFPVPRGG
FT                   AGRLTAALVARFESLGGEIRTGVRVNQVEVRSGRAVGVRLGDGEHIRATRAVVADVSAP
FT                   ALFGGLVPWSQLPDRLRRRMRSFEWDAGTVKIDWALSGPVPWASAPELTPGTVHLADSV
FT                   GDLAIAGAQLASGRVPDRGLVILGQMAATDPTRAPRGSESLWAYLHVPQRRSRADQAHP
FT                   EPVDEPRAELVAHQVEERIEEYAPGFRDRVLDRRVLGPAELERRNENLVGGAVNGGTAA
FT                   IHQQLFWRPVPGWGRPETPVQGLYLASASAHPGGGVHGACGSNAARAALAHDRLERLTA
FT                   RRIRPVGPGPRLGRRQP"
FT   sig_peptide     480708..480788
FT                   /locus_tag="Intca_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            482309..482779
FT                   /locus_tag="Intca_0442"
FT   CDS_pept        482309..482779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_2441 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Polyketide cyclase
FT                   / dehydrase and lipid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46990"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M1"
FT                   /protein_id="ADU46990.1"
FT                   /translation="MSRTTRLMSCSPDDVFEILADGWSFASWVVGAARIREVDATWPQS
FT                   GSRIHHSVGLWPALIDDTTSVLHLDRPHALELKVRAWPTGEGKVRLECVPEEGGTRVIM
FT                   TEDATKGPATLVPRLVRDPVLDARNTEALRRLAYLAERKAAESRPAKRVEKS"
FT   gene            482862..483326
FT                   /locus_tag="Intca_0443"
FT   CDS_pept        482862..483326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0443"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: nda:Ndas_5558 hemerythrin
FT                   HHE cation binding domain protein; PFAM: Hemerythrin HHE
FT                   cation binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding domain protein; PFAM: Hemerythrin HHE cation
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46991"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M2"
FT                   /protein_id="ADU46991.1"
FT                   /translation="MSGVITLIKEDHQKLESVFKKLEKAEPQEIPGLLRQVQELLVPHS
FT                   KAEEKVVYPAIRSTVPDESSDIEDGLEEHHHVEETLEQLLASDPEAPGVDGLIAAMIGE
FT                   VRHHVEEEEEQILPAFGDAASNQQLSDLGEQFTAAKEEELRALKAGSAGA"
FT   gene            483538..483810
FT                   /locus_tag="Intca_0444"
FT   CDS_pept        483538..483810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3839 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46992"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M3"
FT                   /protein_id="ADU46992.1"
FT                   /translation="MPRRRDPGPSVKDKKLYESLRDEGASKEKAARIANAAAKTSRSAV
FT                   GRKGGSSGDYEDWTKDRLLKRAREIGIEGRSKMDKGELVKALRNH"
FT   gene            483822..483920
FT                   /locus_tag="Intca_0445"
FT   CDS_pept        483822..483920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46993"
FT                   /db_xref="GOA:E6S8M4"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M4"
FT                   /protein_id="ADU46993.1"
FT                   /translation="MLMTEGLALGAGWLVFLGLVGFLAHMLLGRRR"
FT   gene            483917..484354
FT                   /locus_tag="Intca_0446"
FT   CDS_pept        483917..484354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_1877 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46994"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M5"
FT                   /protein_id="ADU46994.1"
FT                   /translation="MRAARWPLAACLVLAGCVAPAADTGAFEHNALGALESAVSTARVA
FT                   AVALDARARDRVTFAYANTVVTEAEDAIDPIVASFGVVDPPDRSVDPLRREVLDHLGET
FT                   GDLLAEARIAVRRGDVRAMTDLAAGLRRVADGMDQQAEELS"
FT   sig_peptide     483917..483994
FT                   /locus_tag="Intca_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            484351..485580
FT                   /locus_tag="Intca_0447"
FT   CDS_pept        484351..485580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0447"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; KEGG: nca:Noca_1876 natural resistance-associated
FT                   macrophage protein; SPTR: Natural resistance-associated
FT                   macrophage protein; PFAM: Natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46995"
FT                   /db_xref="GOA:E6S8M6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M6"
FT                   /protein_id="ADU46995.1"
FT                   /translation="MKKLFAIALGILTAIGGFVDIGDLVANGLVGARFGMSLAWVVVVG
FT                   IVGICVFAEMSGRVAAVSGRATFDLIRERLGPRVGLLNLAASMAVTLLTYTAEIGGVAL
FT                   ALELATSVNPYLWIPVVGAAVWLVLWRVRFSLLENAFGLAGLALIVFAVALWQLGPDWS
FT                   ALWESASRPALPEGESRAVYFYYAIALFGAAMTPYEVFFFSSGGVEEGWTEKDLGVMRA
FT                   NVFIGFPLGGLLSLAIAATAAVTFLPQGIQVDSLSQIGLPVGLALGKLGLAFLLLGFFA
FT                   ATFGAACETGLSVGYSISQYFGWQWGKFVEPLRAARFHTVVLLSTIIGVGVLLTTVDPI
FT                   MLTEYSIVFSAVALPLTYFPILVVANDRTYMGNHTNGRLANTLGTIYLFIVGVAAVAAI
FT                   PLMVLTRAGQ"
FT   sig_peptide     484351..484428
FT                   /locus_tag="Intca_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            485582..486397
FT                   /locus_tag="Intca_0448"
FT   CDS_pept        485582..486397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_3278 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46996"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M7"
FT                   /protein_id="ADU46996.1"
FT                   /translation="MADDHLDLVLRVLDHQILGPDRELVGKVDDLELTPTESGLAVTGV
FT                   VVGPGGLSQRLPGRLGDWVAAVWRRLSSSSDPQPVVVPIVHVADLGSGVVLTGRAATAL
FT                   QRSFGLEQWLRQYVVSRIPGAKGGEEDRAPDSDESPSRDEPLVNLTDPPTRPPGPHTRW
FT                   LSQLLGAPVVDESGRHLGSLIELHCGIGNERWTVTHLQVTRSPLGTELGYHADPDQGPV
FT                   VLQRAFRRLQRHDLLIAVGEVREIDTEPPRVVVETRDDRRHPHHDAAAP"
FT   gene            486454..487875
FT                   /locus_tag="Intca_0449"
FT   CDS_pept        486454..487875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0449"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG0665 Glycine/D-amino acid oxidase
FT                   (deaminating); InterPro IPR017941: IPR006076; KEGG:
FT                   nda:Ndas_1353 FAD dependent oxidoreductase; PFAM: FAD
FT                   dependent oxidoreductase; Rieske [2Fe-2S] iron-sulphur
FT                   domain; SPTR: FAD dependent oxidoreductase; PFAM: Rieske
FT                   [2Fe-2S] domain; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46997"
FT                   /db_xref="GOA:E6S8M8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M8"
FT                   /protein_id="ADU46997.1"
FT                   /translation="MSTHEGTHGSVWLDDPGRRRQPASPLVGDAEADVVVVGAGITGLT
FT                   TALLAARDGNRVVVLEARRVGDGTTGYTTGKVTAQHSLIYAHLVEWAGADRARQYADAN
FT                   RAGIDLVAQLVEELRIDCSLTRADALVYTTSEDSHKIRAMEDEAVAARRLGLPASLVGE
FT                   SGLPFPITAGVSFTDQLHLHPRRYLDGLADAVVAAGGVIHEQTRVTGVTEERGHVVVEA
FT                   DGGKVTATSAVIATLLPFGLVGGYFARTRPTMSYGLAVRLRGAAPAAMTISVDDPTRST
FT                   RPWPDGGPGGLIVVGGGHEVGADVDTEGRYAELEAWARATFDVAELSHRWSAHDYTTPD
FT                   RVPYIGRPPLHRNVYVATGFGKWGLANGSAAGLAISHLIAGHDTPWLPIFDAGRIEGVR
FT                   SVPTLVGGNVKVAAELVTGELRREAPRCSHMGCRLRWNDAEETWDCHCHGSRFASDGQV
FT                   LAGPAVTPVDVGADG"
FT   gene            487885..489540
FT                   /locus_tag="Intca_0450"
FT   CDS_pept        487885..489540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0450"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro IPR006047:
FT                   IPR006589; KEGG: mrd:Mrad2831_0315 alpha amylase catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: Alpha amylase catalytic
FT                   region; PFAM: Alpha amylase, catalytic domain; TIGRFAM:
FT                   trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46998"
FT                   /db_xref="GOA:E6S8M9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8M9"
FT                   /protein_id="ADU46998.1"
FT                   /translation="MTARWYRSGVIYSLDVRLFQDSNGDGIGDLAGLTSRLDHLSRLGV
FT                   SILWLNPIHPTPFKDGGYDVADYYDVDPALGNLGDFAEFMAECDERGIRVMLDLVLNHT
FT                   SDEHPWFQAARSDPDSPYRDWYVWSEEEPPDRDQGMVFPGVQESTWSYDETAGAWYHHR
FT                   FYAFQPDLNVLNPQVRSEMKKIVTFWERLGVSGFRLDGAPFLIEKTTAEGGAGRDHGFL
FT                   VELRDRLSWLRGDAVFLAEAHVPNDQLLEFFGDADGAASRVQMLFAFRLNEALMLSLAR
FT                   QAAGAIEDALTGLPPLPRNAAWATFLRNHDEVDLSQLTGEERADVFAAFGPEPDHQLYE
FT                   RGIRRRLAPMLGGDEARLRLAYSLQFTMPGTPVLRYGDEIGMGENLDLPERDAIRTPMQ
FT                   WSGTENGGFSTARQDRLIRPVVDLPPFGFKEVNVTDQRLEPNSLLTWFERMLHTLRECE
FT                   EIGAGTHRIIGGPPPAVLVHVAEGPTGVVMFVHNLGDTPQHLELDDVPLGEQPPVEVFS
FT                   DHPYEGELDPTRLDVAPYGFRWLRLRRSHGPAPG"
FT   gene            complement(489630..492047)
FT                   /locus_tag="Intca_0451"
FT   CDS_pept        complement(489630..492047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0451"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="COGs: COG1501 Alpha-glucosidase family 31 of
FT                   glycosyl hydrolase; InterPro IPR000322; KEGG: bcv:Bcav_3837
FT                   alpha-glucosidase; PFAM: glycoside hydrolase family 31;
FT                   PRIAM: Alpha-glucosidase; SPTR: Alpha-glucosidase; PFAM:
FT                   Glycosyl hydrolases family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46999"
FT                   /db_xref="GOA:E6S8N0"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N0"
FT                   /protein_id="ADU46999.1"
FT                   /translation="MLQTDHFIRFEQVSSTERTAHGLVAQVHTEQLRIDLVREDVVRLK
FT                   ISRGGTFDEEPTHAVCVDPLAEPVRFELEEDDDRVRLVTSALVVSLWLDPFRVDVHRTD
FT                   GTPVVETAADEDGRYWAYATLNDTFTLRRRCGGADRIFGLGEKGGRNDRKGRDFTLWNN
FT                   DVLSEVGSQEFTSGKAPGDPRGDRTSTEFDPYYVSVPFFYHQLYPHGQMSGSFVDNGYR
FT                   GHYEFAPANEYRITFEGGQYTEYVFAGPHMPAIVRAYTDLTGRMSLPPIWALGYHQCRW
FT                   HKYDQAAVEALGQRHRDDDFPCDALWLDIDYMDGYRVFTWDTESFPDGPGMVKRLGEQG
FT                   FRVITIIDPGVKLEPGYWVFDQGLERDLFCRTEGGDVYIGQVWPGNTAFPDFATEEARA
FT                   WWGELNAAHVQSGLAGIWNDMNEPATGVISSKPMRFGHGEHPHERFHNQYALLMAMGTT
FT                   EGLLEAMPDRRTFILSRAGFAGIQRYAANWMGDNQSRWDHLWLSITMGCGFGVSGQPFV
FT                   GADIGGFQGNANAELLLRWMQYGALTPFCRNHSETGYIDQYAWAFGEVVHDLVRDAVRL
FT                   RYRLMPYIYAAFVRASETGEPVQRPLVLDFQYESAAADIDDEYLFGRDLLVAPVDEPGM
FT                   TARQVYLPAGGWYDWFTDEPHVGRSYVIAPTPMDRIPLYARAGSVVPMWPEAPPSTDGY
FT                   HPASIDLHLFVPLGEGRYESRLVEDDGLTFASRDGAHRTTTFTVTREGDEVTLLASVTG
FT                   GGYPELRRTAFRLVVHGATPSTVRHDGTEVSPTDGGFVLTDDGTDFRVELAV"
FT   gene            complement(492217..492735)
FT                   /locus_tag="Intca_0452"
FT   CDS_pept        complement(492217..492735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa23340 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47000"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N1"
FT                   /protein_id="ADU47000.1"
FT                   /translation="MRAGEGRQRHSSFSGRRQRAAAPAGYKENVDTIATFDEVVELARL
FT                   RAPLYVRHSAGPGPDAEHPALDIEAEVALPGLPASGLTPEPWWTRPDEDWVARRLCSCL
FT                   DHVEQRGPDSDERLWLLTGVVVGSGPSHEPLIGAVEALGWVGPEALETAAEVYRTRFHG
FT                   SGLSEPKPA"
FT   gene            complement(492784..496302)
FT                   /locus_tag="Intca_0453"
FT   CDS_pept        complement(492784..496302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0453"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterPro IPR003439:
FT                   IPR017940: IPR003593; KEGG: nca:Noca_2806 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter related; PFAM: ABC transporter
FT                   transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47001"
FT                   /db_xref="GOA:E6S8N2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N2"
FT                   /protein_id="ADU47001.1"
FT                   /translation="MTRVEQDEPQATELGARWDARPPTGRVPVDWRRVHRPLTVVCFSM
FT                   SLLGAVSASLGSMVAGRLAEHATSTLVLLLALCVVGGAVIDTVAKVIWAVVCDRAEGRL
FT                   RADLLDAAMAQPLSELSEQAVGEVLDRIDDDTWEVGQLMRWGVWQAVRTLLASGPLWVV
FT                   ASIAWWPAAILFPLTGLATYWVVRRLLPQVAERKVIEEAAWTDHAASTEEGIAARDDLR
FT                   TALGQAHVLRRNARMAARVHAALERVLQVEARITRRSGGLLHGALAAVAVVGAALVLAG
FT                   DLSTARLVTLFLVTTMFVGGVDMLARHLPDLQEGFGAVLRLRAMLASPAEPTGGRPLPE
FT                   GSLGVEFRGLEFSYDTGTFALRDVNLLVPAGHTCALVGRTGSGKSTLASLLSRAVEPPR
FT                   GTVLLGGVDVRDLDLQQLRAAVGVVTQRTEVLAGTLAENMTLFGDVPRARVEAAVAELG
FT                   LTEWVAGLSDGLDTMLGPGGTTLSAGEEQLVAFARLLVRDVRVVVLDEATARMDPVTEA
FT                   RVVRAADRLISGRTGILVAHRLSTTERAEQVAVLESGRVVQQGPRDRLAAAEGPFRRLL
FT                   EAAAHEVAVEEHHHDDASIGSVRRSTTPPPPPELAPSPGLARQVLHTVSIQPQWGLLGA
FT                   GFFLIASLTGAFGAVTGWVWGLVVTDLQSGRQPGWRLGALVVSLVMGPLVLSQAFRTYP
FT                   HWWVEVRLRVRAAVLAGQTAQRRLVRTPPGEVVARTMDADRLARYTDRWVDFVNGLIVA
FT                   SMTALIARTWLAGAVLLVVMVVSALASTLGRPVAGRSAAAASTARASFGRSLVSALESI
FT                   RTVKLAAATPQVHQHLRQVDGGRVDAAVREHRVQALLDGVPIVMVQCGVVAAWAGLLHG
FT                   TWPLAIALLVANAVSGFDWFGRVAGSVVTEAPGVRAWMRATSDLAGGGDLMDLPPGLDL
FT                   VHGTAAEPEPGPRDPLRTLTLHRLTAVHDDGTIGVQDVDLTVEAGELVLLLGQVGSGKS
FT                   SLLSALVGLTAHTGQVLWNGRPVGDAQVELRPARVSHIAQVPRVLSGTFTDNVALDHAR
FT                   RRVEPALATARMERDVAEAGGPDALVGHRGVRLSGGQVQRLALARALACEADLLLADDV
FT                   SSALDAATEIELWAALRSGGATVIGATSKAAALAQADRVVLLDAGRVVEVGPWRELSQR
FT                   WAHLAG"
FT   gene            complement(496435..498120)
FT                   /locus_tag="Intca_0454"
FT   CDS_pept        complement(496435..498120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0454"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro IPR006047:
FT                   IPR006589; KEGG: mgi:Mflv_3723 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: Alpha amylase,
FT                   catalytic region; PFAM: Alpha amylase, catalytic domain;
FT                   TIGRFAM: trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47002"
FT                   /db_xref="GOA:E6S8N3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N3"
FT                   /protein_id="ADU47002.1"
FT                   /translation="MRMSQTGDLWWKTAVLYCADVQTFYDSDSDGVGDLRGMTEQIEYL
FT                   ADLGITCLWLMPIYPTPSKDDGYDITDFYGVERRLGTHGDFVELVRTARAHGIRVILDF
FT                   VMNHTSDQHPWFRSARRSTDDPYRDYFVWSPTKPKTNPKDIVFPDQEDSLWELEPKTGE
FT                   YYLHHFYKHQPDLNVVNPAVQEEIARTIGFWLELGVSGFRVDAVPFLMTPDTVPADHHQ
FT                   VSFDPKRYLADVRKYVTRRVGDALLLGEVNLPYKDQKTYFGGADGDGLNMQFDFAAMQA
FT                   LYLALAREDARPIEGALRRRPALDVTSQWANFVRNHDELTLDQLTDEERQDVFDAFGPD
FT                   PGMQLFGRGLRRRLPSMLGGDGRRLRLVYSIMFSLPGTPVLFYGEEIGMAENLDVPGRL
FT                   SVRTPMQWGDDPSGGFSDAPPRKLTRPMPDGLYSAERVNVASQRHDHDSLWWFIRTLIR
FT                   LRRQYPQIGWSTVEVPRTKPRSVLAHLAREEDGWTMLALHNLAPESTLVDVSLGEVPPG
FT                   SVLVDLLGDRREHPVAADGSIELEVEGYGYRWLLLHRPGDRPPK"
FT   gene            498267..499253
FT                   /locus_tag="Intca_0455"
FT   CDS_pept        498267..499253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0455"
FT                   /product="F420-dependent oxidoreductase, G6PDH family"
FT                   /note="COGs: COG2141 Coenzyme F420-dependent N5
FT                   N10-methylene tetrahydromethanopterin reductase; InterPro
FT                   IPR019945; KEGG: mgi:Mflv_3722 putative dehydrogenase
FT                   protein; SPTR: Putative dehydrogenase protein; TIGRFAM:
FT                   F420-dependent oxidoreductase, G6PDH family; PFAM:
FT                   Luciferase-like monooxygenase; TIGRFAM: F420-dependent
FT                   oxidoreductase, G6PDH family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47003"
FT                   /db_xref="GOA:E6S8N4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR023907"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N4"
FT                   /protein_id="ADU47003.1"
FT                   /translation="MPTIGFHCSHEQIPPSQLLEDVRHAEAAGFTAAMCSDHLEPWSTD
FT                   QGQSGYAWSWLGAALNATRLPFGVVTAPGQRYHPAITAQAIGTLGEMFPGRFWAALGSG
FT                   EAVNEHVTGDGWPRKELRDQRLVECAEVIRRLLDGERVSHDGLVTVDRAKVWSRPSTPP
FT                   DLVAAAVSVETAGSAAAWADGLITVNQQEGGDRRAAEAYREHGGRGPARLQLHVSWAPS
FT                   EDEALDIAMQQWRSNVFGSPVAWDTDSVDAFDELGRHVTEDDVRRSVHVSADLESHAAR
FT                   IGQAFDDGFDAVMVHFVGTDQAPFIDAFAAAVLPQFTPAALTGRSTS"
FT   gene            499250..500158
FT                   /locus_tag="Intca_0456"
FT   CDS_pept        499250..500158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0456"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198: IPR020904: IPR002347;
FT                   KEGG: krh:KRH_14530 putative oxidoreductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: Putative
FT                   oxidoreductase; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47004"
FT                   /db_xref="GOA:E6S8N5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N5"
FT                   /protein_id="ADU47004.1"
FT                   /translation="MTSSIGERAASMVRSDDKGGFPPQQQDPPGLTQRMEPVPDHGEET
FT                   YVGHGRLEGLKALITGGDSGIGRAVAIAFAREGADVAINYLADEQADAEDTASWVRKAD
FT                   RTAVLVPGDLTERQTCDRVVAEAVEGLGGLDILVNNAGFHWDKGPRDGLEGLTDENIER
FT                   VMRTNLHAVLWLCRAALPHLGEGSSIINTTSIQAYDPSPALLDYAATKAALNNLTVNLA
FT                   QSLGPKGIRVNAVAPGPIWTPLQPATRDTEKIETFGSDTPLGRAGQPGEVAPAFVFLAS
FT                   PSDASYVSGTVVGVTGGGAVF"
FT   gene            500312..501436
FT                   /locus_tag="Intca_0457"
FT   CDS_pept        500312..501436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0457"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="COGs: COG2170 conserved hypothetical protein;
FT                   InterPro IPR006336: IPR011793; KEGG: sgr:SGR_459
FT                   carboxylate-amine ligase; PFAM: glutamate--cysteine ligase
FT                   GCS2; SPTR: Carboxylate-amine ligase SACT1DRAFT_0179; PFAM:
FT                   Glutamate-cysteine ligase family 2(GCS2); TIGRFAM:
FT                   uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47005"
FT                   /db_xref="GOA:E6S8N6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N6"
FT                   /protein_id="ADU47005.1"
FT                   /translation="MVRTVGVEEEMLLVDVRNGRPKSVSGQLVLRAAMQQQAVAGLGVH
FT                   GALEGEFQQQMIETHTAPVESLEDLEREVRHWRTEANSAARQVGSSVAALATSPLPVTP
FT                   IPVESTRYAWMHDRYQIVAKQHLTCGLHVHVAIGSDEEGVGVLDRIRVWLPVLLALSGN
FT                   SPFWNGEATGFASWRSQSFGRWPSNGPTEIFGSAAAYHRMVRDMTMSSVILDEGMVYFD
FT                   ARLSQHYPTVEIRVADVCLRASDAVLLAALCRGLVETAARDWARSVPVPDVPTTMVRLA
FT                   TWQAAREGTEGRLLDPFTSRPRLAWDVVDRLVEYVAPALSEAGDVELVKEGLERIRTRG
FT                   NGAQLQTRTMERTGQLIDVVAHAVRVTAGQEEDD"
FT   gene            501439..501690
FT                   /locus_tag="Intca_0458"
FT   CDS_pept        501439..501690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: der:Dere_GG19401 GG19401 gene product from
FT                   transcript GG19401-RA; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47006"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N7"
FT                   /protein_id="ADU47006.1"
FT                   /translation="MPAGPPRPLPARENLAGRPLDWPPDWTPGGAAGSGGSGGSGGPVP
FT                   VAVATAHPSSVLRSRQREVDRAQLVDDLGVARTLLDQG"
FT   sig_peptide     501439..501471
FT                   /locus_tag="Intca_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(501758..502129)
FT                   /locus_tag="Intca_0459"
FT   CDS_pept        complement(501758..502129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4746 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47007"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N8"
FT                   /protein_id="ADU47007.1"
FT                   /translation="MSVTSFQDLPLADRDREWDGDAAERRVREWAGAEDGPNEKYRDAH
FT                   VWYDAENKNNFTAYKLLIADVVDGRLKAVPRGVMAAAAVMQGSRGGVDLPDKDRDRVRS
FT                   HLAKYYAKWDDEPPWERDG"
FT   gene            502378..503226
FT                   /locus_tag="Intca_0460"
FT   CDS_pept        502378..503226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0460"
FT                   /product="RNA polymerase, sigma 28 subunit, Sig B/F/G
FT                   subfamily"
FT                   /note="COGs: COG1191 DNA-directed RNA polymerase
FT                   specialized sigma subunit; InterProIPR007627: IPR007624:
FT                   IPR007630: IPR000943: IPR 014322: IPR014284; KEGG:
FT                   nca:Noca_1393 sigma-70 region 4 domain-containing protein;
FT                   PFAM: sigma-70 region 2 domain protein; sigma-70 region 3
FT                   domain protein; sigma-70 region 4 domain protein; SPTR:
FT                   Sigma-70 region 4 domain protein; TIGRFAM: RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: Sigma-70, region 4;
FT                   Sigma-70 region 3; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47008"
FT                   /db_xref="GOA:E6S8N9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8N9"
FT                   /protein_id="ADU47008.1"
FT                   /translation="MSRMKSVSPTSTPTPISRRRGRFVERDRKAEELLLELSRTTNCAE
FT                   RERLTDEIVRLHLDLCDGVAARYAGRSIPTEDLVQVARLALLVAIKRYQPGPGSSFIGY
FT                   ALPTISGELKRHFRDHGWMVRPPRRLQELGPVLRLAREHWEQEHGTSPTTQDLAEEVGV
FT                   DPEQVSECLSAEHSYHPLSLDLTFGDDESRSLAESLAEPQDELESAADRVSLGTALSSL
FT                   SQKDRELLQMRFVDGMTQKEIGLALGVSQMQVSRLVRAVLDRLRTQMGVTVDDDRSATA
FT                   A"
FT   gene            503472..504518
FT                   /locus_tag="Intca_0461"
FT   CDS_pept        503472..504518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0461"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein; InterPro IPR018060: IPR000005;
FT                   KEGG: mkm:Mkms_4430 AraC family transcriptional regulator;
FT                   PFAM: helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; SPTR: AraC
FT                   family transcriptional regulator; PFAM: Bacterial
FT                   regulatory helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47009"
FT                   /db_xref="GOA:E6S8P0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P0"
FT                   /protein_id="ADU47009.1"
FT                   /translation="MSLSTSTTSSIHHVTLTATDPTAIERICAEELGVPLRLVGCPDGP
FT                   YVALAHTDAGRFSIDVLSGAGLSAELRPRDDAGPTGTDSTGSSESALFLTGERGQIRLD
FT                   AAGSVEQVGPGQSVCLARAAETSRVDWTGDAPRAHCVRLDLALIRDIAAATTGVTDVVF
FT                   TGSRPVSRAAELHWQETVTHVARTLSGVPGVPVTPLVVGEAARFLAAVALATFPNTTME
FT                   SVRRDTDAAPQPVTDLPITAETVRDAIAFIEERAHDDLTVADVAAAAGVTARAVQLAFR
FT                   RHLDTTPMAYLRRVRLARVHDELAHAEPDAGVTVTEVASKWGFSGSSRFTAYYRDAFGE
FT                   VPSQTLAS"
FT   gene            504793..505080
FT                   /locus_tag="Intca_0462"
FT   CDS_pept        504793..505080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0462"
FT                   /product="Domain of unknown function DUF1905"
FT                   /note="InterPro IPR015018; KEGG: bcv:Bcav_4116 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1905; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF1905)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47010"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P1"
FT                   /protein_id="ADU47010.1"
FT                   /translation="MDLEFSGEIVWWRGPAPYHFVRVPDGESAQIEAVKHLVTYGWGVI
FT                   PVTAVVGDTEFTTSLFPKDGAFLVPLKDGVRQAESLELGEVVSIRLILDV"
FT   gene            complement(505174..506286)
FT                   /locus_tag="Intca_0463"
FT   CDS_pept        complement(505174..506286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0463"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   cmi:CMM_0741 hypothetical protein; PFAM: protein of unknown
FT                   function UPF0118; SPTR: Putative integral membrane protein;
FT                   PFAM: Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47011"
FT                   /db_xref="GOA:E6S8P2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P2"
FT                   /protein_id="ADU47011.1"
FT                   /translation="MNPPQPPAAASGPWQDRLGRAAIRSLQVLAVLTLLVIVVWVGVQL
FT                   RLVVVPLLIAVLIAAAASPLVTWLNRRGLPRAPSVWVTLLAAFAVLGGLGWLVARAAQD
FT                   QWGELAAGAGEGVKELERFLAESPLGLDRREIEDLWAQAAEFLAGPQGQGVITGATLVV
FT                   EILAGIFLGLVLLYFLLKDGDRIWTFLRSELLPDRHSPRFDRVAAEAVSTLGGYVRGTA
FT                   LIALVEATLIGAAVAILGVPLALPIAIVVFIGAFIPLLGATAAGALAALIALVSNGVVA
FT                   ALVLVAVVIVVNQLEGDVLSPYVLGKAVSLHPLAVLLALSAGTISAGIIGAILAVPFAA
FT                   VAWSAITTWRSTEEPGRGSPQPPPPATPPQ"
FT   gene            complement(506308..507804)
FT                   /locus_tag="Intca_0464"
FT   CDS_pept        complement(506308..507804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0464"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="COGs: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase; InterPro IPR001736; KEGG:
FT                   amd:AMED_4111 hypothetical protein; PFAM: phospholipase
FT                   D/Transphosphatidylase; SPTR: Phospholipase D; PFAM:
FT                   Phospholipase D Active site motif"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47012"
FT                   /db_xref="GOA:E6S8P3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P3"
FT                   /protein_id="ADU47012.1"
FT                   /translation="MDLASRVARLDAKVGDALEAVLRRHHVRRLAGLGWSEALTATAGT
FT                   GWWAPGVPVRPGNRVDVLIDGAAALPAMEEAVRGAREYVHIAGWHSSPDFQLSRGPGSI
FT                   ALRDLLAEVAEHVPVRLLLWAGPPLPAFEPTRRMARAARDGFTQGSRVQCALDRRERTL
FT                   HCHHEKTVVVDGRVAFVGGIDLTALQGDRHDEDRHPPKHPLGWHDVAVRLEGPAVADVA
FT                   RHFVQRWNEVTSDHVAEPGSEQDPQPQRQPAATIGPQHAGDVEVQVLRTVPERIYTFAP
FT                   RGEFSILAAYLRALRAAERFIYLENQFLWSPEVVDILCERLASPPRDEFRVLLLLPARP
FT                   NNGADTTRGQLGRLLEADGGSHRLLATTISAHDGGTSAPVYVHAKVGIVDDRWLTVGSA
FT                   NLNEHSLFNDTEMNVLTCDPDLARRTRLRLWAEHTERPVEAIDGDPHTVIDAVWRPIAE
FT                   EQARRRRDGLPPTHRLRLLEHVSRRADRLQGPLRGLLVDG"
FT   gene            complement(508128..508532)
FT                   /locus_tag="Intca_0465"
FT   CDS_pept        complement(508128..508532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_2801 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47013"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P4"
FT                   /protein_id="ADU47013.1"
FT                   /translation="MHCAARGGHAPGRARRGRSLRPKPAKRSQLLGLASPNPSHVMLVP
FT                   RGRRWLERPRARILGAMATSSAHPRPRPASSPFKPHVEPEVEDFTVGDRVSHDSYGVGR
FT                   VVGIDASGATVDFSGRTIRVTTPFRKMTKL"
FT   gene            complement(508540..508743)
FT                   /pseudo
FT                   /locus_tag="Intca_0466"
FT   gene            complement(508820..508893)
FT                   /locus_tag="Intca_R0013"
FT   tRNA            complement(508820..508893)
FT                   /locus_tag="Intca_R0013"
FT                   /product="tRNA-Pro"
FT   gene            complement(509082..510014)
FT                   /locus_tag="Intca_0467"
FT   CDS_pept        complement(509082..510014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0467"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG1408 phosphohydrolase; InterPro IPR004843;
FT                   KEGG: kse:Ksed_25470 predicted phosphohydrolase; PFAM:
FT                   metallophosphoesterase; SPTR: Predicted phosphohydrolase;
FT                   PFAM: Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47014"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P5"
FT                   /protein_id="ADU47014.1"
FT                   /translation="MRALTKTVLGVGAAGAGVLAWASLVERNAFVLRRFELPVLPQGAE
FT                   PLRVLHLSDIHLVPRQGRKAQWLRHLESLDPDLIVNTGDNIAAHDAVPAVLDAFGSLLD
FT                   RPGVFVLGSNDYFAPKVKNPFRYLTRHHAKGTGDTSRLPTSDLVHGFTSRGWVDLTNRH
FT                   DKLVIRGRRFDFVGVDDPHLGYDRLDLVRRPPHPSAELTIGVTHAPYQRVLDAFVEDGA
FT                   GLVIAGHTHGGQVCVPGYGALVTNCDLDTSRVKGVSRWWPGAAHQPSSAAPDGAAWLEV
FT                   CAGLGTSPTAPVRLACRPEAVLLTLVARG"
FT   sig_peptide     complement(509949..510014)
FT                   /locus_tag="Intca_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            510091..510546
FT                   /locus_tag="Intca_0468"
FT   CDS_pept        510091..510546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0468"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="COGs: COG1610 conserved hypothetical protein;
FT                   InterPro IPR019004; KEGG: ami:Amir_0234 GatB/YqeY domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Yqey-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47015"
FT                   /db_xref="GOA:E6S8P6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P6"
FT                   /protein_id="ADU47015.1"
FT                   /translation="MSTLKDQLKADLTAAMRSRDQVRAGTIRMALTAVTTEEVAGTQHR
FT                   ELTDDDVLKVLAKEAKKRREAAEAYTTAGRTELADTEQAELAVLEGYLPKQLDESELEA
FT                   IVREAVAGSGASGMQQMGLAMKAANAAVAGRAEGGRVAAIVRRVLAG"
FT   gene            complement(510623..513058)
FT                   /locus_tag="Intca_0469"
FT   CDS_pept        complement(510623..513058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0469"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro IPR001264:
FT                   IPR001460; KEGG: kse:Ksed_25450 membrane carboxypeptidase
FT                   (penicillin-binding protein); PFAM: glycosyl transferase
FT                   family 51; penicillin-binding protein transpeptidase;
FT                   PRIAM: Peptidoglycan glycosyltransferase; SPTR: Putative
FT                   transpeptidase; PFAM: Penicillin binding protein
FT                   transpeptidase domain; Transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47016"
FT                   /db_xref="GOA:E6S8P7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P7"
FT                   /protein_id="ADU47016.1"
FT                   /translation="MSSSRTTSIGGVISLLGAFLAAALVLGLLAAGLFMPAVGATGAIA
FT                   RSGVDIFNELPGEFKTDPLSQQSRILAADGRVIATPAEQNRIIVPLKNVAPIMREAQVA
FT                   IEDHRFYDHGGFDLQGVVRAAIANLRTGQTTSGASSLTQQYVKISLQYSALNQGDKAAA
FT                   QAAVRKDYMRKLKELKYAITLEKKMTKDEILQGYLNLVYYGDQAYGVEAASRHYFSIPA
FT                   SKLSLSQAALLAGLTQNPGTTDPVNYPERALARRNVVLDRMHELGRISDKEWTDAKKRT
FT                   LKQDLKVSQPKSTCLASPYPYWCEFVINYVETMPELGKTVEARRRLLRTGGITVQTTLD
FT                   PKIQRIVQEEVTRKVPIGDPSGVGAAAYVTEPGTGRVLAFAQNTKYTVGKQSRGKTGVS
FT                   WALDKRWGGSGGFQFGSTAKAFSLLTAMESGMSTKASVKAKAAGDKPATYQPSEFAKGC
FT                   GPGTEWKVLNDTPFKGGSISLMKATALSTNTAFVALAQQLGGCKVWDTMNRLGLRTASG
FT                   QPVPKYAPAYILGAAEVSPQGVAHAYATLAADGKKCSMVVVTKVTQGSKTLAAPKTKCD
FT                   QVAKADYVRGTDKFLEYNMTNGSGVRNQLDGRESAGKTGTSDKNNESWFVGYTPNLVTS
FT                   VWVGTPDDGNKRLMKNVRVGGQFYPVMHGASIAAPIWKGIMNRALEGEPVLRFKEPSDK
FT                   VLNGELVDIPSVTGRTVADATKILEEAGFHRRRRRLDGVEHPQGPRRRHVTVRPGTPGQ
FT                   RRHDLHVRGPEPADEQGQARSEADHHDRAAPRPEADEATAPQAQLHGDRGPAQRLRAG"
FT   sig_peptide     complement(512924..513058)
FT                   /locus_tag="Intca_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            513327..513632
FT                   /locus_tag="Intca_0470"
FT   CDS_pept        513327..513632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0470"
FT                   /product="transcription factor WhiB"
FT                   /note="InterPro IPR003482; KEGG: ace:Acel_2003
FT                   transcription factor WhiB; PFAM: transcription factor WhiB;
FT                   SPTR: Transcription factor WhiB; PFAM: Transcription factor
FT                   WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47017"
FT                   /db_xref="GOA:E6S8P8"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P8"
FT                   /protein_id="ADU47017.1"
FT                   /translation="MSVATISTTWFDEWASQAACTGKDPDALFVRGKAQHEAKAVCKTC
FT                   PVLAQCLAEALDNRTEFGVWGGMTERERRALLRKRPDITSWKLALRAGMEAQAKSA"
FT   gene            complement(513714..514934)
FT                   /locus_tag="Intca_0471"
FT   CDS_pept        complement(513714..514934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0471"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; KEGG: tbi:Tbis_0197 anion-transporting
FT                   ATPase; SPTR: Putative ion-transporting ATPase; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47018"
FT                   /db_xref="GOA:E6S8P9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8P9"
FT                   /protein_id="ADU47018.1"
FT                   /translation="MTQTPHTPAHPPAHSPAHVRAAQAAPRLDIDAMIADRSVEVVVCC
FT                   GAGGVGKTTTAAALGLRAAEAGRRVVVLTIDPARRLAQALGLSELDNTPRPVVGFDASA
FT                   GGSLDAMMLDMKRTFDEVVLAHADPGKAEQILANPFYQAVSSSFAGTQEYMAMEKLGQL
FT                   KAAAGSSPDGWDLIIVDTPPSRSALDFLDAPNRLGSFLDGRFIRLLSAPAKASGRAGVK
FT                   VFGLGVQLVSSTMTKILGGQFLTDVQTFVAALDTMFGGFRERADETYRLLSRAGTSFLV
FT                   VAAPERDALREASYFVDRLQADRMPLSGLVVNRMGRVSAGALTPSRALSVAEALEDRGG
FT                   PKSAENAAGLLRLHAAVVTIAQRQRELAERFSRSHPDVPVRQIPALNRDVHDLESLREI
FT                   GNALAGP"
FT   sig_peptide     complement(514863..514934)
FT                   /locus_tag="Intca_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(514931..515974)
FT                   /locus_tag="Intca_0472"
FT   CDS_pept        complement(514931..515974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0472"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="COGs: COG0003 ATPase involved in chromosome
FT                   partitioning; KEGG: kfl:Kfla_0448 anion-transporting
FT                   ATPase; SPTR: Putative uncharacterized protein; PFAM:
FT                   Anion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47019"
FT                   /db_xref="GOA:E6S8Q0"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q0"
FT                   /protein_id="ADU47019.1"
FT                   /translation="MTDAHAIGAPEWQRARLHVVTGKGGTGKTTAASALALALASGSGT
FT                   PRRVLLAEVEGRQGISQTFDVPPLGTDETRIARTRSGGEILGLSVDAKAALLEYLQLFY
FT                   KLGRAGKLLEKFGAIDFATTIAPGVRDVLLIGRLYEANRRRRDGRHRGASPAAYDAIVM
FT                   DAPPTGRIGRFLSVNSEVADLARVGPIHSQAESITDLLESEQTLVHIVTLLEEMPVQET
FT                   LEAVRELRSKDLRVGLIFVNMVRDPLLDDVALEQARTGRLHKPSISSQLADAGVTATPE
FT                   LVDGLLEEAYDHAHRVDLETEQLALLEETGLPLVILPALPEGVDSGSVRELADILLDEL
FT                   EEVGLAR"
FT   sig_peptide     complement(515843..515974)
FT                   /locus_tag="Intca_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            516145..517083
FT                   /locus_tag="Intca_0473"
FT   CDS_pept        516145..517083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47020"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q1"
FT                   /protein_id="ADU47020.1"
FT                   /translation="MVDERVVLDKAQGVAADRGGVASRALLADVGVHRHHIRQEVLRGR
FT                   WALHGRHTVAVHTRVLTQEELFWRAVWEVSASAAVLDGVSALIAAGLRGFDEEAVHVSV
FT                   VHNRRSAKAPGVRVHHLPRRCSDEVIGAGVPRVRPALAAVRAAHWAVSDRQAALILAMT
FT                   VQQRLCSSAQLLAAVEVIRGRRRRALVKGVVLDVAGGAQSLGELDLAGMCRRHGLPEPD
FT                   RQVIREDPTGRRYLDCRWRCGLVAEIDGAGHRWGLAVTDDNLRLNEVVVGGEQVLRFDT
FT                   LGLRLREGQFMTQLRAGLHALGEPGVEAPSG"
FT   gene            complement(517120..517470)
FT                   /locus_tag="Intca_0474"
FT   CDS_pept        complement(517120..517470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0913 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Prolyl
FT                   oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47021"
FT                   /db_xref="GOA:E6S8Q2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q2"
FT                   /protein_id="ADU47021.1"
FT                   /translation="MAVAEYRRAGIPGGGWPGTFDDIRVRDFLGSPDSAPAAWRAADPV
FT                   RGLPPRVPVRLVHGELDHEVPVSVTDAYVREARRLGADVTLHVVPGAGHYSLSDPQSPA
FT                   WPHILVTLDGLV"
FT   gene            517757..517915
FT                   /locus_tag="Intca_0475"
FT   CDS_pept        517757..517915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_0333 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47022"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q3"
FT                   /protein_id="ADU47022.1"
FT                   /translation="MTTWEYLTAPLLIHNTKQILDNFGADGWELVQVVPGPDGTSLVAY
FT                   FKRPKGA"
FT   gene            517918..518388
FT                   /locus_tag="Intca_0476"
FT   CDS_pept        517918..518388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0476"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="COGs: COG0251 Putative translation initiation
FT                   inhibitor yjgF family; InterPro IPR006175; KEGG:
FT                   lxx:Lxx03610 translation initiation inhibitor; PFAM:
FT                   Endoribonuclease L-PSP; SPTR: Translation initiation
FT                   inhibitor; PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47023"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q4"
FT                   /protein_id="ADU47023.1"
FT                   /translation="MATVEERLAELGLTVPEVVPPVAAYVPALRNGNLVFTSGQLPMKD
FT                   GAMSATGKVGSADGPDADAAKELAALCALNAIAAIKSVVGDLEKVTQVVKVVGFVASDP
FT                   SFTGQPGVINGASELLGTAFGDRGKHARSAVGVAALPLDAAVEVEVVVAVAD"
FT   gene            518393..519226
FT                   /locus_tag="Intca_0477"
FT   CDS_pept        518393..519226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0477"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086; KEGG: kse:Ksed_25420 NUDIX
FT                   family protein; PFAM: NUDIX hydrolase; SPTR: NUDIX family
FT                   protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47024"
FT                   /db_xref="GOA:E6S8Q5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q5"
FT                   /protein_id="ADU47024.1"
FT                   /translation="MTPPRDFPLTQVRGLGDVALRWLRGERWDEAAPRQASTVMLVRDG
FT                   ERGTEVFMLKRVSQMAFAPSMHVFPGGGVDPRDGDAGLPWAGPSPAEWASRLRCTAAEA
FT                   QMFVAAAVREVFEEVGVLLAGPSPSSPLVDPHDGSWAGVRDRLVSRDLSLAGVLRERDL
FT                   VLRSDLIVAKAHWLTPAFEPRRFDTWFFAAVMPEHQVADGETSEAETAEWVVPQELLEA
FT                   YAAGLASLLPPTVMCVEEIADAPSAVAFVRHSDDLPLIMPVVVDTPEGPAMRIDV"
FT   gene            519354..520112
FT                   /locus_tag="Intca_0478"
FT   CDS_pept        519354..520112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0478"
FT                   /product="Zn-dependent hydrolase, glyoxylase"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: kse:Ksed_25410 Zn-dependent hydrolase,
FT                   glyoxylase; SPTR: Putative hydrolase; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47025"
FT                   /db_xref="GOA:E6S8Q6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q6"
FT                   /protein_id="ADU47025.1"
FT                   /translation="MTARAACVLCPNPSPMTLDGTNTWVVAEPGSTEAVVIDPGPLDEG
FT                   HLARVVSEVEQADRRVVLTLLTHGHLDHAESAERFHELTGAPVRAFGRGHDDVAPGEVI
FT                   RVGGLEIVAVATPGHTSDSYSYLLPAETALLTGDTILGRGTTVVAWPDGHLESYLESLH
FT                   RIEAMTRTGDVARILPGHGPYVADAAAATTFYLAHRAERLNQVRAALAAGDRTAREVVE
FT                   RVYADVPRNVWGAAEMSVQAQLEYLRRQPS"
FT   gene            complement(520222..520884)
FT                   /locus_tag="Intca_0479"
FT   CDS_pept        complement(520222..520884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0479"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR000595: IPR012318: IPR001808:
FT                   IPR002373; KEGG: nca:Noca_0339 cyclic nucleotide-binding;
FT                   PFAM: cyclic nucleotide-binding; regulatory protein Crp;
FT                   SMART: cyclic nucleotide-binding; regulatory protein Crp;
FT                   SPTR: Putative transcriptional regulator with cyclic
FT                   nucleotide-binding domain protein; PFAM: Bacterial
FT                   regulatory proteins, crp family; Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47026"
FT                   /db_xref="GOA:E6S8Q7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q7"
FT                   /protein_id="ADU47026.1"
FT                   /translation="MRRAPLFKALDDEAAAALQSQMTLSRMERGDVLFHEGDRGDTLYV
FT                   IAEGKVKLGRTSADGRENLVAILGPGEMFGELSLFDPGPRTMTATAVAETQLLGLGNDS
FT                   LTGLLTGRPEVAKSLLAALAQRLRRTNAHLADLVFTDVPGRVAKALIDLSERFGRHVEG
FT                   GLLVAHDLTQEELAQLVGASRETVNKALADFQSRGWLRLEARAVLLQDVERLRRRAK"
FT   gene            521062..521796
FT                   /locus_tag="Intca_0480"
FT   CDS_pept        521062..521796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0480"
FT                   /product="endonuclease III; DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="COGs: COG0177 EndoIII-related endonuclease;
FT                   InterProIPR003265: IPR003651: IPR004035: IPR004036: IPR
FT                   005759; KEGG: kfl:Kfla_0455 endonuclease III; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; PRIAM:
FT                   DNA-(apurinic or apyrimidinic site) lyase; SMART: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; SPTR: Putative
FT                   endonuclease III; TIGRFAM: endonuclease III; manually
FT                   curated; PFAM: HhH-GPD superfamily base excision DNA repair
FT                   protein; Iron-sulfur binding domain of endonuclease III;
FT                   Helix-hairpin-helix motif; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47027"
FT                   /db_xref="GOA:E6S8Q8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q8"
FT                   /protein_id="ADU47027.1"
FT                   /translation="MSSVSARAVVTADESPVARTRRARAMYRALHDRYPYAHCELDFTT
FT                   PLELLVATILSAQTTDVGVNKVTPIVFAKYRTAADYAAADRTELETIIQPTGFFRAKSD
FT                   SLIKLGQALVERFDGEVPGRLKDLVTLPGVGRKTANVVLGNAFNVPGITVDTHFGRLVR
FT                   RFGWTAEEDPVKVEHAVGALFLRRDWTMLSHVVIFHGRRTCHAKKPACGACPVARWCPS
FT                   YGIGETDPERAARLLKFELAPK"
FT   sig_peptide     521062..521136
FT                   /locus_tag="Intca_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            521793..522539
FT                   /locus_tag="Intca_0481"
FT   CDS_pept        521793..522539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0481"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086; KEGG: sgr:SGR_3331 hypothetical
FT                   protein; PFAM: NUDIX hydrolase; SPTR: NUDIX hydrolase;
FT                   PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47028"
FT                   /db_xref="GOA:E6S8Q9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8Q9"
FT                   /protein_id="ADU47028.1"
FT                   /translation="MTAPLTPAPRGARVVHSGATGAIPPGPAGLPRPRWLDEVAERVPS
FT                   VDAHWFSRFQPPEEGGRESAVLMLFGPPPAGEPSEGEHVILIERSHTMRTQPAQIAFPG
FT                   GSRDPEDEDSVHTALREAEEETGIVPAGVDVVDVLPSLYLPPANFVVAPVLGWWAEPAP
FT                   LTVRDPAEVQEVLSVPISHLIHPETRFTVTHPSGYVGPAFELDHLLLWGFTAGLLSRVL
FT                   DLAGLAVEWDEARRRPLPEIYLRDRR"
FT   gene            522536..523738
FT                   /locus_tag="Intca_0482"
FT   CDS_pept        522536..523738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0482"
FT                   /product="Colicin V production protein"
FT                   /note="COGs: COG0265 Trypsin-like serine protease typically
FT                   periplasmic contain C-terminal PDZ domain; InterPro
FT                   IPR003825: IPR001254: IPR001940; KEGG: kra:Krad_0420
FT                   peptidase S1 and S6 chymotrypsin/Hap; PFAM: Colicin V
FT                   production protein; peptidase S1 and S6 chymotrypsin/Hap;
FT                   SPTR: Peptidase S1 and S6 chymotrypsin/Hap; PFAM: Trypsin;
FT                   Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47029"
FT                   /db_xref="GOA:E6S8R0"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R0"
FT                   /protein_id="ADU47029.1"
FT                   /translation="MSGGLILDIALALILVAYGISGYRNGLVASVFSLLGFFAGAVIAI
FT                   WALPVMLADLDAVANDSRLRVLVLIVGVVVIGWVGQVLGSLLGAQVRRRMGQPGVRQVD
FT                   SVLGAAVVVVAASLIIWFLGGSLRTAGNPSVARSISESRVLRAVNSVVPEDAGQIFAGF
FT                   RGFLSSQGFPQVFGDLVPEPITPVEAPDPRIGDSGAITRAASSVVKVTTASESCGRGQE
FT                   GTGWVLSPNRIVTNAHVVAGADRLQVTSREQTVAGRVVLFDPDRDLAVISTEGLDAPAL
FT                   ELGSDLPRGAAAAVPGFPLDGPYTVVAARVRQVLDARGRDIYGGDPVVREIYSLYTRVQ
FT                   PGNSGGPLLDANGRVAGVIFAKSLDDDNTGYALTLDEAMPVLDAALQADRAVGTGACIP
FT                   G"
FT   sig_peptide     522536..522592
FT                   /locus_tag="Intca_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(523890..524282)
FT                   /locus_tag="Intca_0483"
FT   CDS_pept        complement(523890..524282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0483"
FT                   /product="UspA domain-containing protein"
FT                   /note="InterPro IPR006016: IPR006015; KEGG: aau:AAur_0701
FT                   universal stress family domain-containing protein; PFAM:
FT                   UspA domain-containing protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Universal stress protein
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47030"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R1"
FT                   /protein_id="ADU47030.1"
FT                   /translation="MTIVVGYIPTTQGEAAITAAITEARAHGDSLLVVNMSRDDKLVDA
FT                   HRAASTELSRLDAELTESGVPHEVRRVEHGTDPADAILRIIGEVDARMLVIGLRPRTPV
FT                   GKLLLGSTAQRLLLDADCPVLAVKAH"
FT   gene            complement(524279..525802)
FT                   /locus_tag="Intca_0484"
FT   CDS_pept        complement(524279..525802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0484"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: ach:Achl_0594 protein of unknown
FT                   function DUF112 transmembrane; PFAM: protein of unknown
FT                   function DUF112 transmembrane; SPTR: Putative integral
FT                   membrane protein; PFAM: Tripartite tricarboxylate
FT                   transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47031"
FT                   /db_xref="GOA:E6S8R2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R2"
FT                   /protein_id="ADU47031.1"
FT                   /translation="MDNLNHLIEGFGHVLTPMNLLFALIGVTVGTAVGVLPGIGPAMTV
FT                   ALLLPITYGLEPTQALIMFAGIFYGGMYGGSTTSILLNTPGESASVVTALEGNKMAKSG
FT                   RAAQALATAAIGSFVAGTIGTALLVLVMPQVVAFAINLGSPELLAILLVAFVGASAVLG
FT                   SSRVRGFAALLVGLTIGVVGIDFVTGQQRLTFGQPMLADGIDVVVVAVGIFAVGEALWV
FT                   AAHLRRKAATVIPVGRPWMGREDWARSWKPWLRGTALGFPFGAIPAGGAEVPTFLSYLA
FT                   ERRLAKHPEEFGHGAIEGVAGPEAANNASAAGTLVPLLAIGLPTNATAAIMLSALQGWG
FT                   FEPGPFLIEKQPVLVWTLVASLFVGNTMLLLLNLPLAPTWAKLLQIPRPYLYAGILFFA
FT                   TMGAYAVNAQPFDLFLLLALGLVGFALRRFGLPVLPLIIGVILGPLAEKHGRRSLQLSG
FT                   GDISGLIGGPVAWVCYAIIAGVILWPLIGRLLPGKRPSDRDHTPTEVSA"
FT   sig_peptide     complement(525713..525802)
FT                   /locus_tag="Intca_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(525802..526329)
FT                   /locus_tag="Intca_0485"
FT   CDS_pept        complement(525802..526329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0485"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: mjl:Mjls_3247 integral membrane protein; SPTR:
FT                   Putative integral membrane protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctB family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47032"
FT                   /db_xref="GOA:E6S8R3"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R3"
FT                   /protein_id="ADU47032.1"
FT                   /translation="MSDPQVDTTGAAAKPREDRAQYGVCAALAGLGVLLLVDAANIRHV
FT                   TSSNDPLGPRPVPIVLGVLLLITAVSYAIDVWRGGVGQAEGGEDVDLGSRADWKTVGLL
FT                   IVVFGASALLIQPLGWVITGSLLFWGCAYALGNEHHVRGLAFGIALALTTFYGFAIGLG
FT                   VNLPAGILKGIL"
FT   sig_peptide     complement(526213..526329)
FT                   /locus_tag="Intca_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(526332..527372)
FT                   /locus_tag="Intca_0486"
FT   CDS_pept        complement(526332..527372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0486"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: art:Arth_1395 hypothetical
FT                   protein; SPTR: Putative secreted protein; PFAM: Tripartite
FT                   tricarboxylate transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47033"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R4"
FT                   /protein_id="ADU47033.1"
FT                   /translation="MRAHPTARKASLLTAGIATAALTLSACGATADDTNTNAGASGATG
FT                   GSAAPASGLQIMVPNSPGGGYDTTARTVAKVMETEQITGTVQVFNLPGAGGTVGLQRTV
FT                   NEKGNGKLAMQMGLGVVGAAYTQKSQATLNDTTPIAKLIEEAGAIVVSKDSPYKDITSL
FT                   IDAWKKDPSKVNVGGGSSPGGPDHLLPMRLAKAVGIEPKSVSFISYDGGGELLPAIIGN
FT                   KIAFGASGFGEFLDQVKAGQVKVLAVTSEERIEALPDVPTLKESGVDFLFTNWRGIVAP
FT                   PEISDADQAVWVDALTKMHDSQAWKDEMKKRGWTDAFVTGDEFGTFLKEQDTAVAEILT
FT                   SLGLVS"
FT   sig_peptide     complement(527280..527372)
FT                   /locus_tag="Intca_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            527454..529136
FT                   /locus_tag="Intca_0487"
FT   CDS_pept        527454..529136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0487"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="COGs: COG3290 Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism; InterPro IPR005467:
FT                   IPR013767: IPR003594: IPR004358; KEGG: sco:SCO1137 two
FT                   component system histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; SPTR: Putative
FT                   two component system histidine kinase; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47034"
FT                   /db_xref="GOA:E6S8R5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R5"
FT                   /protein_id="ADU47034.1"
FT                   /translation="MKVEFFVVMRRLRRFTLAGQLLVAQVAILLTVLIAVAFVSLAQSE
FT                   ATFTRTEGRRLFAIAEQLASHPLVRQELAPPQVINALPTVVQGTITQYGLALVSVADSR
FT                   GVVKDSSDPTTEERQLPLGSERVRQGASWTGPMELAGRRMLAAQTPVLYSPGTNVPAAG
FT                   GLSPGTRLGTVMVAVEMPSVIDRLQGASSYLLTYLGLALALGGLGSWLLARRLKRQTLG
FT                   LEPHEITGLAESREAMLFGLAEGVVALDTSNRITLVNNVAQRLLDLPERAVGMSVSDLA
FT                   IGPRLREVLLGQTGDEPDQVVLRRGRVLVMNRMEVAKDGRPLGSVTTLRDRTELAALER
FT                   EIGSFRSSTELLRAQAHEFANQLHTISGLIQLGEYDEVVRFVDSVSQHRAQLDLTVARR
FT                   IQDTAVSALVMAKAAQATERRVELRVSDDTALGRMSSVDSADLAAVVGNLVDNAVDAAA
FT                   TAGGDERWVELAIHQDASSPRSTVEVMVSDSGPGVAPELVTEVFTHGFTTKAAEAGERG
FT                   IGLALTRLICQRRGGEVEVERTEEGATFIARLTVDSPALQESR"
FT   sig_peptide     527454..527585
FT                   /locus_tag="Intca_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            529133..529807
FT                   /locus_tag="Intca_0488"
FT   CDS_pept        529133..529807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0488"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="COGs: COG4565 Response regulator of citrate/malate
FT                   metabolism; InterPro IPR001789; KEGG: sco:SCO1136 two
FT                   component system response regulator; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Putative two component system response regulator;
FT                   PFAM: IclR helix-turn-helix domain; Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47035"
FT                   /db_xref="GOA:E6S8R6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R6"
FT                   /protein_id="ADU47035.1"
FT                   /translation="MISVLVVDDDFMVARIHRGFVSQTEGFEVVGTASSGGEALELVGR
FT                   LKPDLVLLDLYLPDIFGLDVVTRLRAAGETCDVLVITAAKEADSVRAAVRHGVVGYLLK
FT                   PFSRADLEQRLMSYAAERARAVDAGELTQQEIDAAFASGAGGRPAAVSLPKGLSVETAE
FT                   AVLRALREADDTMSATECAEAVGISRVSARRYLEHFVATGAAEVSLRYGATGRPERRYR
FT                   PR"
FT   gene            529986..531221
FT                   /locus_tag="Intca_0489"
FT   CDS_pept        529986..531221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0489"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR010259: IPR000209; KEGG: sro:Sros_3301 putative
FT                   serine protease; PFAM: peptidase S8 and S53 subtilisin
FT                   kexin sedolisin; proteinase inhibitor I9 subtilisin
FT                   propeptide; SPTR: Putative serine protease; PFAM: Peptidase
FT                   inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47036"
FT                   /db_xref="GOA:E6S8R7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R7"
FT                   /protein_id="ADU47036.1"
FT                   /translation="MRRTTLGSVAAAGLLLGGLAVAPTSAQAVNTSAEAGVIPGSYIVV
FT                   LADSASPRAVAAEHARTQGATVDHLYQYSIKGYAAHMSATAAARVARDSRVVSVVPDRE
FT                   MSIDAQTLPTGINRIDGELSSARAGDGAGSVNVDVAVIDTGVDLDHPDLNVVGGTNCST
FT                   GRSYDDGNGHGTHVAGTIGAKDDANGVVGVAPGARIWAVRVLNNQGSGSWSSIICGVDW
FT                   VTARAGTIEVANMSLGGSGSEPAGSGCSTGDALHDAICRSVGAGVTYAVAAGNSAVDSK
FT                   GAVPAAYDEVITVSALADFDGQPGGLGAATCRSDVDDTFANFSNYGADVDIIAPGVCIN
FT                   STWKGGGYNTISGTSMASPHVAGAAALYKSTHPTASPSAVQTALVNAGNLNWNNVDDKD
FT                   KIKEPLLNVAGF"
FT   sig_peptide     529986..530069
FT                   /locus_tag="Intca_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(531280..532050)
FT                   /locus_tag="Intca_0490"
FT   CDS_pept        complement(531280..532050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0490"
FT                   /product="beta-lactamase related protein"
FT                   /note="KEGG: lxx:Lxx01020 beta-lactamase related protein;
FT                   SPTR: Beta-lactamase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47037"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R8"
FT                   /protein_id="ADU47037.1"
FT                   /translation="MPLSSPHAHVPLRTGAVGTLLLLLAAARRVADGAVDGGMLLRRTP
FT                   EDVAGGSGIWRTLAVEALPLVDVAALVGAVRDNLATNVLLRHVGLSGVADSTASMGLMR
FT                   TGLHDRVRAARGAADPESASSGTALELCWLAERLMRGSAMGGSADRLVRGWLSANVDQS
FT                   MVGAAFVERFGVDPLAHHASLGGELAYWNTTGTEPGVRADIGAATWAGRTVAWTAIANW
FT                   APELDDKLGAEVLAGMRSVGDSVIDFLTRTGPSE"
FT   sig_peptide     complement(531958..532050)
FT                   /locus_tag="Intca_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(532122..533033)
FT                   /locus_tag="Intca_0491"
FT   CDS_pept        complement(532122..533033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0491"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000073:
FT                   IPR000639; KEGG: tbi:Tbis_0209 alpha/beta hydrolase fold
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Hydrolase;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47038"
FT                   /db_xref="GOA:E6S8R9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8R9"
FT                   /protein_id="ADU47038.1"
FT                   /translation="MPVDAAFVEIDGPWQHRHVAANGARFHVAELGDGPLVLMLHGYPQ
FT                   FWYTWRHQMVSLAEAGYRVAAMDLRGYGGSDKPPRGYDTYTATLDAASVIRALGEAEAT
FT                   IVGQGLGGWIAWAMPALRPDETTAVASLSMPHPRVMRRASWLNRKQRAASSWIVSLQRP
FT                   FGPERAMTRSHDYVGGLLRDWSAPGGDFPTPEDVARYGDAMMIPFVAHSAAEHYRWLGR
FT                   SQLRPDGPFFMRRIRHAIHVPVLELHGADDGCVLVSSIRGSEKYAAGDFRSVTIPRAGH
FT                   FLTEEAPDAVSAELLRWLKSVR"
FT   gene            complement(533055..533642)
FT                   /locus_tag="Intca_0492"
FT   CDS_pept        complement(533055..533642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0724 protein of unknown function
FT                   DUF1469; SPTR: Putative uncharacterized protein; manually
FT                   curated; PFAM: Protein of unknown function (DUF1469)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47039"
FT                   /db_xref="GOA:E6S8S0"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S0"
FT                   /protein_id="ADU47039.1"
FT                   /translation="MHRTVGWQEQAPRAQPITWRSEPMSTDPRQERTLGQLVAAATQDM
FT                   STLVRGEIALAKAEVSGQLKKAGKGGGLLAAAAVLGFYAVYFVFTTLVEVLDIWLPRWA
FT                   AWLIITVLMLLVAGILAMAGIRKMKTVEPTPKKAVAEAQQTVAALKAATANPGTMAAAP
FT                   RPEWDRPSTATLPSGTPVTAASDGTRSDTTNP"
FT   gene            complement(533799..534236)
FT                   /locus_tag="Intca_0493"
FT   CDS_pept        complement(533799..534236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0493"
FT                   /product="PEBP family protein"
FT                   /note="COGs: COG1881 Phospholipid-binding protein; InterPro
FT                   IPR008914: IPR005247; KEGG: drt:Dret_1202 PEBP family
FT                   protein; PFAM: PEBP family protein; SPTR: PEBP family
FT                   protein; PFAM: Phosphatidylethanolamine-binding protein;
FT                   TIGRFAM: Raf kinase inhibitor-like protein, YbhB/YbcL
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47040"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S1"
FT                   /protein_id="ADU47040.1"
FT                   /translation="MKLTSSTFAEGQEIPEKCGKRAQNVSPHLTWSDEPAGTRSFALTV
FT                   VDWHPVARGYVHWMVCDIRPTTTTFMEGAAARGLPEGTRQVRAYAGPFPPSGTHDYVFT
FT                   LHALDIAAPNIPPGATLDEFNAAVSSHTLATATLTGHFTRR"
FT   gene            complement(534534..535325)
FT                   /locus_tag="Intca_0494"
FT   CDS_pept        complement(534534..535325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0494"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451; KEGG: bcv:Bcav_1182
FT                   acetyltransferase, putative; SPTR: Acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47041"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S2"
FT                   /protein_id="ADU47041.1"
FT                   /translation="MHNIKANKLTIGKGTFIDPSAVICGADGGPADVVTIGDNCYIGER
FT                   VQIRCPEFSLGDYGKIHHDTNVHGYSPCLIGHNAWIGQFTIIDSIGGVTIGDNCGIGAH
FT                   SQLWSHIKYGDTLEGCRFLSEKPLRIGKDVWFVGHCIVSPITAEDRSVAMVGSVVTRDM
FT                   KENRVYAGTPAADITDKTGPAFSPVNVEEKFLKMEEYLKAYGGDRSDLRIARTVNDISD
FT                   VNSTWFVVESRTYTKRGTASEVEFMKFLLPERGKFTPISTL"
FT   gene            complement(535449..536603)
FT                   /locus_tag="Intca_0495"
FT   CDS_pept        complement(535449..536603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0495"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653: IPR012749; KEGG: rer:RER_24530
FT                   TDP-4-oxo-6-deoxy-D-glucose transaminase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; SPTR: Putative
FT                   aminotransferase; TIGRFAM: TDP-4-keto-6-deoxy-D-glucose
FT                   transaminase; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase
FT                   family; TIGRFAM: TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47042"
FT                   /db_xref="GOA:E6S8S3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S3"
FT                   /protein_id="ADU47042.1"
FT                   /translation="MLRGVRQISFSTPYRTGLEEPYIAEALKSSVWHGDGQFTKRASDF
FT                   LTELTGATSTLLTTSGTHALELAAVALGLGPGDEVIVPTFTFPSTATAIALRGATPVFV
FT                   DVLPETLNLDIDATAAALTDRTRAIFVVHYGGVAADLDRLTELAAANDVAIVEDNAHGL
FT                   GAYYDGQHLGTFGTFGAQSWHDTKNFTCGEGGALLINDASLLSRAEIIREKGTNRSQFL
FT                   RGQVDKYTWVDQGSSYLPSELQAAVLMAQFEHYSEIQGKRHAVWDRYATDLKAWAADHG
FT                   VSLMTVPERRQHPAHLYYLLLPTHEDQQAFIASLAAESIVAPFHYQPLHASPAGKALGR
FT                   TPFPCDVADDRAHRLVRLPLHANLTESDLDRVVSAISSFVPIHG"
FT   gene            536634..537056
FT                   /locus_tag="Intca_0496"
FT   CDS_pept        536634..537056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0496"
FT                   /product="GtrA family protein"
FT                   /note="InterPro IPR007267; KEGG: kfl:Kfla_0511 GtrA family
FT                   protein; PFAM: GtrA family protein; SPTR: GtrA family
FT                   protein; PFAM: GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47043"
FT                   /db_xref="GOA:E6S8S4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S4"
FT                   /protein_id="ADU47043.1"
FT                   /translation="MNRWLSSSKLSSTLRWTHQPARYLVVAGTTSLVYLGLVAGGLALG
FT                   LHYIAAILVAQVITISFAFPAYRHWVFAPGAEWTKDLARFVSVWSSGAVAGLVMTPLLV
FT                   ELAGWPPMLAQVVALVVVSVGSYLSHRFFTFRHVSP"
FT   gene            537112..538164
FT                   /locus_tag="Intca_0497"
FT   CDS_pept        537112..538164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0497"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: kfl:Kfla_0510
FT                   glycosyl transferase family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase family 2; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47044"
FT                   /db_xref="GOA:E6S8S5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S5"
FT                   /protein_id="ADU47044.1"
FT                   /translation="MTGHTDDVKISVVVPCYRSRATLPELVRRLHESLPAIADAFEIIL
FT                   VVDGSPDDTYAVARGLERDNPATMRTVLLRRNYGQHNALLAGIMRAKHPITVTMDDDLQ
FT                   HRPEEVGTLVAALDDPLVDLAYGVAAEEEHGFTRSFASRIVKAGLAASGVPNAKDVSAF
FT                   RAFRTDLREGFEHVADPFASLDVLLSWTTNSVRRVTVQMDERETGRSNYSLRGLARHAM
FT                   NMVTGYGTAPLKLVTWMGLLTSVLGFALLVSVLVRYWVGAVEVAGFTTLASMLAILSGA
FT                   LMLSIGILGEYIGRLHFRSMQKPTFLVKEDSHRSSTWGEVKPVELHPARADVGPDEVAE
FT                   ALEERYRRQS"
FT   gene            complement(538186..539523)
FT                   /locus_tag="Intca_0498"
FT   CDS_pept        complement(538186..539523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0498"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="COGs: COG3004 Na+/H+ antiporter; InterPro IPR004670;
FT                   KEGG: gob:Gobs_2920 Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; SPTR: Putative sodium/proton antiporter;
FT                   TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+ antiporter 1;
FT                   TIGRFAM: Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47045"
FT                   /db_xref="GOA:E6S8S6"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S6"
FT                   /protein_id="ADU47045.1"
FT                   /translation="MTLPPRPTSRLLGRGSWRESRYVADILRQETVGGTLLLIAAVAAI
FT                   VWANSPWREAYSALRDTTVGPQSLHLDLSLGEWAADGLLAVFFLVAGIELKREFVAGDL
FT                   ADRRKAALPIVAAAAGVAVPAILFVITATLVASGDDATQLSGILRGWAIPTATDIAFAL
FT                   AVLAVIGTHLPSALRSFLLTLAVVDDLIAITIIAIFYTQSLNLLWLAAAIVPLAAWRFL
FT                   LQRKITNPFVLAIPGILAWGFVHSSGIHATVAGVLLGLLVPVNRAIEDDPDRHSLAERI
FT                   EHKIRPFSAGFAVPVFAFFAAGVTVIGGGFSAALSDPAALGVIVGLVLGKPIGIFGSTW
FT                   AMSRFTRAELDSGLAWTDVLGLSMLAGVGFTVSLLIGDLAFGLGSERDEHVKFAILFGS
FT                   LIASLFAAVVLRLRNRVYRRIHEQELRDSDRDGIPDVYDASPGHPD"
FT   gene            539765..539944
FT                   /locus_tag="Intca_0499"
FT   CDS_pept        539765..539944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0499"
FT                   /product="Flp/Fap pilin component"
FT                   /note="InterPro IPR007047; KEGG: art:Arth_2928 Flp/Fap
FT                   pilin component; PFAM: Flp/Fap pilin component; SPTR:
FT                   Flp/Fap pilin component; PFAM: Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47046"
FT                   /db_xref="GOA:E6S8S7"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S7"
FT                   /protein_id="ADU47046.1"
FT                   /translation="MTKLAAKLQTLRSREEGATAVEYGLMVALIAVAIMVTVGLLGDAL
FT                   DGLFARVLAAVNAA"
FT   gene            540101..540487
FT                   /pseudo
FT                   /locus_tag="Intca_0500"
FT   gene            540429..541667
FT                   /locus_tag="Intca_0501"
FT   CDS_pept        540429..541667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ach:Achl_4441 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47047"
FT                   /db_xref="GOA:E6S8S8"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S8"
FT                   /protein_id="ADU47047.1"
FT                   /translation="MGLALLTALRRRPQCVVEVELPKNVHPERGGVAVIAAVVVAFVML
FT                   GALAISVDVGFFKLERGQLQNAADATALALAQECASGDDCGPAEVDEVANLLGDNSWTD
FT                   GETRYDTNPGRPDGACGRGVGLPGCATVLSLDNLAQCPPLPNWLTFGAGANIPYVETYT
FT                   NTRTRDGGDGLLPWFGEADAEVTQSTCARAAWGPPAGTGPTLPLTMNLCDWNTTTENGT
FT                   KFAPPPQYSTSPGTSPLEEVPSEVLAHVVGLFTHDSKGTKCSGSPGQEYPGGFAWLDPE
FT                   GDCVADIDDNSIVPGDTGAPPPGNCKDLLQTYLGSEVLVPIFDSVSGTGANGEFHISGV
FT                   ASFYLAGFGNVPSAQPSKSTAVYVEPSTICANPCNSSSTYVWGWFTSGLAKAGSGGVGS
FT                   GPSRGVTVVVPAG"
FT   gene            541706..542509
FT                   /locus_tag="Intca_0502"
FT   CDS_pept        541706..542509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0502"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="InterPro IPR000169; KEGG: tcu:Tcur_1854 Flp pilus
FT                   assembly protein CpaB; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: Flp pilus assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47048"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8S9"
FT                   /protein_id="ADU47048.1"
FT                   /translation="MNRRLVAVLLAVLLAIAGALLVVNYVRGADARAIADQQPAKVYLA
FT                   EKLIPAGTTLKDAQRTELIVETRVATVARPQGALDDINPENSALLALSDIQPGEFVMAS
FT                   RFGTRPVGEKAIEVPAGMLAMSVELSDPARIGKFVTPGSDIAIFATHGMKLIGEDDATK
FT                   AFNELNLKGTTVLLDKVQVIAMGDTPLAAPKKAEAGKADEQTPSFLVTVAVTPEQSLRL
FT                   AHGINEYTLYAGLRGSDVKIPADGHTDDSDIFSYDMRQLLKQVRR"
FT   sig_peptide     541706..541789
FT                   /locus_tag="Intca_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            542506..543675
FT                   /locus_tag="Intca_0503"
FT   CDS_pept        542506..543675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0503"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: ace:Acel_0975 cobyrinic acid
FT                   a,c-diamide synthase; SPTR: Probable chromosome
FT                   partitioning ATPase; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47049"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T0"
FT                   /protein_id="ADU47049.1"
FT                   /translation="MTILWDLDPRAPQTYGFALGPDALQMHAAGQVGKALQEGKHALVV
FT                   IGPDIALDAACSLAELERVDRPELGVILLRHRVDVTTLAQALRSGVREVVQAGDQTSLS
FT                   DAIKRSLELTAQLSGHAHGPSAGAGKVITIFSAKGGVGKTTLATNLAAYLASTGAETLL
FT                   IDLDLMFGDVAISLQVVPAHDIGHLISMRGHLDEQGVHSVVSRHEDSGLAVIAAPSDPE
FT                   VADRVPAAVVEELLRVARGMFAYVIVDTPPNLTEHVLTACDLSDLTMLVATLDIPAVKN
FT                   LRVAMNALDTLGASKDGRVIVLNRSDAKVGLKADDVEVALQHEIRGQVPTSQSVPSSVN
FT                   RGVALVLDEPRSPVAVAIREIADREIRSRFGEQVENGSRRGFALLRSRK"
FT   gene            543672..545060
FT                   /locus_tag="Intca_0504"
FT   CDS_pept        543672..545060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0504"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR001482: IPR017975; KEGG: tcu:Tcur_1852
FT                   type II secretion system protein E; PFAM: type II secretion
FT                   system protein E; SPTR: Flp pilus assembly protein TadA;
FT                   PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47050"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T1"
FT                   /protein_id="ADU47050.1"
FT                   /translation="MSSLADRLEAARRAQVFTVQDQGPAFESERAQRRARRGVDPFAGV
FT                   KDRVHQALVDSLGPRLYDPHLSEAELASQVRVTLQDVIDSEQTPLSLADRTRIAQDVSD
FT                   DILGHGPLEPFLRDQDVTEIMVNGPDDIFIEREGKIFPVDARFSDDAHLRRTIDKIVSR
FT                   VGRRVDESSPMVDARLPDGSRVNAVLPPIALDGSILTIRKFAADPFTDRDLISFGTMSP
FT                   PVRDFLEACVRGRRNIVISGGTGSGKTTTLNVLSSFLPDDERIITIEDAAELQLHQDHV
FT                   LRLESRPPNIEGRGAIAIRELVRNSLRMRPDRIIVGEVRDGAALDMLQAMNTGHDGSLT
FT                   TVHANSPRDSLSRLETMVLMAGVELPVRAIREQVASAIDLIVQQSRLKDGSRRIVAITE
FT                   VVGMESDIVTLQDIYTFDYSAGRDESGRYRGQLVPTGIRPKFTTDLADVGVELPNHLFA
FT                   RFGL"
FT   gene            545057..547015
FT                   /locus_tag="Intca_0505"
FT   CDS_pept        545057..547015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0505"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG4965 Flp pilus assembly protein TadB;
FT                   InterPro IPR002035: IPR018076; KEGG: tcu:Tcur_1851 type II
FT                   secretion system protein; PFAM: Type II secretion system F
FT                   domain; von Willebrand factor type A; SMART: von Willebrand
FT                   factor type A; SPTR: Putative membrane protein; PFAM: von
FT                   Willebrand factor type A domain; Bacterial type II
FT                   secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47051"
FT                   /db_xref="GOA:E6S8T2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T2"
FT                   /protein_id="ADU47051.1"
FT                   /translation="MTRSLRRLWIGLAALLLLLFLARPAAAASIDAVMSDVKSSSGTVT
FT                   GVLTVRSANPVQVDPGSVKASVDGVIVKSFVSEMTHTKRTAMLVIDTSGSMGTDGMATV
FT                   RAATRAYLKEAPEDVLIGVVTFANTAGVDLKPTVDRAAAQRVVNGLDARGDTSLYAAVR
FT                   SAARAMPGDGDRSMVLLSDGADTVSDDRQGDLAEANRELKRRGVRVDVVRFNTDDPDAV
FT                   VALRSFASASGGSVIPATNASDVGAAFKSAARALRSQAQFTLTPSSPLQGNHTITISGT
FT                   AAGEPFKTTQTVNFGEVAAVMTPAAPPPAGPAGAALPPLHALTMQASLMPWIAAGTIGV
FT                   AILLLAIGILTPSFATRREQRLASLESYMGQTRVASRSEGKHHSAPIAEQLVNFGERAM
FT                   KGRSSTARTMELINRADLPLRPGEWWVLRSVAVLSGVAIGMLLFGGSALLGAALGFMLG
FT                   YFLPAFVLRFLAARRAAAFERLLPQSLMLVSTSLRSGFGLPQALDSIAKDAPDPLAKEF
FT                   SRGLAETRIGTDIADALERMADRMGSRSMRMAVMAIRIQREVGGNLAETLETTARTLRE
FT                   RESLHRQVRALSAEGRLSAYILIALPIGLFFYMMWVNYGYISLLWTHPLGLMMLVGGIV
FT                   LLIGGIFWMRQVVKIEV"
FT   sig_peptide     545057..545137
FT                   /locus_tag="Intca_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            547017..547937
FT                   /locus_tag="Intca_0506"
FT   CDS_pept        547017..547937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0506"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG2064 Flp pilus assembly protein TadC;
FT                   InterPro IPR018076; KEGG: tcu:Tcur_1850 type II secretion
FT                   system protein; PFAM: Type II secretion system F domain;
FT                   SPTR: Probable secretion system protein TadC; PFAM:
FT                   Bacterial type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47052"
FT                   /db_xref="GOA:E6S8T3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T3"
FT                   /protein_id="ADU47052.1"
FT                   /translation="MASVYIGVGLIAVAVFGLVLALSFGSGGPTGVAKSLAMIEGVVTQ
FT                   RSAVKTELDAKDRLVEPIFNRAQRIATVLSPQGTSDRLARGLERAGNPSPWTAERVMGA
FT                   KGVALLIGLLLGVAYGGFSLRGFVFALGFGGAAFWLPNLLVYNAALRRQEQVATGLAEA
FT                   LDMLTVCVEAGQGFDAALVQVARSTDGPISGEFARVLSEVQIGKSRSEAFAGLGDRVSL
FT                   SDVKNFVSAIIQADKLGIPIASVLREQTAAMRLSRRQRAEEKAQKVTVKILFPLLLCIF
FT                   PAMFVVILGPGIIRMITTLFGGNLL"
FT   sig_peptide     547017..547115
FT                   /locus_tag="Intca_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(548041..549276)
FT                   /locus_tag="Intca_0507"
FT   CDS_pept        complement(548041..549276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0507"
FT                   /product="cupin 4 family protein"
FT                   /note="InterPro IPR003347; KEGG: gob:Gobs_3279 cupin 4
FT                   family protein; SPTR: Cupin 4 family protein; PFAM: Cupin
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47053"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:E6S8T4"
FT                   /protein_id="ADU47053.1"
FT                   /translation="MSLTTQSRGSAPTRRPSALPRLVSVPVDEFASDHWGRQPLVSLGA
FT                   DLAGGFEDLFSLEAVDELVSRRGLRTPFVRVAKNGQTLPDSAFTAGGGVGAGIADQVSD
FT                   DKLLRLFADGATIVLQGLHRTWAPVSDFVAALAEDLGHPVQANAYVTPRQSQGFNDHYD
FT                   VHDVFVLQVAGEKHWRIRLPVHLWPTRDQPWTAYRERVGQAAAEPPLLDVTLRAGDCLY
FT                   LPRGFLHSATATEEVSAHLTLGVHTWTRAHLAEALVAEAMHALVDAESERAPLPLGVDV
FT                   GNPAGVADEVTRLREVLAGLVEGIDPDRVAARLGRQARAAARPGPLSPVAQARRALQLG
FT                   PDDVIRLRGFVRPEVIDGPDGGAVVQSRAGSLTVTADERPAIETLLAQGEAPVSTLGLD
FT                   LARRLLTAGLAL"
FT   sig_peptide     complement(549184..549276)
FT                   /locus_tag="Intca_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(549277..549612)
FT                   /locus_tag="Intca_0508"
FT   CDS_pept        complement(549277..549612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_3067 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47054"
FT                   /db_xref="UniProtKB/TrEMBL:E6S978"
FT                   /protein_id="ADU47054.1"
FT                   /translation="MSDTNDMTSGETDETTGMGSRADTGTDSQGLGGVDSGSVDNAGMS
FT                   AGPTGSMSEQGEGPADGGADATAVDGGADGGAGGSEGPADGGADTSSHDGGADGGADGG
FT                   ADEGAGR"
FT   gene            549837..550091
FT                   /locus_tag="Intca_0509"
FT   CDS_pept        549837..550091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cfl:Cfla_1495 aldehyde dehydrogenase; SPTR:
FT                   Cell division protein ftsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47055"
FT                   /db_xref="GOA:E6S979"
FT                   /db_xref="UniProtKB/TrEMBL:E6S979"
FT                   /protein_id="ADU47055.1"
FT                   /translation="MDVLMLTTPIVVMVGLLALMQRIEGHMTEHAPVRITTEDAPRPMT
FT                   RADVVAPRTETSRFLAGAPFAVLVTTAVLIGAAVVRMAA"
FT   sig_peptide     549837..549911
FT                   /locus_tag="Intca_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(550109..550970)
FT                   /pseudo
FT                   /locus_tag="Intca_0510"
FT   gene            complement(551022..551567)
FT                   /locus_tag="Intca_0511"
FT   CDS_pept        complement(551022..551567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0511"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0431 flavoprotein; InterPro IPR005025;
FT                   KEGG: bfa:Bfae_17270 predicted flavoprotein; PFAM:
FT                   NADPH-dependent FMN reductase; SPTR: Putative
FT                   uncharacterized protein; PFAM: NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47056"
FT                   /db_xref="GOA:E6S980"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6S980"
FT                   /protein_id="ADU47056.1"
FT                   /translation="MKQLRIIVSSTRPGRIGPKVAEWVASQAPADEWEVKVLDPSGLPF
FT                   LDEEEHPKSGKYALPHTQQWASEIFESDAIVVVTPQYNRSFPAPIKNAIDILFAEWDSK
FT                   PIAILGYGWSGGTDAAADLAKVLTHVKADVVGTTGLHFLQDLSPEGEVDATDERRGELA
FT                   ALLETLSSRLGERESVSA"
FT   gene            complement(551623..552087)
FT                   /locus_tag="Intca_0512"
FT   CDS_pept        complement(551623..552087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_5325 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47057"
FT                   /db_xref="UniProtKB/TrEMBL:E6S981"
FT                   /protein_id="ADU47057.1"
FT                   /translation="MDEAVERFGSAKEGYAPPPRPDGVDDATVEALGKLSEALEVVEHA
FT                   RGLLYGFHRLVGRADATLQEAVTLLRDARYDACADVVEECVVGRNVLPGLWTFQMIEAF
FT                   DDGYWRVFREVVDEVRAATGDPERHRYEAEMKAREQRPKGAAGAPPDGAV"
FT   gene            complement(552202..553572)
FT                   /locus_tag="Intca_0513"
FT   CDS_pept        complement(552202..553572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0513"
FT                   /product="protein of unknown function DUF21"
FT                   /note="COGs: COG1253 Hemolysins and related protein
FT                   containing CBS domains; InterPro IPR000644: IPR002550:
FT                   IPR005170; KEGG: ami:Amir_4979 protein of unknown function
FT                   DUF21; PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SPTR:
FT                   Putative uncharacterized protein; PFAM: CBS domain; Domain
FT                   of unknown function DUF21; Transporter associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47058"
FT                   /db_xref="GOA:E6S982"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6S982"
FT                   /protein_id="ADU47058.1"
FT                   /translation="MPHQVSGYWFNIALVAVLVLLNAAFSGSEMALISLREGQLKQLEK
FT                   EGTVTARRLVRLARDPNRFLATIQIGITLAGFLASATAAVALAEPLVPFLDVLGGAAEA
FT                   AAVAGVTLILTFFTLVLGELAPKRLAMQMALPWARVVARPLDLLSTFSRPAVWTLGLAT
FT                   NTVVRLLGGRAEAASEELTPDELREIVSTHQGLGPEQREIIAGAFDIQERTLREVLVPR
FT                   HQTLFLRHSMPVAEARALLAAQGHSRAPVIRGSNRDDVIGVAHWALLLDEDDRLVGEVA
FT                   TPALVLPDTANVSAALRRFKSERQQLAVVIDEHGSVDGIVTLEDLLEEVVGEIYDETDD
FT                   DSLAIERAADGSITLPGTFPVHDLEDVGVDAGLVRHGEYTTVAGLVLHRLGRIPTAPGD
FT                   TVEIDGWTIEVTAVGHHAVTEVRLVPGDTETRDTQTRDTQTRDTDTRDTGADADRAE"
FT   sig_peptide     complement(553480..553572)
FT                   /locus_tag="Intca_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(553638..554075)
FT                   /locus_tag="Intca_0514"
FT   CDS_pept        complement(553638..554075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0514"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="COGs: COG3187 Heat shock protein; InterPro
FT                   IPR005184; KEGG: rer:RER_23460 hypothetical protein; PFAM:
FT                   protein of unknown function DUF306 Meta and HslJ; SPTR:
FT                   Putative uncharacterized protein; PFAM: META domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47059"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:E6S983"
FT                   /protein_id="ADU47059.1"
FT                   /translation="MSTPPDGPPDRPADSPTHGPADGPADGPAAPAPRTAWVVEFIAGE
FT                   ATIDPKPQISLTEDGRVLGTTGVNRISGRYEAHNETVRITGAGMTRVAGSPEAMDQERR
FT                   FLQALEGWNAFHVSDSRLDLGAPDTGLVCVLSESPTTPPSG"
FT   gene            554217..555533
FT                   /locus_tag="Intca_0515"
FT   CDS_pept        554217..555533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0515"
FT                   /product="HNH nuclease"
FT                   /note="InterPro IPR003615; KEGG: kse:Ksed_09510 HNH
FT                   endonuclease; SMART: HNH nuclease; SPTR: HNH endonuclease;
FT                   PFAM: HNH endonuclease; Domain of unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47060"
FT                   /db_xref="GOA:E6S984"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:E6S984"
FT                   /protein_id="ADU47060.1"
FT                   /translation="MKAEQLIEAEGLVAALELAVDVVQRLTSDFPTWSLPEAEVSAGVA
FT                   GAQRLAQLSQTLTAVLAKEAHSRGLGADNGLSRIDWLKAQAPTLEGSSAPALALLGAAM
FT                   NEPRWDALSEKVTSGQVSVAAATVVLRLHQDVSRIADPEQLDEIIAVIVDKIEHLTVKE
FT                   LNRVAAQARAALKPPSELDREDAGRRLGRSLSKIGSTADYTEYRLRLDPEGSAILDAAI
FT                   DPLARPRPDVEWTGDTKDDPRTPAARRADALLELVGRAVAAPQGVTRTSRTKLVVTMSY
FT                   EALLDQLRGAGVADNDAVLSPGTVRRLACEAEIVPMVLGSPSQVLDQGFSERYFTTAQR
FT                   LALARRDQGCSFPGCSIPPQWCDAHHIEHWSRGGPTDLGNGALLCGRHHTIVHERDLTA
FT                   QIGPHGVTWLLGGLPISIGPRAPRTTWRPHATEDLPLGA"
FT   gene            complement(555813..557789)
FT                   /locus_tag="Intca_0516"
FT   CDS_pept        complement(555813..557789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0516"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR000873: IPR020845: IPR011904;
FT                   KEGG: bcv:Bcav_0611 acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: Acetate/CoA ligase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: Domain of unknown function
FT                   (DUF3448); AMP-binding enzyme; TIGRFAM: acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47061"
FT                   /db_xref="GOA:E6S985"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6S985"
FT                   /protein_id="ADU47061.1"
FT                   /translation="MSETLENLLQETRTFPPPPEFASRANGTAELYEKADADHEGFWAE
FT                   QARTYVSWSKDFTQTLQWDTPFAKWFPDGELNACYNAVDRHVEAGNGDRVAIHWIGEPE
FT                   GDTREITYSDLHSSVQRAANALQDIGVRKGDTVAIYLPMIPEAAVAMLACARIGAPHSV
FT                   VFGGFSAEALHSRIDDAGAKVVITSDGGYRRGSASPLKPAVDAALDHGDTSVEKVLVVK
FT                   RTGQETPWTEGRDLWWDEVLEQAAPTHEAPAHESEHPLFILYTSGTTGKPKGIFHTTGG
FT                   YLTQCAYTNAVVHDVHPESDVYWCTADIGWVTGHSYIVYGPLTLGATQVMYEGTPDTPH
FT                   QGRFWEIVEQKKVTILYTAPTAIRTFMKWGDDIPGKFDLSSLRLLGSVGEPINPEAWMW
FT                   YRRVIGGDRCPIVDTWWQTETGAIMVSPLPGVTATKPGSAQRAIPGIGAEVVDDMAQPV
FT                   PNGHGGYLVLTKPWPAMLRGIWGDPERYKETYWSRFEGLYFAGDGAKKDDDGDIWLLGR
FT                   VDDVMNVSGHRLSTTEIESALVSHPKVAEAAVVGATDETTGQAVVAFVILRSEAVAEAD
FT                   EPGEGADIVAELRNHVAKEIGPIAKPRSIMIVPELPKTRSGKIMRRLLRDVAENRQVGD
FT                   VTTLADSSVMELIKTGLNKGDGD"
FT   gene            558482..559366
FT                   /locus_tag="Intca_0517"
FT   CDS_pept        558482..559366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_25360 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47062"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E6S986"
FT                   /protein_id="ADU47062.1"
FT                   /translation="MSDPKPARNPIVDQLAALADLPGVRGRADAVRGACTRLRFHEALR
FT                   RRIPEAAAESRVRGARASAALDGVDYPVDLVRELTTGARPWPDELTPDLATLKGAIAAT
FT                   AESERVATIVRTAPLQALARLHVAAASPLVGGERPELLGRPRIAGEECTEFVDLGPAPD
FT                   AAEVSRRLSQLADLIVAASAATNRVPAVVVSSVVHGEVIAIRPFVHGNGLVARALERAL
FT                   VQALGLDPTGVAVPEAGHVANGTVTYTGSSAAYGKGTAAGVGLWLGQAADALLKGVDEG
FT                   ERICDAVRAGRLS"
FT   gene            559971..560984
FT                   /locus_tag="Intca_0518"
FT   CDS_pept        559971..560984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0518"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019825; KEGG: bcv:Bcav_0618 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47063"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S987"
FT                   /protein_id="ADU47063.1"
FT                   /translation="MGHVIGVIPASGGVGATTFAAVLAVRAAETGHPVVAVDLDSFGGR
FT                   LDVVLGVEQEPGWRWEQLRGVAGVVDGGGLARELPQSGPLHVLAGATRAAEPERSRADG
FT                   HPAAAWGTVVSDVVAGLAAAHRVTVLDLARDAAVVESVAPLVDAWVVVAGTGVPQLASA
FT                   AVSVPLLRRLVDGACARASGAGRVTAAGAGLRRPCEPWLVLRGARIEDDIADAVCDHLD
FT                   VPVIARVRDDLRLVSDVTCGVAPGARGRGAVVEAADEILLRLVSQPPIELAMSPRPAGS
FT                   RARPPGASGPGTASAPGAASAPGTVPAPGTASGPGTASAPGVRTGADPSERWGWSA"
FT   sig_peptide     559971..560051
FT                   /locus_tag="Intca_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            560972..562153
FT                   /locus_tag="Intca_0519"
FT   CDS_pept        560972..562153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0519"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR001482: IPR017975; KEGG: kse:Ksed_25300
FT                   Flp pilus assembly protein, ATPase CpaF; PFAM: type II
FT                   secretion system protein E; SPTR: Flp pilus assembly
FT                   protein, ATPase CpaF; PFAM: Type II/IV secretion system
FT                   protein; TIGRFAM: helicase/secretion neighborhood ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47064"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S988"
FT                   /protein_id="ADU47064.1"
FT                   /translation="MVRVTLTPAMWQRVREGRGPDPSLVTDVAKEETGALGAQRVAASR
FT                   EAIAARVLGAGPLEEWLDDGDVTDLALNGDGKVWVDRGAGMEWTGHVVPADDARGLAVR
FT                   LAAGAGRRLDEASPWVDGQLPSGARLHAVLPPLVAGGPHITIRVPARDHLSFGRLEAGG
FT                   MFPAPWGQVLRQVVARRLAFVVSGGTGAGKTTILAALLGLVDPSDRLLVVEDVRELHVD
FT                   HPHVVRLEARPPNVEGMGEVTLTTLVRQSLRMRPDRIVVGEVRGAEVRELLAALNTGHE
FT                   GGCGTVHANAPEDVIARFEALGALAGLGPAAVRAQLAAAVDVVVHVARLGPVRRVETIS
FT                   ALFRRGGEPVVETALSRGGTDGASRVGPAWPALAHRLGIDPGCVAGTTPGAGA"
FT   gene            562156..562956
FT                   /locus_tag="Intca_0520"
FT   CDS_pept        562156..562956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0520"
FT                   /product="Type II secretion system F domain"
FT                   /note="InterPro IPR018076; KEGG: kse:Ksed_25290 Flp pilus
FT                   assembly protein TadB; PFAM: Type II secretion system F
FT                   domain; SPTR: Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47065"
FT                   /db_xref="GOA:E6S989"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S989"
FT                   /protein_id="ADU47065.1"
FT                   /translation="MAVVAGVVLAASVLLWPVGGRVAEVRRVLGGGALEGRNAPEPGPR
FT                   WAQLRGVWGSDPVELFHDWRRRRRSGSSVSSAVALLEGVAPALEAGLTPSVAVRLSGAT
FT                   LRSSIDPLTARLVAELTETSERGAHVAPVWRSWAGAEGSEELRFVAAAWQLSEVTGAPL
FT                   ADAVRRAVASVHQARERARRVHVAVAGPRATVVVLTVLPLTGPLFGLACGVPPTELYLA
FT                   SPLSSAAAALGLVLIWVGRRWCRRLVESAVSVGGADGAGSWSRR"
FT   sig_peptide     562156..562224
FT                   /locus_tag="Intca_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            562953..563588
FT                   /locus_tag="Intca_0521"
FT   CDS_pept        562953..563588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0521"
FT                   /product="Type II secretion system F domain"
FT                   /note="InterPro IPR018076; KEGG: kse:Ksed_25280 Flp pilus
FT                   assembly protein TadC; PFAM: Type II secretion system F
FT                   domain; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47066"
FT                   /db_xref="GOA:E6S990"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E6S990"
FT                   /protein_id="ADU47066.1"
FT                   /translation="MSQAVVAGLLVAFAVLVAPRRGRLGSPAGGGTHPAAGTGAGNAIG
FT                   TDDQMGAAVPRPLARPTSEEVTSALVLLALGYRSGLPTWNVLTAVADVLAQPEAPDGSA
FT                   VTRDLRQVAAALRWGASDDEAWASVGEVWTGAGRAVAIAHRAGIPPGPLLLSAADELRK
FT                   ASLERVELAAARVGVQLVAPLGLVLLPAFCLTTVVPLVMALGGQLLSG"
FT   sig_peptide     562953..563042
FT                   /locus_tag="Intca_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            563675..563863
FT                   /locus_tag="Intca_0522"
FT   CDS_pept        563675..563863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_2222 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47067"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:E6S991"
FT                   /protein_id="ADU47067.1"
FT                   /translation="MTQRMKRRMHGWLSESGMSTSEYAVGIMAACTFALVLLGVVRSDA
FT                   VRSALTGIVQSALGLAG"
FT   sig_peptide     563675..563818
FT                   /locus_tag="Intca_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            563896..564264
FT                   /locus_tag="Intca_0523"
FT   CDS_pept        563896..564264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ske:Sked_33320 hypothetical protein; SPTR:
FT                   Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47068"
FT                   /db_xref="GOA:E6S992"
FT                   /db_xref="UniProtKB/TrEMBL:E6S992"
FT                   /protein_id="ADU47068.1"
FT                   /translation="MGLPRVGRRDAGMVTAELAVAIPVVVLVLVICLAGLSAAVAQVRC
FT                   VDAASAGSRAAARGDSPARVEELARRAAPDGAVVSVSTRGGDALVTVRVRAGGWGDLVP
FT                   AWDLSATGRTPVEQERGP"
FT   sig_peptide     563896..564018
FT                   /locus_tag="Intca_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            564261..564719
FT                   /locus_tag="Intca_0524"
FT   CDS_pept        564261..564719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_0475 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM:
FT                   helicase/secretion neighborhood TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47069"
FT                   /db_xref="GOA:E6S993"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:E6S993"
FT                   /protein_id="ADU47069.1"
FT                   /translation="MTQGPCRCRGRRGGSGFRRSAAEGPRPRVLNLSRQPATERGAATV
FT                   LVIGVLVALLVVTTGGLLIASAVVASHRARLAADLAVLAGATALRDASTVERACAAARR
FT                   VATLNGAELGACQARGTELELTVTVAAPPWSEPARARSRAGPATEALR"
FT   gene            complement(564781..565245)
FT                   /locus_tag="Intca_0525"
FT   CDS_pept        complement(564781..565245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0525"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="COGs: COG1959 transcriptional regulator protein;
FT                   InterPro IPR000944; KEGG: cai:Caci_3768 transcriptional
FT                   regulator, BadM/Rrf2 family; PFAM: protein of unknown
FT                   function UPF0074; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: transcriptional regulator, Rrf2 family; PFAM:
FT                   Transcriptional regulator; TIGRFAM: rrf2 family protein
FT                   (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47070"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S994"
FT                   /protein_id="ADU47070.1"
FT                   /translation="MDISARVDYAVRAMLILAEAAASGSGPVSIEALATEQELPRKFLE
FT                   AIFADLRRAELVLSRRGALGGYALARPQREISVGDVFRAVDGPLAEVRGLRPHETSYAG
FT                   VAQHLPSLWVAVRASLREVLDGTSLEALRTGALPEPLQQLLTAPDAWRNR"
FT   gene            complement(565440..566450)
FT                   /locus_tag="Intca_0526"
FT   CDS_pept        complement(565440..566450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0526"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="COGs: COG1118 ABC-type sulfate/molybdate transport
FT                   systems ATPase component; InterProIPR003439: IPR014769:
FT                   IPR005116: IPR003593: IPR 017871: IPR005666; KEGG:
FT                   rha:RHA1_ro01270 ABC sulfate/thiosulfate porter,
FT                   ATP-binding component; PFAM: ABC transporter related; TOBE
FT                   domain-containing protein; SMART: AAA ATPase; SPTR:
FT                   Putative sulfate ABC transporter ATP-binding protein;
FT                   TIGRFAM: sulfate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter; TOBE domain; TIGRFAM: sulfate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47071"
FT                   /db_xref="GOA:E6S995"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S995"
FT                   /protein_id="ADU47071.1"
FT                   /translation="MITVTGARKEFGSFTALDDVSLDIPSGSLTALLGPSGSGKSTLLR
FT                   AIAGLESLDSGVVSIGGRDVTGEPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLTIRKRP
FT                   KTETDAKVNELLTVVGLEGFAHRYPAQLSGGQRQRMALARALAVDPEVLLLDEPFGALD
FT                   AKVRTDLRTWLRRLHDEVHVTTVLVTHDQEEALDVADRIAVLNHGRIEQVGDPVTLYDR
FT                   PANDFVMSFLGSVSKLGEQLVRPHDIILERDHALALAADAQVPGSPGVIRAVVERVVRL
FT                   GFEVRVDLRADSGERFAAQITRRDADGLDLRDGEPITARAAHRSSVVDHDPALAI"
FT   gene            complement(566447..567253)
FT                   /locus_tag="Intca_0527"
FT   CDS_pept        complement(566447..567253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0527"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="COGs: COG4208 ABC-type sulfate transport system
FT                   permease component; InterPro IPR000515: IPR005667:
FT                   IPR011866; KEGG: rer:RER_37540 sulfate ABC transporter
FT                   permease protein; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Putative sulfate
FT                   ABC transporter permease; TIGRFAM: sulfate ABC transporter,
FT                   inner membrane subunit CysW; sulfate ABC transporter, inner
FT                   membrane subunit; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component; TIGRFAM: sulfate ABC
FT                   transporter, permease protein CysW; sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47072"
FT                   /db_xref="GOA:E6S996"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S996"
FT                   /protein_id="ADU47072.1"
FT                   /translation="MRASRRTRLALRTVALGYLIALLAVPIGVILWRAFAPGVGAFVAS
FT                   VSTPAAQAAINLSLLIVAIVVPLNVVFGIVTALALVRGRFRGRGLLQAVVDLPFAVSPI
FT                   VVGVALIMLWGAGGWFGALDDVGITVIFGLPGMVIATIFVTMPFVVREVEPVLHEIGTE
FT                   QEQAAATLGATSWQTFWRITLPAIRWGLTYGVVLTVARALGEFGAVIMVSSGFPGLSQT
FT                   LTLLVHARYIDDHNTYGAYAAATLLMGIALVVLLLMTVLDRKRSER"
FT   sig_peptide     complement(567095..567253)
FT                   /locus_tag="Intca_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(567250..568137)
FT                   /locus_tag="Intca_0528"
FT   CDS_pept        complement(567250..568137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0528"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="COGs: COG0555 ABC-type sulfate transport system
FT                   permease component; InterPro IPR000515: IPR005667:
FT                   IPR011865; KEGG: rha:RHA1_ro01272 ABC sulfate/thiosulfate
FT                   porter, permease component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Sulfate/thiosulfate ABC superfamily ATP binding cassette
FT                   transporter, membrane protein; TIGRFAM: sulfate ABC
FT                   transporter, inner membrane subunit CysT; sulfate ABC
FT                   transporter, inner membrane subunit; manually curated;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: sulfate ABC transporter,
FT                   permease protein; sulfate ABC transporter, permease protein
FT                   CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47073"
FT                   /db_xref="GOA:E6S997"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S997"
FT                   /protein_id="ADU47073.1"
FT                   /translation="MEARTAQARTVRPGSPAHGPAPGRAGRSRRRLRSGLQPLGIGVVT
FT                   LWLSVIVLLPLAALTVASFEGGLGGFWDAATAPVALASLRVTVTVSAIVAAVNAVLGTL
FT                   VAWVLVRDRFAGQAVVNALIDLPFALPTIVASIVLLSLYGPGSPVGVQLNATTWGLFVA
FT                   LAFVTLPFVVRSVQPVLIEADREVEEAAASLGATNWTTFRRIVLPTLAPAVLSGTGLAF
FT                   ARAIGEYGSVVLIGGNIPRETQVASQYIQQQIEMDRPANAAAVSVVLLLIAFATLLVLR
FT                   VLSTRSQRREERAP"
FT   gene            complement(568275..569330)
FT                   /locus_tag="Intca_0529"
FT   CDS_pept        complement(568275..569330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0529"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="COGs: COG1613 ABC-type sulfate transport system
FT                   periplasmic component; InterPro IPR006059: IPR005669; KEGG:
FT                   rop:ROP_09930 sulfate ABC transporter sulfate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Sulfate ABC transporter sulfate-binding protein;
FT                   TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; TIGRFAM:
FT                   sulfate/thiosulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47074"
FT                   /db_xref="GOA:E6S998"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:E6S998"
FT                   /protein_id="ADU47074.1"
FT                   /translation="MPRPRPTAPRSRILRGLAALAVLALAGCTGAGPSDVVVQPGAARV
FT                   AAAPTTTLNLFAHAVAKPAHDAVVPAFQRTPAGTGVAFQQSYGASGDQSRKVAAGAEAD
FT                   LVQLSTEPDLTRLVDAGLIDPTWNAGEHGGVPFGSVVTLVVRTGNPKGIADWDDLLQPE
FT                   VEVVTPNPFSSGSARWNLLAPFAAESHGGADPAAGLAYVEKLVSEHVRIQPKSSREATE
FT                   AFLQGRGDVLLSYENEALFIEQNGDPVEHVTPPQTFRIDNPVAVLKGSENLPVAEAFAD
FT                   YLYTPEAQRLLARAGFRPVDEQVAAEFAKAFPRPEKLWTIADLGGWTAVDAALFEPRTG
FT                   AIATIYDAVTQ"
FT   sig_peptide     complement(569190..569330)
FT                   /locus_tag="Intca_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(569503..569991)
FT                   /locus_tag="Intca_0530"
FT   CDS_pept        complement(569503..569991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_28470 DNA polymerase III, subunit
FT                   gamma/tau; SPTR: DNA polymerase III, subunit gamma/tau"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47075"
FT                   /db_xref="UniProtKB/TrEMBL:E6S999"
FT                   /protein_id="ADU47075.1"
FT                   /translation="MSHRKRGGPGHGRGLPASRPPGHSSGSPHPIDGQSAGSSTGPAGD
FT                   PFSEPVRDPSPSEPPIDAGFLGAAELREHLRRTIEASTQRRPSDVIVTGTVTRAEVETG
FT                   PLVLTDPDGRTWELVLPPGWAVDVGHGARVTVRGDLVDEPSSTQLGPRLRVRSLSAGD"
FT   gene            complement(570008..573001)
FT                   /locus_tag="Intca_0531"
FT   CDS_pept        complement(570008..573001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0531"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="InterPro IPR010259: IPR000209: IPR003137: IPR007280;
FT                   KEGG: kfl:Kfla_2384 protease-associated PA domain protein;
FT                   PFAM: peptidase S8 and S53 subtilisin kexin sedolisin;
FT                   proteinase inhibitor I9 subtilisin propeptide;
FT                   protease-associated PA domain protein; peptidase domain
FT                   protein; SPTR: Protease-associated PA domain protein; PFAM:
FT                   PA domain; Peptidase inhibitor I9; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47076"
FT                   /db_xref="GOA:E6S9A0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034197"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041469"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A0"
FT                   /protein_id="ADU47076.1"
FT                   /translation="MKRRLLGAVTAVPVALAMAGTGAADAAVTQSVPPSTSGTYIVQMA
FT                   DLPVVAYDGKIKGLAATSPTPGTKVDPQSDAVTRYVAHLESKHNSALTRVGATSTKIYD
FT                   YAFSFNGFAAKLTAAQAQRLTKAPGVVAVNPEQTYTVDTSTTPDFLGLTAKGGLWDQLG
FT                   GTGSAGEDILIGTIDSGIWPEHLSFSDRATAGVPSASGPVVYAPFDGPADACKAGENWT
FT                   AKTCNNKLVIARHFNESWGGDKGIRKDRPWEFTSPRDYNGHGTHTASTSGGNHDVPVPG
FT                   IASALAPNGMSGIAPRARVAAYKALWSTETGDTASGRGGDLVAAIDQAVADGVDVINYS
FT                   ISGSQTNFADGAEIAFLFAARAGVFVAASAGNSGPTASTVAHPSPWITTVAAGTHNRAS
FT                   HGSVTLGNGATYEGASLAAEAVTAPFIDSTSAGLAGADPTKVALCYSSADGGNVLDPAK
FT                   VAGKIVLCDRGATARTNKSLAVKEAGGVGLVLVNTSPIGINADLHTIPSVHLESTERAP
FT                   VKAYAATSGATATINVAELDLNAPAPFTAGFSSRGPLSAGSGDLLKPDVIAPGQDILAA
FT                   YTPVTNGGYAYNAISGTSMSSPHVAGLAALLRDRHPGWSPMAIKSALMTTDYDVKDEAS
FT                   TADKAFRQGAGHVNPNAAAKAGLVYDSGWNDWLAFLCGTTSAVGAGTCDALVSRGYSTD
FT                   PSQFNGASIASGALAGSETITRRVTNVGATTATYKASITLRGFDVEVSPKKLVLAPGQT
FT                   KSFTVTITREDAPLNSYTGGHLVWTSGTTTVRSPIVVRPVALAAPGEVRAEPSGTSYGV
FT                   TFGYTGDFAATGRGLVPAAATSGTVADDPTDSTCSLSSPNAQKVEVAVPAGTTYARFAL
FT                   FDADVNPGTDLDLCVFDSTEKNVGSSGSGTSAEQVNLLNPGAGTYTVVVQGWGVAGTSP
FT                   FKLHTWVLGSAAEDNLTVTAPTSATIGQSGTVTLGFTGLTSGKWLGSVAYSGAEGMPNP
FT                   TIVRVDVP"
FT   sig_peptide     complement(572924..573001)
FT                   /locus_tag="Intca_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(573173..575170)
FT                   /locus_tag="Intca_0532"
FT   CDS_pept        complement(573173..575170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0532"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1205 Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster; InterPro IPR014021: IPR001650: IPR011545:
FT                   IPR014001; KEGG: nca:Noca_0370 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; SPTR: Putative
FT                   ATP-dependent RNA helicase; PFAM: Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47077"
FT                   /db_xref="GOA:E6S9A1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A1"
FT                   /protein_id="ADU47077.1"
FT                   /translation="MNGSDALFNAPPAPSDDGDRDQRAFDPEALLHRLVGEHPERLLHV
FT                   HEVPARPARHAEWPGWVDPTLLGALLGSGIDRPWRHQVEVAEAAHRGDHVVVSTGTASG
FT                   KSLGYLLPLLTDVVTGARAPSGRGSTALYLAPTKALAADQLDRITRLALPPVRAATYDG
FT                   DTPTDERRWIRDHANVVLTNPDLVHHSLLPRHDRWAPFLRALRYVVVDECHVYKGVFGA
FT                   HLAAVLRRLRRVAARYHASPTFVFASATVADPSVHASRLLGMPLSSVTEDGSPRAPMTF
FT                   ALWEPPVRTDDQGRPKRVSTLTETGDLLAQCVEEDVQTAVFARSRAGVEVVANVARDRV
FT                   STTREARIAAYRGGYLPEERRELERALRSRRLVGIAATNALELGVDVSGLDAVVLAGWP
FT                   GTLASLWQQAGRAGRTGHRSLAILVAADDPLDTFVVHHPESIFGRAVEATVVDPDNPYV
FT                   LGPHLAAAAAELPLTEGDLELFGPQTRPLLDALVAKGILKKRPRGWFWTREDRPADHVS
FT                   LRGAGEPVRIVETRTGRVVATVDEASAHAQVHTGAVHLHQGQTWVVTELDLDDGAAFAV
FT                   RGDPGWTTHAQSVSEFTIVRELEAVEWGPLRCSFGQVTVTHQVVSFLRRLPGGEVLGEH
FT                   PLDLPPRSLATKAMWWTLLDLTLSRAGSRR"
FT   gene            575293..575676
FT                   /locus_tag="Intca_0533"
FT   CDS_pept        575293..575676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0533"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="COGs: COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor); InterPro IPR002645:
FT                   IPR003658; KEGG: kfl:Kfla_0571 anti-sigma-factor
FT                   antagonist; PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; SPTR: Anti-sigma factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: STAS domain;
FT                   TIGRFAM: anti-anti-sigma factor; anti-sigma F factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47078"
FT                   /db_xref="GOA:E6S9A2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A2"
FT                   /protein_id="ADU47078.1"
FT                   /translation="MDLSITRADHGDRTVVHLGGEIDVYTAPFVREKLDEQIHAGRADL
FT                   IVDLSEVTFLDSTGLGVLVGRLKFARTRGGSLKLVGTSERVLRVFAITGLDKVFDIHPD
FT                   LESALAAPDQGEAPMPPTSNARH"
FT   gene            575706..577226
FT                   /locus_tag="Intca_0534"
FT   CDS_pept        575706..577226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0534"
FT                   /product="methyltransferase small"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR007848: IPR002052; KEGG:
FT                   kse:Ksed_25140 methyltransferase family protein; PFAM:
FT                   methyltransferase small; SPTR: Putative transferase; PFAM:
FT                   Methyltransferase small domain; TIGRFAM: HemK family
FT                   putative methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47079"
FT                   /db_xref="GOA:E6S9A3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A3"
FT                   /protein_id="ADU47079.1"
FT                   /translation="MVEQSGSPSPAPPVVDPALVARLRADLASAGFTVDGVAERLGPVA
FT                   AAALRREQRLPALLATAAPLDPVAALVRFFTLGQPVARADLEAALPTLRVEGVAALRLA
FT                   RLKGDEVVATCDLRPYAEDAHDWWVASDLSELATRAPLRPDHVLGIGGASTTLATWTIR
FT                   HRVDRALDLGTGCGVQALHLAGHTGSIVATDISERALAFARFNAALAGLDVDLRRGDLL
FT                   DPVAGERFSLIVSNPPFVITPRADDVPVYEYRDGGRSGDAIVRTLVRTVRDALEPGGVA
FT                   QLLGNWEVPHGRTWRDVWGDWLAGIDLDAWVVQREVQDPAEYAELWSRDGGVVPGSSAH
FT                   ERLGAAWLRDFASRDVEAIGFGVVTLQRPLTERRPWRSLDEAPGPVAAQMGPVIEAGLR
FT                   ARTWLAEHTDEDVLAVAWACAADVTEERHGRPGADDPSVIIVRQGGGLRRAVRAGTLLA
FT                   AYLGVADGELAAATALDAIATVLGLDPAAVRAELVPQIRDLVADGLLT"
FT   gene            577440..578081
FT                   /locus_tag="Intca_0535"
FT   CDS_pept        577440..578081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0535"
FT                   /product="regulatory protein TetR"
FT                   /note="InterPro IPR001647; KEGG: tpr:Tpau_2624
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; SPTR: Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47080"
FT                   /db_xref="GOA:E6S9A4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A4"
FT                   /protein_id="ADU47080.1"
FT                   /translation="MATTAARAAPLPPTERREALIDVFLDLARRHGRVPTTSEIAGAAG
FT                   VAEGTIFRVFPSKDALQTAAVEAAFCPASARRDFVAIDRSQPMRDRLVAFAASLQRRIR
FT                   DVLDLMGALGLSQPPPLHQHAACLETGRHVPSEPSADCAALHVDLFEAVLDLVDPDAIT
FT                   VTPHQLLHRIRLLSFSGSHPGIAHGELLTPEEVVDTVLYGVCARPGPIRD"
FT   gene            578149..579879
FT                   /locus_tag="Intca_0536"
FT   CDS_pept        578149..579879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0536"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR003439:
FT                   IPR017940: IPR001140: IPR003593: IPR 017871; KEGG:
FT                   kfl:Kfla_3612 ABC transporter related protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase; SPTR: Putative ABC transporter; PFAM:
FT                   ABC transporter transmembrane region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47081"
FT                   /db_xref="GOA:E6S9A5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A5"
FT                   /protein_id="ADU47081.1"
FT                   /translation="MLLRLLRSHLLAYRGEITLIVLLQLASTIASLYLPSLNGEIIDDG
FT                   VAKGDTDFIMSHGALMLGVSVVQIATAVAATFLAARVAMGIGRDLRAKVFDTVIDYSAQ
FT                   EVSRFGAPTLISRNTNDVTQVQTVLFMGFAILVSTPIMMFGGIIMALREDVGLSWLVAV
FT                   AVPLLGLVVATVIWRMMPWFTRMQTSLDGVNRVLREQITGIRVVRAFVREGHEEARFGR
FT                   ANADLTEAGLRVGRLMALVFPVVMFIFSMSTVAVLWFGAYRVDSGAMEVGSLTAFLAYL
FT                   VQILMAVMMATFMATMIPRASVSAGRIAEVLDTASSIVQSVQPIPIRVPRAGVEFVDVE
FT                   FHYPGAEHAVLNGITFEASSGRTTAIIGSTGAGKTTLLGLVPRLFDVRSGRVKVGDVDV
FT                   RDLELDALWARIGLVPQKPYLFTGTVASNLRYGNPDATDDELWEALRISQAADFVTQLG
FT                   GLDTAIVQGGTNVSGGQRQRLAIARAVVKRPDIYLFDDSFSALDLSTDARLRAALRPVT
FT                   RDATVVIVAQRVSTIIDADHIVVLDDGRIVGQGTHDELLQTCETYQEIALSQRAAEEVA
FT                   "
FT   sig_peptide     578149..578241
FT                   /locus_tag="Intca_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            579879..581906
FT                   /locus_tag="Intca_0537"
FT   CDS_pept        579879..581906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0537"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR003439:
FT                   IPR017940: IPR001140: IPR003593: IPR 017871; KEGG:
FT                   kfl:Kfla_3611 ABC transporter transmembrane region; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase; SPTR: Putative ABC transporter;
FT                   PFAM: ABC transporter transmembrane region; ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47082"
FT                   /db_xref="GOA:E6S9A6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A6"
FT                   /protein_id="ADU47082.1"
FT                   /translation="MSEGVKTAEEKAAEARRGPARRGGPPHMMMGQPGEKSLNFGPSAK
FT                   RLLGLLRPERGKVVGVVTLVVVSVFLSAIGPKILGRATDLIFGGLLGRQLGQNVPAGAT
FT                   TEQVVAGLRARGEENLADMLQRAGVVIGQGIDFGAVADVLLLVTGLYVASSLLLWVQGW
FT                   ILQGVLARTMYRLRQDVEAKLNRLPLPYFDKQPRGEILSRVTNDIDNVSMSLQQTLSQL
FT                   LNSLLTVVAVLVMMFWISWVLALIALVTIPISIVVTGLIAKRSQKLFVQQWRNTGELNG
FT                   IIEETYTGHGLVKVYGRQQETEAHFRTKNDELFGAAFGAQFVSGIIMPVMMFIGNLNYV
FT                   VVAVVGGLKVASGSMSLGDVQAFIQYSRQFTQPLTQVASMANLLQSGVASAERVFEVLD
FT                   ADEQEAEVAVPDVIDDPRGEVAFEGVSFAYTPDQPLIEDLDLVVRPGQTVAIVGPTGAG
FT                   KTTLVNLIMRFYELDGGRITLDGVDIRDLTRHGLRSRIGMVLQDTWLFAGTIRENIAYG
FT                   RPGASDEEVLEAARATYVDRFVHSLPDGYDTVLDDEASNISAGEKQLVTIARAFLSDPA
FT                   LLILDEATSSVDTRTELLVQQAMRALRSDRTSFVIAHRLSTIRDADLILVMEHGRIVEQ
FT                   GSHAELLAADGSYARLYAAQFAGAAADVDDVAEVAGPPVG"
FT   gene            582148..585210
FT                   /locus_tag="Intca_0538"
FT   CDS_pept        582148..585210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0538"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="COGs: COG0751 Glycyl-tRNA synthetase beta subunit;
FT                   InterPro IPR006194: IPR002310: IPR002311: IPR015944; KEGG:
FT                   kfl:Kfla_5824 glycyl-tRNA synthetase, beta subunit; PFAM:
FT                   glycyl-tRNA synthetase alpha subunit; glycyl-tRNA
FT                   synthetase beta subunit; PRIAM: Glycine--tRNA ligase; SPTR:
FT                   Glycyl-tRNA synthetase, beta subunit; TIGRFAM: glycyl-tRNA
FT                   synthetase, beta subunit; glycyl-tRNA synthetase, alpha
FT                   subunit; PFAM: Glycyl-tRNA synthetase beta subunit;
FT                   Glycyl-tRNA synthetase alpha subunit; TIGRFAM: glycyl-tRNA
FT                   synthetase, tetrameric type, beta subunit; glycyl-tRNA
FT                   synthetase, tetrameric type, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47083"
FT                   /db_xref="GOA:E6S9A7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A7"
FT                   /protein_id="ADU47083.1"
FT                   /translation="MPDTTTLTVQDALLTLQKFWTDRGCMVVQPFNTEVGAGTMNPATI
FT                   LRVLGPEPWRVAYVEPSVRPDDSRYGENPNRLQQHTQFQVILKPDPGNPQELYLESLEA
FT                   LGIDIRAHDIRFVEDNWAQPAIGAWGLGWEVWLDGMEITQFTYFQQVGGQNLDPVAVEL
FT                   TYGVERIMMALQGVAHFKDMVYAPGITYGEAFGQSEYEMSRYYLDDADIQTNRDLFERF
FT                   TAEAQRLIDVRLPVPAHTYVLKSSHAFNVLDARGAISTTERAKAFGTMRRLAREVSRLW
FT                   VERREELGFPLLGADLPPMEGRALMPPSQGVEVTPEAYAAELASLAPDVTRRLALEIGV
FT                   EELPPHVVPEAIEQVRTALTQKLGATRLPHGSVVVQGTPRRIIALVDAVGVHEPDAETL
FT                   RKGPKVAAAFGPDGAATKAAEGFARGQKVDVSDLVRAEFDGVEHVAVRVAETGRGVLEV
FT                   LGSIIADVVAGLRADKNMRWSDPELAYSRPIRWIVALWGDTVVPVTVSGLRSGRTTYGE
FT                   RTEAGPLIEVENADVLLPKLAERDFIVDPVARRESVVSQAKSLAASVGGAVDVEGEAAL
FT                   VDEITHLVEAPHGILGSFEERYLELPEQILTTVMRKHQRYLPVRSGDGALLPYFVTMAN
FT                   GECDDDLVRKGNENVLRARYEDAAFFYAADLKVPLEELRAGIAKLTFEERIGSVADRAD
FT                   RIRDVAAALAELVGLDASEGATLARAGQLAKFDLASQMVVELSSLAGFMAREYALKAGE
FT                   TPEVAAALYEMEQPRTAGGPLPASRAGAVLALADRFDLLMAMFALGAKPTGSSDPFALR
FT                   RAALGVIGILRSQPTLAGLTIEQGLHAAADQLRQQGLDVSAEAIADAVEFVTGRFGQQL
FT                   REEGVPSTLAGAVQPLAGTPGKAEVALRDIETVRGREGFAKLVEATQRITRIVPEGSPA
FT                   AYDPQVLREEAERELSVALETIPDLSGAALPEWAGVAVRAVPALERFFDEVLVMAEDPA
FT                   LRAARLGLLQTFVARAPRGIDWRALHSALAG"
FT   gene            585353..586363
FT                   /locus_tag="Intca_0539"
FT   CDS_pept        585353..586363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0539"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="COGs: COG0598 Mg2+ and Co2+ transporter; InterPro
FT                   IPR002523; KEGG: rxy:Rxyl_0057 magnesium and cobalt
FT                   transport protein CorA; PFAM: Mg2 transporter protein CorA
FT                   family protein; SPTR: Magnesium and cobalt transport
FT                   protein CorA; PFAM: CorA-like Mg2+ transporter protein;
FT                   TIGRFAM: magnesium Mg(2+) and cobalt Co(2+) transport
FT                   protein (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47084"
FT                   /db_xref="GOA:E6S9A8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A8"
FT                   /protein_id="ADU47084.1"
FT                   /translation="MIIDCALYRDGRRQQEAALTLDTAAALHQDGSEGFAWLGTFEPAP
FT                   DELERIRDSFGLHELAVEDVQTFHLRPKMEQYDHGVELVILRTARYDDEREEVDFGEIS
FT                   VFIAPTFVITVRQGVASELHTARTNLEARPDLLAEGSPAVLWAILDQVIKSYGPVVAEL
FT                   ERDIEQVESTVFAGEAAPTERIYFLRREVTNFYRAVHPLLTVLTTIERTYREGPLAPYL
FT                   HDVHDYLRLISDEVAAQRDLLATILEANMAVISVEQTRLGIRQGQTIERLTVLATVFLP
FT                   LTFVTGFFGQNFPWLVEHLDGFGRFVVLGIGGLVLPLVVLWVLLRRDRGRLDRST"
FT   gene            complement(586568..587002)
FT                   /locus_tag="Intca_0540"
FT   CDS_pept        complement(586568..587002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0540"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551: IPR015358: IPR010211; KEGG:
FT                   tcu:Tcur_2818 transcriptional regulator, MerR family; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR; SPTR:
FT                   Transcriptional regulator, MerR family; TIGRFAM:
FT                   redox-sensitive transcriptional activator SoxR; PFAM: MerR
FT                   family regulatory protein; MerR, DNA binding; TIGRFAM:
FT                   redox-sensitive transcriptional activator SoxR"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47085"
FT                   /db_xref="GOA:E6S9A9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9A9"
FT                   /protein_id="ADU47085.1"
FT                   /translation="MSPQLTIGQVAERTGVATSALRYWEALGLISSGRTTGNQRRYDRP
FT                   TIRRVSFIRAAQRVGLSLEEIRDALATLPGSRTPTSHDWARLSSAWRARLDEQIRRIEL
FT                   LRDRLDGCIGCGCLSLETCALNNPGDEMASVGPGPHRLDP"
FT   gene            complement(587004..587567)
FT                   /locus_tag="Intca_0541"
FT   CDS_pept        complement(587004..587567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0541"
FT                   /product="phosphotransferase (aminonucleoside antibiotic
FT                   resistance)"
FT                   /note="KEGG: aoe:Clos_0772 phosphotransferase
FT                   (aminonucleoside antibiotic resistance); SPTR:
FT                   Phosphotransferase (Aminonucleoside antibiotic resistance);
FT                   PFAM: Chloramphenicol phosphotransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47086"
FT                   /db_xref="GOA:E6S9B0"
FT                   /db_xref="InterPro:IPR012853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B0"
FT                   /protein_id="ADU47086.1"
FT                   /translation="MTDRLPLPASVDTPQTIVVTGVMAAGKSTVSQLLAERFTRAVHLR
FT                   GDEFRRVVVRGRVDLSPHGDLEAERQLALRHRLAAHTANIYVDAGFTVVVQDLFVGTTL
FT                   EPFLAQLTEPVSLVMLAPDVSTVMRRESERTKTGYGDLWSIRDFDLKVRTETPKIGLWL
FT                   DSSQQTPDETVDEILHRLAEARIR"
FT   gene            complement(587653..588471)
FT                   /locus_tag="Intca_0542"
FT   CDS_pept        complement(587653..588471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0542"
FT                   /product="Forkhead-associated protein"
FT                   /note="InterPro IPR000253; KEGG: kfl:Kfla_5978 FHA domain
FT                   containing protein; PFAM: Forkhead-associated protein;
FT                   SMART: Forkhead-associated protein; SPTR: FHA domain
FT                   containing protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47087"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B1"
FT                   /protein_id="ADU47087.1"
FT                   /translation="MTVTCPNGHPSQADDYCDVCGSPIEAGAGSGDAASVSGSASPTGP
FT                   YAAGPAPTAAPGAAPAETSSVAGAESLECPNCQAQNPAGALFCEACGYDFTTGAMPRSS
FT                   AQNVPAPTPSSVQNAPAPTPSSVQNVPAPEGFDWLAEVWVDPDWYQTQEVEDPCPSPGL
FT                   PLIVPLRSRSVLLGRVSQSRNTHPEIDLSSDPGVSRRHAQLSTDGTRWFVEDLGSSNGT
FT                   FVGPASGPLPDDPISVGPRTELDDDDRLYVGAWSRVVVRRATPEEVEAHG"
FT   sig_peptide     complement(588433..588471)
FT                   /locus_tag="Intca_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(588468..589754)
FT                   /locus_tag="Intca_0543"
FT   CDS_pept        complement(588468..589754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0543"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: kfl:Kfla_5977 von
FT                   Willebrand factor type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: Putative
FT                   uncharacterized protein; PFAM: von Willebrand factor type A
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47088"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041176"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B2"
FT                   /protein_id="ADU47088.1"
FT                   /translation="MADFTAEVFQNEFLPDGGTDVHAIVRITSSGASAATSMGVVDPGS
FT                   AAEVILIDTSGSMGRRGVMEAGHAAKAALNEIVDGTLFAVVSGNGTAQIVYPYAHQGAL
FT                   AVMSSHTRAEARRAVEGLRAQGGTAMGTWLTLARQIFETVPHVQKRHAILLTDGVNEGE
FT                   TPASLQAAVQSCVGVFQCDARGVGDQWRVEEVRAIASALLGTVGLVPEPEELAAEFQAM
FT                   MRASMSRGVASAELRVWVPQGAELLFVRQVSPTLEDLTGRRSQVNPLTGAYPTGAWSDE
FT                   SRDYHVAVRLPARTLGQEQLAARVSLGLGDQPVCQGLVKARWSNDDALTTRIDPAVAAY
FT                   TGQAELAQVIQEGLAAKASGHDEVATAKLGRAVQLAGQTGNDEMTTRLKKVVEIDDADT
FT                   GTVRLKKSVSKLDEMSLDTASTKTSRVRR"
FT   sig_peptide     complement(589686..589754)
FT                   /locus_tag="Intca_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(589747..591021)
FT                   /locus_tag="Intca_0544"
FT   CDS_pept        complement(589747..591021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0544"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR014045: IPR001932; KEGG: kfl:Kfla_5976 protein
FT                   serine/threonine phosphatase; PFAM: Protein phosphatase
FT                   2C-like; SMART: protein phosphatase 2C domain protein;
FT                   SPTR: Protein serine/threonine phosphatase; PFAM: Protein
FT                   phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47089"
FT                   /db_xref="GOA:E6S9B3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B3"
FT                   /protein_id="ADU47089.1"
FT                   /translation="MTDASPPRLPQATQFPQATGPEPTCPSCGTPNPPDASFCEACGAG
FT                   LAPGQQGAGASPAAYGGVVSPATPQTAPTGEESPLDVGWTGPVPSTATGPAQPTGAEAQ
FT                   PCQSCGEGHYVDGYCDHCGSPPPDPRNHFAESPAPWVGGVCDIGRRHARNEDAMALTAT
FT                   EAPGSRAVLVVCDGVSMATDSHIASLAAARAARAVLDQPLPRGAGTRDAWEAAAARALT
FT                   TAVATANDAVRSAVEGEQENPPSCTIAAAVIEDGAVVTGNVGDSRVYWLPDRPELPPRQ
FT                   LGRDDSYAHEQMLAGVPRDAAENGPHAHSITRWLGTDAPDDLTPHLTTLAADDTTAGWL
FT                   LVCSDGLWNYCSAAADMRVLVHNMVTEAGPDPTPTAVAQALVDFANEQGGRDNITVALA
FT                   RLGGQGSQETTGAEAAPQEGDPIHG"
FT   gene            complement(591018..593501)
FT                   /locus_tag="Intca_0545"
FT   CDS_pept        complement(591018..593501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0545"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterPro IPR000719: IPR017442: IPR020635: IPR002290; KEGG:
FT                   kfl:Kfla_5975 serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; SPTR: Serine/threonine protein kinase;
FT                   PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47090"
FT                   /db_xref="GOA:E6S9B4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B4"
FT                   /protein_id="ADU47090.1"
FT                   /translation="MTTSPPPTSTPPTSTGLRCAQPGCAGTIVDGYCDTCGMAPTSPAA
FT                   PGGRSLADPGPPPATSPATSPATSPDTSLDTSLDTALATVPDGTPCAQPGCTGAIDDGY
FT                   CNVCGTPAHQAEVVQVVDSAVTRPAGMGSELSTRSAASSMLASAALGSKRARQTGSAVT
FT                   RRTSGSQRLRSARLGGGITTVRPAPTIDAEKALLTDPVVPEAKRFCPKCGEPVGRGRDG
FT                   QPGRTTGFCANCRHPFSFDPKLRSGDLVAGQYEVAGCLAHGGLGWIYLARDKNVSDRWV
FT                   VLKGLLNSADPDALAAAIAEQRFLAQVSHPNIVEIYNFVTHDDAGYIVMEYVGGTSLKS
FT                   ILKQRMQRAGFYDPLPVDQALAYILEILPSFQYLHDLGLVYCDFKPDNIIQVGDEVKLI
FT                   DLGGVRRVDDEDSAIFGTVGYQAPEVADLGTSVASDIYTIGRTLVVLTMEFRGYQSTYL
FT                   NVLPPQDSSPVFQKYDSFYRLVSKACAPNRDDRFVSADELRSQMVGVLREVVAIDRGSG
FT                   AATTTVGSLLFDAPTPGDEADDWRNLPALRRDPHDAQTNWLHTISGSPEQRLDILRDAP
FT                   ARTAEVLLDLARTALSVGERDLAEAAATELLTNDPWEWRAVWIQGLAALERGDAPSAQA
FT                   AFNAVYGQVPGELAPKLALAHASEKAGDDAVAENLYVACARTDSTYVPMAAFGLARIRA
FT                   ARGDVDGAVAAYRLVPTQSSAYRTARAGLAELLARANRGLPDLAEALRTLADTSLTARR
FT                   RAEVTTHIYREALASVREAGAQPDLHLGTHRATEPALRVGLEQALRELASRTPDTAERV
FT                   ALVDEANTVRPWSLW"
FT   sig_peptide     complement(593427..593501)
FT                   /locus_tag="Intca_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(593498..594772)
FT                   /locus_tag="Intca_0546"
FT   CDS_pept        complement(593498..594772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5974 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU47091"
FT                   /db_xref="UniProtKB/TrEMBL:E6S9B5"
FT                   /protein_id="ADU47091.1"
FT                   /translation="MTLSGAVPPPPSSRPPEWTPPSAGPAGTRSGGSAAPAAPGGLGVP
FT                   VPAAEAQTYLTALRQWVAQRRADLSEVDSAILRLSSAEQTAITTDLTVALTFWKAINDR
FT                   LTLLETTFDGGRVGAKEAERLSTLIHGRLDSNTTEHLSLPATGSLAVSLPEACRLLDSL
FT                   TRTLQARASLAPGAAEATQRITVLRAGAERVRDQVPLVPAGPDRDDAAERLARLDRRVG
FT                   DLVERARRGADVGGLIGPLEIDLAVLERDLIVAAAERANAAQDRADTRQQVEELDARAE
FT                   AIRSLERRCIAAVTPAPHLAIPNVRALGPVPGEAAGLAGYRQRLDRVARALDLAHETYA
FT                   AALAERDEIIGLAGAVGAMLEARLAAHPPDDEVQDDLEAIRSRLEAVLGRTPMPTTRAR
FT                   ALAAAFQSYVDSVTRPPSRPGRAQQ"
FT   gene            complement(594769..595773)
FT                   /locus_tag="Intca_0547"
FT   CDS_pept        complement(594769..595773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0547"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR017909: IPR001638: IPR018313; KEGG: cfl:Cfla_3062
FT                   extracellular solute-binding protein family 3; PFAM:
FT                   extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3; SPTR:
FT                   Extracellular solute-binding protein family 3; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 3"
F