(data stored in ACNUC30630 zone)

EMBL: CP002344

ID   CP002344; SV 1; circular; genomic DNA; STD; PRO; 2844696 BP.
XX
AC   CP002344;
XX
PR   Project:PRJNA38025;
XX
DT   30-DEC-2010 (Rel. 107, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Thermaerobacter marianensis DSM 12885, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Thermaerobacter marianensis DSM 12885
OC   Bacteria; Firmicutes; Clostridia; Clostridiales;
OC   Clostridiales Family XVII. Incertae Sedis; Thermaerobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2844696
RX   PUBMED; 21304738.
RA   Han C., Gu W., Zhang X., Lapidus A., Nolan M., Copeland A., Lucas S.,
RA   Del Rio T.G., Tice H., Cheng J.F., Tapia R., Goodwin L., Pitluck S.,
RA   Pagani I., Ivanova N., Mavromatis K., Mikhailova N., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Schneider S., Rohde M., Goker M., Pukall R., Woyke T., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.,
RA   Detter J.C.;
RT   "Complete genome sequence of Thermaerobacter marianensis type strain
RT   (7p75a)";
RL   Stand Genomic Sci 3(3):337-345(2010).
XX
RN   [2]
RP   1-2844696
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Gu W., Zhang X., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Pukall R., Gehrich-Schroeter G., Schneider S., Klenk H.-P.,
RA   Eisen J.A.;
RT   "The complete genome of Thermaerobacter marianensis DSM 12885";
RL   Unpublished.
XX
RN   [3]
RP   1-2844696
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Gu W., Zhang X., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Pukall R., Gehrich-Schroeter G., Schneider S., Klenk H.-P.,
RA   Eisen J.A.;
RT   ;
RL   Submitted (17-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 2b2b30646655a9ee5da75ca2276528e6.
DR   BioSample; SAMN00713570.
DR   CABRI; DSM 12885.
DR   EnsemblGenomes-Gn; EBG00001073959.
DR   EnsemblGenomes-Gn; EBG00001073960.
DR   EnsemblGenomes-Gn; EBG00001073961.
DR   EnsemblGenomes-Gn; EBG00001073962.
DR   EnsemblGenomes-Gn; EBG00001073963.
DR   EnsemblGenomes-Gn; EBG00001073964.
DR   EnsemblGenomes-Gn; EBG00001073965.
DR   EnsemblGenomes-Gn; EBG00001073966.
DR   EnsemblGenomes-Gn; EBG00001073967.
DR   EnsemblGenomes-Gn; EBG00001073968.
DR   EnsemblGenomes-Gn; EBG00001073969.
DR   EnsemblGenomes-Gn; EBG00001073970.
DR   EnsemblGenomes-Gn; EBG00001073971.
DR   EnsemblGenomes-Gn; EBG00001073972.
DR   EnsemblGenomes-Gn; EBG00001073973.
DR   EnsemblGenomes-Gn; EBG00001073974.
DR   EnsemblGenomes-Gn; EBG00001073975.
DR   EnsemblGenomes-Gn; EBG00001073976.
DR   EnsemblGenomes-Gn; EBG00001073977.
DR   EnsemblGenomes-Gn; EBG00001073978.
DR   EnsemblGenomes-Gn; EBG00001073979.
DR   EnsemblGenomes-Gn; EBG00001073980.
DR   EnsemblGenomes-Gn; EBG00001073981.
DR   EnsemblGenomes-Gn; EBG00001073982.
DR   EnsemblGenomes-Gn; EBG00001073983.
DR   EnsemblGenomes-Gn; EBG00001073984.
DR   EnsemblGenomes-Gn; EBG00001073985.
DR   EnsemblGenomes-Gn; EBG00001073986.
DR   EnsemblGenomes-Gn; EBG00001073987.
DR   EnsemblGenomes-Gn; EBG00001073988.
DR   EnsemblGenomes-Gn; EBG00001073989.
DR   EnsemblGenomes-Gn; EBG00001073990.
DR   EnsemblGenomes-Gn; EBG00001073991.
DR   EnsemblGenomes-Gn; EBG00001073992.
DR   EnsemblGenomes-Gn; EBG00001073993.
DR   EnsemblGenomes-Gn; EBG00001073994.
DR   EnsemblGenomes-Gn; EBG00001073995.
DR   EnsemblGenomes-Gn; EBG00001073996.
DR   EnsemblGenomes-Gn; EBG00001073997.
DR   EnsemblGenomes-Gn; EBG00001073998.
DR   EnsemblGenomes-Gn; EBG00001073999.
DR   EnsemblGenomes-Gn; EBG00001074000.
DR   EnsemblGenomes-Gn; EBG00001074001.
DR   EnsemblGenomes-Gn; EBG00001074002.
DR   EnsemblGenomes-Gn; EBG00001074003.
DR   EnsemblGenomes-Gn; EBG00001074004.
DR   EnsemblGenomes-Gn; EBG00001074005.
DR   EnsemblGenomes-Gn; EBG00001074006.
DR   EnsemblGenomes-Gn; EBG00001074007.
DR   EnsemblGenomes-Gn; EBG00001074008.
DR   EnsemblGenomes-Gn; EBG00001074009.
DR   EnsemblGenomes-Gn; EBG00001074010.
DR   EnsemblGenomes-Gn; EBG00001074011.
DR   EnsemblGenomes-Gn; EBG00001074012.
DR   EnsemblGenomes-Gn; EBG00001074013.
DR   EnsemblGenomes-Gn; EBG00001074014.
DR   EnsemblGenomes-Gn; EBG00001074015.
DR   EnsemblGenomes-Gn; EBG00001074016.
DR   EnsemblGenomes-Gn; EBG00001074017.
DR   EnsemblGenomes-Gn; EBG00001074018.
DR   EnsemblGenomes-Gn; EBG00001074019.
DR   EnsemblGenomes-Gn; EBG00001074020.
DR   EnsemblGenomes-Gn; EBG00001074021.
DR   EnsemblGenomes-Gn; EBG00001074022.
DR   EnsemblGenomes-Gn; EBG00001074023.
DR   EnsemblGenomes-Gn; EBG00001074024.
DR   EnsemblGenomes-Gn; Tmar_R0001.
DR   EnsemblGenomes-Gn; Tmar_R0002.
DR   EnsemblGenomes-Gn; Tmar_R0003.
DR   EnsemblGenomes-Gn; Tmar_R0004.
DR   EnsemblGenomes-Gn; Tmar_R0005.
DR   EnsemblGenomes-Gn; Tmar_R0006.
DR   EnsemblGenomes-Gn; Tmar_R0007.
DR   EnsemblGenomes-Gn; Tmar_R0008.
DR   EnsemblGenomes-Gn; Tmar_R0009.
DR   EnsemblGenomes-Gn; Tmar_R0010.
DR   EnsemblGenomes-Gn; Tmar_R0011.
DR   EnsemblGenomes-Gn; Tmar_R0012.
DR   EnsemblGenomes-Gn; Tmar_R0013.
DR   EnsemblGenomes-Gn; Tmar_R0014.
DR   EnsemblGenomes-Gn; Tmar_R0015.
DR   EnsemblGenomes-Gn; Tmar_R0016.
DR   EnsemblGenomes-Gn; Tmar_R0017.
DR   EnsemblGenomes-Gn; Tmar_R0018.
DR   EnsemblGenomes-Gn; Tmar_R0019.
DR   EnsemblGenomes-Gn; Tmar_R0020.
DR   EnsemblGenomes-Gn; Tmar_R0021.
DR   EnsemblGenomes-Gn; Tmar_R0022.
DR   EnsemblGenomes-Gn; Tmar_R0023.
DR   EnsemblGenomes-Gn; Tmar_R0024.
DR   EnsemblGenomes-Gn; Tmar_R0025.
DR   EnsemblGenomes-Gn; Tmar_R0026.
DR   EnsemblGenomes-Gn; Tmar_R0027.
DR   EnsemblGenomes-Gn; Tmar_R0028.
DR   EnsemblGenomes-Gn; Tmar_R0029.
DR   EnsemblGenomes-Gn; Tmar_R0030.
DR   EnsemblGenomes-Gn; Tmar_R0031.
DR   EnsemblGenomes-Gn; Tmar_R0032.
DR   EnsemblGenomes-Gn; Tmar_R0033.
DR   EnsemblGenomes-Gn; Tmar_R0034.
DR   EnsemblGenomes-Gn; Tmar_R0035.
DR   EnsemblGenomes-Gn; Tmar_R0036.
DR   EnsemblGenomes-Gn; Tmar_R0037.
DR   EnsemblGenomes-Gn; Tmar_R0038.
DR   EnsemblGenomes-Gn; Tmar_R0039.
DR   EnsemblGenomes-Gn; Tmar_R0040.
DR   EnsemblGenomes-Gn; Tmar_R0041.
DR   EnsemblGenomes-Gn; Tmar_R0042.
DR   EnsemblGenomes-Gn; Tmar_R0043.
DR   EnsemblGenomes-Gn; Tmar_R0044.
DR   EnsemblGenomes-Gn; Tmar_R0045.
DR   EnsemblGenomes-Gn; Tmar_R0046.
DR   EnsemblGenomes-Gn; Tmar_R0047.
DR   EnsemblGenomes-Gn; Tmar_R0048.
DR   EnsemblGenomes-Gn; Tmar_R0049.
DR   EnsemblGenomes-Gn; Tmar_R0050.
DR   EnsemblGenomes-Gn; Tmar_R0051.
DR   EnsemblGenomes-Gn; Tmar_R0052.
DR   EnsemblGenomes-Gn; Tmar_R0054.
DR   EnsemblGenomes-Gn; Tmar_R0055.
DR   EnsemblGenomes-Gn; Tmar_R0056.
DR   EnsemblGenomes-Gn; Tmar_R0057.
DR   EnsemblGenomes-Gn; Tmar_R0058.
DR   EnsemblGenomes-Gn; Tmar_R0059.
DR   EnsemblGenomes-Gn; Tmar_R0060.
DR   EnsemblGenomes-Gn; Tmar_R0061.
DR   EnsemblGenomes-Tr; EBT00001677049.
DR   EnsemblGenomes-Tr; EBT00001677050.
DR   EnsemblGenomes-Tr; EBT00001677051.
DR   EnsemblGenomes-Tr; EBT00001677052.
DR   EnsemblGenomes-Tr; EBT00001677053.
DR   EnsemblGenomes-Tr; EBT00001677054.
DR   EnsemblGenomes-Tr; EBT00001677055.
DR   EnsemblGenomes-Tr; EBT00001677056.
DR   EnsemblGenomes-Tr; EBT00001677057.
DR   EnsemblGenomes-Tr; EBT00001677058.
DR   EnsemblGenomes-Tr; EBT00001677059.
DR   EnsemblGenomes-Tr; EBT00001677060.
DR   EnsemblGenomes-Tr; EBT00001677061.
DR   EnsemblGenomes-Tr; EBT00001677062.
DR   EnsemblGenomes-Tr; EBT00001677063.
DR   EnsemblGenomes-Tr; EBT00001677064.
DR   EnsemblGenomes-Tr; EBT00001677065.
DR   EnsemblGenomes-Tr; EBT00001677066.
DR   EnsemblGenomes-Tr; EBT00001677067.
DR   EnsemblGenomes-Tr; EBT00001677068.
DR   EnsemblGenomes-Tr; EBT00001677069.
DR   EnsemblGenomes-Tr; EBT00001677070.
DR   EnsemblGenomes-Tr; EBT00001677071.
DR   EnsemblGenomes-Tr; EBT00001677072.
DR   EnsemblGenomes-Tr; EBT00001677073.
DR   EnsemblGenomes-Tr; EBT00001677074.
DR   EnsemblGenomes-Tr; EBT00001677075.
DR   EnsemblGenomes-Tr; EBT00001677076.
DR   EnsemblGenomes-Tr; EBT00001677077.
DR   EnsemblGenomes-Tr; EBT00001677078.
DR   EnsemblGenomes-Tr; EBT00001677079.
DR   EnsemblGenomes-Tr; EBT00001677080.
DR   EnsemblGenomes-Tr; EBT00001677081.
DR   EnsemblGenomes-Tr; EBT00001677082.
DR   EnsemblGenomes-Tr; EBT00001677083.
DR   EnsemblGenomes-Tr; EBT00001677084.
DR   EnsemblGenomes-Tr; EBT00001677085.
DR   EnsemblGenomes-Tr; EBT00001677086.
DR   EnsemblGenomes-Tr; EBT00001677087.
DR   EnsemblGenomes-Tr; EBT00001677088.
DR   EnsemblGenomes-Tr; EBT00001677089.
DR   EnsemblGenomes-Tr; EBT00001677090.
DR   EnsemblGenomes-Tr; EBT00001677091.
DR   EnsemblGenomes-Tr; EBT00001677092.
DR   EnsemblGenomes-Tr; EBT00001677093.
DR   EnsemblGenomes-Tr; EBT00001677094.
DR   EnsemblGenomes-Tr; EBT00001677095.
DR   EnsemblGenomes-Tr; EBT00001677096.
DR   EnsemblGenomes-Tr; EBT00001677097.
DR   EnsemblGenomes-Tr; EBT00001677098.
DR   EnsemblGenomes-Tr; EBT00001677099.
DR   EnsemblGenomes-Tr; EBT00001677100.
DR   EnsemblGenomes-Tr; EBT00001677101.
DR   EnsemblGenomes-Tr; EBT00001677102.
DR   EnsemblGenomes-Tr; EBT00001677103.
DR   EnsemblGenomes-Tr; EBT00001677104.
DR   EnsemblGenomes-Tr; EBT00001677105.
DR   EnsemblGenomes-Tr; EBT00001677106.
DR   EnsemblGenomes-Tr; EBT00001677107.
DR   EnsemblGenomes-Tr; EBT00001677108.
DR   EnsemblGenomes-Tr; EBT00001677109.
DR   EnsemblGenomes-Tr; EBT00001677110.
DR   EnsemblGenomes-Tr; EBT00001677111.
DR   EnsemblGenomes-Tr; EBT00001677112.
DR   EnsemblGenomes-Tr; EBT00001677113.
DR   EnsemblGenomes-Tr; EBT00001677114.
DR   EnsemblGenomes-Tr; Tmar_R0001-1.
DR   EnsemblGenomes-Tr; Tmar_R0002-1.
DR   EnsemblGenomes-Tr; Tmar_R0003-1.
DR   EnsemblGenomes-Tr; Tmar_R0004-1.
DR   EnsemblGenomes-Tr; Tmar_R0005-1.
DR   EnsemblGenomes-Tr; Tmar_R0006-1.
DR   EnsemblGenomes-Tr; Tmar_R0007-1.
DR   EnsemblGenomes-Tr; Tmar_R0008-1.
DR   EnsemblGenomes-Tr; Tmar_R0009-1.
DR   EnsemblGenomes-Tr; Tmar_R0010-1.
DR   EnsemblGenomes-Tr; Tmar_R0011-1.
DR   EnsemblGenomes-Tr; Tmar_R0012-1.
DR   EnsemblGenomes-Tr; Tmar_R0013-1.
DR   EnsemblGenomes-Tr; Tmar_R0014-1.
DR   EnsemblGenomes-Tr; Tmar_R0015-1.
DR   EnsemblGenomes-Tr; Tmar_R0016-1.
DR   EnsemblGenomes-Tr; Tmar_R0017-1.
DR   EnsemblGenomes-Tr; Tmar_R0018-1.
DR   EnsemblGenomes-Tr; Tmar_R0019-1.
DR   EnsemblGenomes-Tr; Tmar_R0020-1.
DR   EnsemblGenomes-Tr; Tmar_R0021-1.
DR   EnsemblGenomes-Tr; Tmar_R0022-1.
DR   EnsemblGenomes-Tr; Tmar_R0023-1.
DR   EnsemblGenomes-Tr; Tmar_R0024-1.
DR   EnsemblGenomes-Tr; Tmar_R0025-1.
DR   EnsemblGenomes-Tr; Tmar_R0026-1.
DR   EnsemblGenomes-Tr; Tmar_R0027-1.
DR   EnsemblGenomes-Tr; Tmar_R0028-1.
DR   EnsemblGenomes-Tr; Tmar_R0029-1.
DR   EnsemblGenomes-Tr; Tmar_R0030-1.
DR   EnsemblGenomes-Tr; Tmar_R0031-1.
DR   EnsemblGenomes-Tr; Tmar_R0032-1.
DR   EnsemblGenomes-Tr; Tmar_R0033-1.
DR   EnsemblGenomes-Tr; Tmar_R0034-1.
DR   EnsemblGenomes-Tr; Tmar_R0035-1.
DR   EnsemblGenomes-Tr; Tmar_R0036-1.
DR   EnsemblGenomes-Tr; Tmar_R0037-1.
DR   EnsemblGenomes-Tr; Tmar_R0038-1.
DR   EnsemblGenomes-Tr; Tmar_R0039-1.
DR   EnsemblGenomes-Tr; Tmar_R0040-1.
DR   EnsemblGenomes-Tr; Tmar_R0041-1.
DR   EnsemblGenomes-Tr; Tmar_R0042-1.
DR   EnsemblGenomes-Tr; Tmar_R0043-1.
DR   EnsemblGenomes-Tr; Tmar_R0044-1.
DR   EnsemblGenomes-Tr; Tmar_R0045-1.
DR   EnsemblGenomes-Tr; Tmar_R0046-1.
DR   EnsemblGenomes-Tr; Tmar_R0047-1.
DR   EnsemblGenomes-Tr; Tmar_R0048-1.
DR   EnsemblGenomes-Tr; Tmar_R0049-1.
DR   EnsemblGenomes-Tr; Tmar_R0050-1.
DR   EnsemblGenomes-Tr; Tmar_R0051-1.
DR   EnsemblGenomes-Tr; Tmar_R0052-1.
DR   EnsemblGenomes-Tr; Tmar_R0054-1.
DR   EnsemblGenomes-Tr; Tmar_R0055-1.
DR   EnsemblGenomes-Tr; Tmar_R0056-1.
DR   EnsemblGenomes-Tr; Tmar_R0057-1.
DR   EnsemblGenomes-Tr; Tmar_R0058-1.
DR   EnsemblGenomes-Tr; Tmar_R0059-1.
DR   EnsemblGenomes-Tr; Tmar_R0060-1.
DR   EnsemblGenomes-Tr; Tmar_R0061-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002344.
DR   SILVA-SSU; CP002344.
DR   StrainInfo; 118574; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085044
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Thermaerobacter marianensis 7p75a, DSM 12885
CC   collection_date     :: 1998
CC   lat_lon             :: Missing
CC   depth               :: 10897 m
CC   alt_elev            :: Missing
CC   country             :: Pacific Ocean
CC   environment         :: Mud
CC   num_replicons       :: Missing
CC   ref_biomaterial     :: DSM 12885, JCM 10246
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi03961
CC   Type Strain         :: Yes
CC   Funding Program     :: DOE-GEBA 2007
CC   Isolation Site      :: mud from the Challenger Deep in the Mariana
CC                          Trench at a depth of 10897m
CC   Isolation Comments  :: isolated by K Takai
CC   Motility            :: Nonmotile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Hyperthermophile
CC   Temperature Optimum :: 74-76CC
CC   Gram Staining       :: Gram+
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2844696
FT                   /organism="Thermaerobacter marianensis DSM 12885"
FT                   /strain="DSM 12885"
FT                   /mol_type="genomic DNA"
FT                   /country="Pacific Ocean"
FT                   /isolation_source="mud from the Challenger Deep in the
FT                   Mariana Trench at a depth of 10897 m"
FT                   /collection_date="1998"
FT                   /db_xref="taxon:644966"
FT                   /culture_collection="DSM:12885"
FT   gene            513..1892
FT                   /locus_tag="Tmar_0001"
FT   CDS_pept        513..1892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterPro IPR003593: IPR013159: IPR013317:
FT                   IPR001957: IPR 018312: IPR020591; KEGG: bbe:BBR47_00010
FT                   chromosomal replication initiation protein; PFAM:
FT                   Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; SPTR:
FT                   Chromosomal replication initiator protein dnaA; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50126"
FT                   /db_xref="GOA:E6SK02"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK02"
FT                   /protein_id="ADU50126.1"
FT                   /translation="MVKGELAEVWAEALQHIERQLTRPSYEAWLRNTRPVSLEGDRLVL
FT                   AVPNQFARDWVLERCSGAIVDSLRQVVGHAVRLEVVVEPQPAPAAAQTAATTEAPLAPP
FT                   PAAAASDAGSSWRTLSQPLNPKYTFDTFVTGSGNRLAHAAALAVAEAPARTYNPLFIYG
FT                   GVGLGKTHLMQAVAHHVLRKHGSRVAYVSCETFTNEMINAIRDGKTLEFRNRYRNVDVL
FT                   LVDDIQFLAGKESTQEEFFHTFNALHEANRQIVISSDRPPKEIPTLEERLRSRFEWGLI
FT                   SDIQPPDFETRVAILRKKAQLEKLRVPDDVIAFIAERIDTNIRELEGALIRLVAFASLT
FT                   NHHIDLDLAQEVLKDILPPPRANKVTIARIQEVVAEYYGVKVRDLKARRRTRAIAFPRQ
FT                   VAMYLCRELTEASLPRIGEEFGGRDHTTVLHAYEKIRHDLRNDPQLGRQIKELMDLIRK
FT                   G"
FT   gene            2217..3326
FT                   /locus_tag="Tmar_0002"
FT   CDS_pept        2217..3326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: sth:STH2 DNA
FT                   polymerase III beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50127"
FT                   /db_xref="GOA:E6SK03"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK03"
FT                   /protein_id="ADU50127.1"
FT                   /translation="MRLVIDQSDLHAALQVAIRGVATRSTLPVLSGILLVAEPEQLRLV
FT                   ATDMEMTVEVLAPARVQEEGSVVLPGRHLVEIVRRLPPGEVHLEVEGFRARILQERSRF
FT                   TIHGTDPGIFPAMPHISAGSTVLFDNGLLRNVLRRTTFAVSTDEGRPILTGVSFRAEGD
FT                   RLQAVATDGFRIAACSVTLERPVEGQPVAAVIPGRSLAEVARLLPDQGIGRLLLDETQA
FT                   GFQLGEVRLITRLVDGVYPDVLGLVPSEYPTRVQLPTRAFQEACERAALLADTRQPARW
FT                   VIRLAVEPGRLVITASDPELGEAREEIPAQVDGEGMVIGFNARYLVDGLKAIDTEEVLF
FT                   ELTEPLKASRLRGVGADDFTYIVLPVKIS"
FT   gene            3397..4599
FT                   /locus_tag="Tmar_0003"
FT   CDS_pept        3397..4599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COGs: COG1195 Recombinational DNA repair ATPase
FT                   (RecF pathway); InterPro IPR003593: IPR003395: IPR001238:
FT                   IPR018078; KEGG: ace:Acel_0003 recombination protein F;
FT                   PFAM: SMC domain protein; SMART: AAA ATPase; SPTR: DNA
FT                   replication and repair protein recF; TIGRFAM: DNA
FT                   replication and repair protein RecF; PFAM: RecF/RecN/SMC N
FT                   terminal domain; TIGRFAM: recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50128"
FT                   /db_xref="GOA:E6SK04"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK04"
FT                   /protein_id="ADU50128.1"
FT                   /translation="MVIRRVVLRQFRSYERATLELEPGLTLLVGPNGIGKTNLLEAIHF
FT                   AATGRSPRTSRDADLIRNGEPVCYVRVEWDDPVAGRRAVEMAYHREQGKALRLDGRKRR
FT                   RVADLHGALPVVYFAPESLALVKAGPAARRDYLDRLLVQVVPGYGPLLHDYQRVLAQRN
FT                   QLLREIRAGRAAASLLAIWDEPLLRHGTALRRHRQALLDELAPLVAAAAARVEAGGAVG
FT                   PGEVKLGYLAGDGPGDAAHEPGREEPSGAPEEAGDPGQRAAGVPPSLAAWHREEIARGT
FT                   TLWGPQRDDFAILLDGRDARAFASQGQQRALALALTLAEVHLIHRRLGRWPVLLLDDVL
FT                   SELDARRRRHLLETVAGLPQVIVTATDEPAWPEGMTPRVVPLPLPAAGRPGAAAPRGVG
FT                   P"
FT   gene            4707..6011
FT                   /locus_tag="Tmar_0004"
FT   CDS_pept        4707..6011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="InterPro IPR007922; KEGG: cya:CYA_2562 hypothetical
FT                   protein; PFAM: protein of unknown function DUF721; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF721)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50129"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK05"
FT                   /protein_id="ADU50129.1"
FT                   /translation="MRAGEGQAGPGLHRGSHPRTAGLRERPGAGGTSAGGPWRPLALGP
FT                   VLDGLLERLGLATQARRHRVLHLWDRVVGDAVAAHARPYRLEGDVLWVAVSHPGWAQEL
FT                   AFLKGIILRDLNAAAGAPVLRDVRFTAGPLRRGSPLGAPPRRGAVAASGSSAGTGAMER
FT                   PGGRRDGGRAASPARSPEQVSGPAGGPDAGLPAAASVSVGAAPASVARLADPDLRVAAG
FT                   RWLAAARRRREWALRRGWVACAGCGSLFPPQPGSPAGVTHPRPPGTGAAPAVGPPPAGD
FT                   RLPEQVPCAQRADAAGRRSGPVEGALCPSCRAAREERRRRQVRAILERDPWLTCPQVAA
FT                   VVGEPTAAVARLYREERAALQDLWRSRLRVAAARLRQGEPPPPETRSLLLRYALLRSGR
FT                   DPADLDPAAAREAVGARLAPLWDACFGSFARGGRR"
FT   gene            6038..6493
FT                   /locus_tag="Tmar_0005"
FT   CDS_pept        6038..6493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH5 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50130"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK06"
FT                   /protein_id="ADU50130.1"
FT                   /translation="MFLHIGSDVILPYREIVTILDAELLRHSPALRDLLALQELEKRVT
FT                   DVSGGQPRSLVVADRGLYLSPISVLTLRRRGSLRLDEQLGLAGEPAEPAAGTAREATVR
FT                   PVEPEAGAGGESGGAGGTTSRRRGRRPAGRRVDRRPRHGDGGNSPQT"
FT   gene            6838..8745
FT                   /locus_tag="Tmar_0006"
FT   CDS_pept        6838..8745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit; InterPro
FT                   IPR003594: IPR001241: IPR013506: IPR006171: IPR 002288:
FT                   IPR011557: IPR018522: IPR000565; KEGG: tjr:TherJR_0008 DNA
FT                   topoisomerase IV, B subunit; PFAM: DNA topoisomerase type
FT                   IIA subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain-containing protein;
FT                   DNA gyrase subunit B domain protein; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA topoisomerase
FT                   II; ATP-binding region ATPase domain protein; SPTR: DNA
FT                   topoisomerase IV, B subunit; TIGRFAM: DNA gyrase, B
FT                   subunit; PFAM: Toprim domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; DNA gyrase B; DNA gyrase B
FT                   subunit, carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50131"
FT                   /db_xref="GOA:E6SK07"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SK07"
FT                   /protein_id="ADU50131.1"
FT                   /translation="MARLGYDESQIQVLEGLEAVRRRPGMYIGSTGPRGLHHLIWEVVD
FT                   NAVDEALAGRCTAITVTLHADGSCSVRDNGGGIPVGIHPKVGKPTVEVVLTMLHAGGKF
FT                   DGQAYKVSGGLHGVGVSVVNALSEWLEVEVRREGRIHRQRYRRGKPDTDLEVVGTTDPA
FT                   DTGTYVRFKPDPEIFEETEFKYDVVVGRLREIALLNSGLYIELKDERTGERNLFQFMGG
FT                   LRSFVALLNRTKEPLHPEPISYKGERDGVEVEMALQWTTSYVETLYSFANTIHTHEGGT
FT                   HEAGFKMALTRVVNDYARKANLIKNGEENLSGDDIREGLTAVLSVKLPEPQFEGQTKTK
FT                   LGNSEVRGVVDSVTGEALATYFEENPQVARRVVEKAITAMRAREAARKARELTRRKSAL
FT                   EVTALPGKLTDCTVRDPAMAELFIVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVEKAR
FT                   LDKILAHDEIRALITAIGTGIGEDFDIQKARYHKIILMTDADVDGAHIRTLLLTFFFRY
FT                   MKPLIEAGYVYIAQPPLYLVRMGKEEHYFYDDDQLEAFFRQIGKRMPAQRFKGLGEMNA
FT                   EQLWETTMNPETRTLLQVTLEDAMAADQIFSILMGSRVEPRREFIEQHARKVRFLDTIG
FT                   "
FT   gene            8965..11397
FT                   /locus_tag="Tmar_0007"
FT   CDS_pept        8965..11397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit; InterPro
FT                   IPR002205: IPR006691: IPR005743; KEGG: tjr:TherJR_0009 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: DNA gyrase, A
FT                   subunit; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   domain, beta-propeller; TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50132"
FT                   /db_xref="GOA:E6SKE5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKE5"
FT                   /protein_id="ADU50132.1"
FT                   /translation="MAEYTHGKILPVDIEEEMKQSYIDYAMSVIVNRALPDVRDGLKPV
FT                   HRRILYAMREGGNTPDKPFKKSARTVGDVLGKYHPHGDAAVYDALVRMAQDFSMRYPLI
FT                   EGHGNFGSIDGDPPAAMRYTEARLSPLAMELMRDLDKDTVDFVPNFDETEQEPAVLPAR
FT                   FPNLLVNGAAGIAVGMATNIPPHNLREAIDGVIHLIDHPDAGDRDLMKVIKGPDFPTGG
FT                   IIVGREGIRQAYTTGRGIITIRAHAQIETSASGKTRIVVTEIPYEVTKSKIIEKIAELV
FT                   QERRIEGITDLRDETDRSGLRVVIELARGANPNVILNQLYKFTPMQVSYGIILLALVDG
FT                   QPRVLTLKQLLRHYLDHQKDVILRRTRHDLEKAEARAHILEGLRIALDHIDAVITLIRQ
FT                   SRTVDEARTGLMESFSLTEKQAQAILDMRLQRLTGLEREKVEEEYQELLKEIEYLRAVL
FT                   NSEKMVLDIIKQELAEIRDRFGDDRRTKIVSGAADFEVEDLIAEEDVVITLTHRGYIKR
FT                   MPVNTYRSQRRGGRGVTGIQTREEDFVAQLFIATTHENLLFFTNRGKVYHRRVHEIPEA
FT                   GRTARGTAVVNLIEIERDEQVTAVIPVRDFGEDRDLLMCTRRGVVKRTALAEFSHIRRG
FT                   GLIALALDPGDELVAVELTDGRGDVLVVTRLGQAIRFPVAEVRTMGRAARGVMGIRLDE
FT                   GDEVVGMEVADDEAHLLVITDLGFGKRTPVREFRAQGRGGKGIRAISLTARNGRVAGFE
FT                   VVRPGEEVMLISQGGIVLRVPVDQVSVQGRAAQGVTVMRLEPGDRVSAVATVAHKGD"
FT   gene            11527..12609
FT                   /locus_tag="Tmar_0008"
FT   CDS_pept        11527..12609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0008"
FT                   /product="AIR synthase related protein"
FT                   /note="COGs: COG0309 Hydrogenase maturation factor;
FT                   InterPro IPR000728: IPR010918: IPR011854; KEGG:
FT                   tsi:TSIB_0767 hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; SPTR: Hydrogenase
FT                   expression/formation protein HypE; PFAM: AIR synthase
FT                   related protein, N-terminal domain; AIR synthase related
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50133"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKE6"
FT                   /protein_id="ADU50133.1"
FT                   /translation="MQPDRPQDVTAAPADEAGAPLPEGKLPAALLERLVLPRTGVQRRE
FT                   VVLAAAPGEDAAALDLGGDLCVAASDPITGAGHHAGWLAVHVNCNDVAATGAEPVAVLL
FT                   TILLPPGSPPAVLEDIMAGAHAAAREVGCQIAGGHTEVTPGLAQPLVVATALGRTPAAR
FT                   LVPSGGARPGDVLLLTKWAGLEGTAILAADCREALARRGVPEAVLDAAAELGRWLSIVP
FT                   EARVAAGRGARAMHDVTEGGVLGATWEMVTAARQALGQAVGCVIEAAAIPVRDETRAIC
FT                   AAAGVDPLRLIGSGALLVAAPPETAAALQAAWAEAGIPAAAIGRITGDGILRLIDAGGH
FT                   ETELEPPGTDALWVARTRLA"
FT   gene            12697..13974
FT                   /locus_tag="Tmar_0009"
FT   CDS_pept        12697..13974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0009"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COGs: COG0172 Seryl-tRNA synthetase; InterPro
FT                   IPR015866: IPR002314: IPR002317: IPR006195: IPR 018156;
FT                   KEGG: adg:Adeg_0011 seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Seryl-tRNA synthetase,
FT                   class IIa-like; PRIAM: Serine--tRNA ligase; SPTR:
FT                   Seryl-tRNA synthetase; TIGRFAM: seryl-tRNA synthetase;
FT                   PFAM: tRNA synthetase class II core domain (G, H, P, S and
FT                   T); Seryl-tRNA synthetase N-terminal domain; TIGRFAM:
FT                   seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50134"
FT                   /db_xref="GOA:E6SKE7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKE7"
FT                   /protein_id="ADU50134.1"
FT                   /translation="MLDLRFVRQNPEVVREALRRRRLDPAELDALLDADARWRQDLQQL
FT                   EELRARRNQTSEAIGRLRREGADASELIAAMRQVGDSIKELEERVRGLEQEIQDRLLRI
FT                   PMIPDPDVPEGDDADDNVEVRRWGTPPSFDFTPKAHWELGPALGLLDFERAAKITGARF
FT                   TVFRGRGARLVRALIQFMLDLHTQEHGYTEVLPPFLVHRQSMVGTGQLPKFEEDAFRVA
FT                   DSDFFLVPTAEVPVTNLYRDEILDGAQLPIYHVAYTPCFRAEAGSAGRDTRGLIRQHQF
FT                   DKVELVKFVHPDRSAEEHEKLVADAEAVLQRLGLPYRLVLICTGDMGFAQAKQYDLEVW
FT                   MPSYGRYVEISSCSNYRDYQARRANIRFRPEPGARPQFVHTLNGSGLAVGRTLAALLEN
FT                   YQQADGSVVIPEALRPYMGGLDVLKP"
FT   gene            14088..14175
FT                   /locus_tag="Tmar_R0001"
FT   tRNA            14088..14175
FT                   /locus_tag="Tmar_R0001"
FT                   /product="tRNA-Ser"
FT   gene            complement(14220..14489)
FT                   /locus_tag="Tmar_0010"
FT   CDS_pept        complement(14220..14489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0010"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR020390; KEGG: pth:PTH_1815 hypothetical
FT                   protein; SPTR: Hypothetical membrane protein; PFAM: Protein
FT                   of unknown function (DUF2619)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50135"
FT                   /db_xref="GOA:E6SKE8"
FT                   /db_xref="InterPro:IPR020390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKE8"
FT                   /protein_id="ADU50135.1"
FT                   /translation="MVSPNPYVAGMALTRVLSGSLEVLAAVLIWRYGRVDRALEINALL
FT                   AGAGPLAMMLATTIGLAGLAGSVPPLKLALILAGVALILIGTRI"
FT   sig_peptide     complement(14415..14489)
FT                   /locus_tag="Tmar_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            14648..14742
FT                   /locus_tag="Tmar_R0002"
FT   tRNA            14648..14742
FT                   /locus_tag="Tmar_R0002"
FT                   /product="tRNA-Ser"
FT   gene            14770..14847
FT                   /locus_tag="Tmar_R0003"
FT   tRNA            14770..14847
FT                   /locus_tag="Tmar_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(14938..16047)
FT                   /locus_tag="Tmar_0011"
FT   CDS_pept        complement(14938..16047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0011"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: dev:DhcVS_1463 site-specific
FT                   recombinase, phage integrase family; PFAM: integrase family
FT                   protein; SPTR: Site-specific recombinase, phage integrase
FT                   family; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50136"
FT                   /db_xref="GOA:E6SKE9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKE9"
FT                   /protein_id="ADU50136.1"
FT                   /translation="MIRKRGKDYWEIRVDIGRDPKTGKRLWKYTSVRGTKRDAERVEQQ
FT                   LKARHMQGELTAVRMTVDELLDEWLAHVRTNREGRTYDDYAYCTRRIRAAFGPMRVDRL
FT                   TRAQIQRWLDELQQAPRDDGRPGNLSATTVQKHHRALHAALSYAVRMGYLGYNPADNLT
FT                   LPRRQRSEPPMLTREQLEQLLEAALGTRWYPLWYVAAHTGLRVGELCGLWWEDIDWSRP
FT                   AIRVRRALKQDREGKRLILGDVKNHEARVVWLDDRTAEVLDRHRAEQQLEIARAQRWEH
FT                   PEHVFTAPGGRFLRPDVPTQVLRKHAKRLGLPPLSMHDLRHIHGSHLLQYHGWSITAVS
FT                   ERLGHYSPAFTAEVYAHVIPGAQEGYLRR"
FT   gene            16087..16163
FT                   /locus_tag="Tmar_R0004"
FT   tRNA            16087..16163
FT                   /locus_tag="Tmar_R0004"
FT                   /product="tRNA-Ala"
FT   gene            complement(16322..16984)
FT                   /locus_tag="Tmar_0012"
FT   CDS_pept        complement(16322..16984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dau:Daud_0705 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50137"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF0"
FT                   /protein_id="ADU50137.1"
FT                   /translation="MAYKTSEVMEVFLDESGALRATEPFYAGLWITWQGDKWRTMVSDQ
FT                   RAAEAFFKEFHFHKISRNPNDWRYRFGRRIARKFIYKNWYARLLHVPGDKLDQWRRMNR
FT                   RDIYDTLLTELLVKFAPHIPEPRIVITIDERNRPKDDDYLPVGIEAILRDVLPHKQIEV
FT                   RLASSSNEDLLQVVDLLVGAVRQLKYPSGNQNKKALARLIQPYTIGEKPRVWVWDWS"
FT   gene            complement(17320..17802)
FT                   /locus_tag="Tmar_0013"
FT   CDS_pept        complement(17320..17802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0013"
FT                   /product="protein of unknown function DUF955"
FT                   /note="InterPro IPR010359; KEGG: drm:Dred_0494 hypothetical
FT                   protein; PFAM: protein of unknown function DUF955; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50138"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF1"
FT                   /protein_id="ADU50138.1"
FT                   /translation="MERLLQMAATEGILVEYVPLLPSKGLLGLYLRTPHGAAIVLDSSL
FT                   PANPRLERCVMAEELGHHFTVPVTSTFVACTSATARTSYRRDEARALRWACDHLMPLDQ
FT                   FLQAMREGVSTVEELADYFYVTPWMVHARFRFLPSHLCRCLLLCRELTCLGCPEAA"
FT   gene            complement(17771..18166)
FT                   /locus_tag="Tmar_0014"
FT   CDS_pept        complement(17771..18166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0014"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: tit:Thit_1413
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50139"
FT                   /db_xref="GOA:E6SKF2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF2"
FT                   /protein_id="ADU50139.1"
FT                   /translation="MQFADRLRKMREARGLTQRELATAIGVSRQAIGLYEAGEREPDLT
FT                   TIQKLAHVLRTSISYLVGETDDPSPLPRSGVAAHREGTDPGDPLDPEVQLIMERAFREI
FT                   SRKLEEKWRQRQQGESQGGEASPNGRH"
FT   gene            18324..18545
FT                   /locus_tag="Tmar_0015"
FT   CDS_pept        18324..18545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0015"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: gym:GYMC10_5352
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50140"
FT                   /db_xref="GOA:E6SKF3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF3"
FT                   /protein_id="ADU50140.1"
FT                   /translation="MKRENWVQLRKARGWTQYDVARMLGISRARYSQYELGLRNPPIDV
FT                   AIRLADLFGVPIQELFPTSQPGHARQAS"
FT   gene            18862..19359
FT                   /locus_tag="Tmar_0016"
FT   CDS_pept        18862..19359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0016"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="InterPro IPR001387; KEGG: tmt:Tmath_0051
FT                   transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50141"
FT                   /db_xref="GOA:E6SKF4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF4"
FT                   /protein_id="ADU50141.1"
FT                   /translation="MHVAIGRMMAEARQRAGLTQEQAAPRLAVSRRALAYYEAGERTPP
FT                   PEVVRAAARAYQAPELLVALAGETPLVGVAMEDDPLEAVGWLREELREALEAAERAEAM
FT                   LRRGEPTPEVDEQIYDLTTALASYLVARGRQGLDLEALARQHRRKIADRYLRRHRPEGV
FT                   AA"
FT   gene            19356..19580
FT                   /locus_tag="Tmar_0017"
FT   CDS_pept        19356..19580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_3283 carbamoyltransferase; SPTR:
FT                   Carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50142"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF5"
FT                   /protein_id="ADU50142.1"
FT                   /translation="MRLEVERYPMILTTPQVHEMLGRQIGINRLRELARQQPRELGVKW
FT                   HGRRILWDRDRVLAWWDKQLRYAGGRLSA"
FT   gene            19595..19948
FT                   /locus_tag="Tmar_0018"
FT   CDS_pept        19595..19948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0671 peptidase A24A domain protein;
FT                   SPTR: Peptidase A24A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50143"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF6"
FT                   /protein_id="ADU50143.1"
FT                   /translation="MRDVVIRIGGRRYRYVGRRKKIERTPAPAERITAIGGRCPRCGSE
FT                   WLRGDGDPVIRYRTTRYPVWCERCGARAVMAWPTSPALRDLYCAERVGVDVATFRRYRD
FT                   AARKLWEDDRHGA"
FT   gene            19938..20453
FT                   /locus_tag="Tmar_0019"
FT   CDS_pept        19938..20453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hla:Hlac_3126 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50144"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF7"
FT                   /protein_id="ADU50144.1"
FT                   /translation="MVHEAAMATSSCSRCGRPLKDPRSRAMGMGPVCAARARDDKAMSM
FT                   LPPGSPVVTVNGRHLHHVVRHSPTGMEWGYGGSGPADLARSILLDYLSRCGSGLRVRAM
FT                   PGARLGKRGRERLVDQLYQAFKWDFVARFPYESWRLTGPEIAAWLMQTGLIESVPALPV
FT                   TYEGRRTA"
FT   sig_peptide     19938..20039
FT                   /locus_tag="Tmar_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            20450..20881
FT                   /locus_tag="Tmar_0020"
FT   CDS_pept        20450..20881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6557 chitinase II; SPTR: Putative
FT                   transcriptional regulator (HTH-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50145"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF8"
FT                   /protein_id="ADU50145.1"
FT                   /translation="MTTCSTCGAEIVPGDIAYADPHDSTTLYCSADCLADACATTVIVD
FT                   EEEHLPYHGGPTWTYDQAVEGLRRYLYLHDRLLTIARAWRLIAEEKHRDGRHMEAVSLQ
FT                   SCAAQIEDALADAVDRARGVVAPADLGSGLPAGADAGNR"
FT   gene            20917..21873
FT                   /locus_tag="Tmar_0021"
FT   CDS_pept        20917..21873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0021"
FT                   /product="phage-type endonuclease"
FT                   /note="COGs: COG5377 Phage-related protein predicted
FT                   endonuclease; InterPro IPR019080: IPR017482; KEGG:
FT                   tit:Thit_1407 phage-type endonuclease; PFAM: YqaJ viral
FT                   recombinase family; SPTR: Phage-type endonuclease; TIGRFAM:
FT                   phage-type endonuclease; PFAM: YqaJ-like viral recombinase
FT                   domain; TIGRFAM: putative phage-type endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50146"
FT                   /db_xref="GOA:E6SKF9"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKF9"
FT                   /protein_id="ADU50146.1"
FT                   /translation="MATAKVLVRTAGMDRATWLAWRRRGIGGSDAPAVAGLDPLRSPLA
FT                   LWMEKTGQMEPEEPGESALWGTLLEPVIVEEWERRTGKKARRRNAILQHPEQPFMLANL
FT                   DREVVGERALLEIKTTAAWHGHEIGEDRLPDRYVVQAQHYLAVTGYERCYFAVLVGGQH
FT                   LVTTYVDRDEELISYLVEMERDFWRCVETCTPPAPGGSDLDRAILQRLYPDVEPDSVVD
FT                   LPEEAAEWLRVYREAHAAERAATARKQEAANRLRSLLGGHELGRIGGEVVVRQRQIMQK
FT                   RLDTKRLKSERPDVYDAYLTEAVQRRLEVLGGNEEGA"
FT   gene            21875..22801
FT                   /locus_tag="Tmar_0022"
FT   CDS_pept        21875..22801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0022"
FT                   /product="RecT protein"
FT                   /note="COGs: COG3723 Recombinational DNA repair protein
FT                   (RecE pathway); InterPro IPR018330: IPR004590; KEGG:
FT                   gyc:GYMC61_0604 recombination and repair protein RecT;
FT                   PFAM: DNA single-strand annealing protein RecT-like; SPTR:
FT                   RecT protein; TIGRFAM: RecT protein; PFAM: RecT family;
FT                   TIGRFAM: recombinase, phage RecT family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50147"
FT                   /db_xref="GOA:E6SKG0"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG0"
FT                   /protein_id="ADU50147.1"
FT                   /translation="MAVQTDQVRNKLARRAQENGAPAPSQQPKTIEQWLRDERFRAEIE
FT                   RALPRHLSADRLLRITLTVLRTTPELRRCTVPSLLAAVLQCAQLGLEPGVLGHVYLVPF
FT                   KNGKTGEYEVQVIIGYKGWVELARRSGQIQSLTARVVYQNDEFELSFGIEDNLRHVPWY
FT                   MRPNVQDGGPIRGAYSVARFKDGGYHLHYMPIQQIEARRKRSRAADSGPWKTDYEAMVL
FT                   KTVVRDASKWWPLSPEIARGLAQDESIKRTVDDVDSDAPYFGEDVIDVQGEDVGEGGED
FT                   AAHEEGGDASAGGDGSAQFGLFGGGGQ"
FT   gene            22838..23362
FT                   /locus_tag="Tmar_0023"
FT   CDS_pept        22838..23362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0023"
FT                   /product="rare lipoprotein A"
FT                   /note="COGs: COG0797 Lipoprotein; InterPro IPR005132:
FT                   IPR012997; KEGG: rxy:Rxyl_0971 rare lipoprotein A; PFAM:
FT                   Rare lipoprotein A; SPTR: Rare lipoprotein A; TIGRFAM: rare
FT                   lipoprotein A; PFAM: Rare lipoprotein A (RlpA)-like
FT                   double-psi beta-barrel; TIGRFAM: rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50148"
FT                   /db_xref="GOA:E6SKG1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG1"
FT                   /protein_id="ADU50148.1"
FT                   /translation="MWDEWPPDRQLRWMIWLWIAALWAAVIATAVFGERALGTTGHGPA
FT                   DADQASAAQEPAIDPAPPADRSVSRRHARTASAGEWQTWTASWYGEESGSVTASGERFD
FT                   PQAMTAAHRTLPFGTRLEVCYGGRCVVVRVNDRGPYVPGRDLDLSRGAAEALGMTEAGV
FT                   APVQVRIVGEE"
FT   sig_peptide     22838..22978
FT                   /locus_tag="Tmar_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            23368..23919
FT                   /locus_tag="Tmar_0024"
FT   CDS_pept        23368..23919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dba:Dbac_3056 efflux transporter, RND family,
FT                   MFP subunit; SPTR: Efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50149"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG2"
FT                   /protein_id="ADU50149.1"
FT                   /translation="MMVGIGGEGYVRADEVVAILGPMTAEDARQVTPLAFRVDGPDAMV
FT                   VLRSGQIVPAYLSPQTIRKRVEKALRGQEVARTSAAKVERALLAAYEAMNYMGDILNDM
FT                   DAVTAKDEAYLNQRFKVVRSVLGEQKLEIREVRLERGQTLFVLYDDPHSDMVREAWITC
FT                   EDLDRLMDGVPHGAAPQDND"
FT   gene            24219..24452
FT                   /locus_tag="Tmar_0025"
FT   CDS_pept        24219..24452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0025"
FT                   /product="DNA polymerase gamma"
FT                   /note="KEGG: ure:UREG_04994 DNA polymerase gamma; SPTR: DNA
FT                   polymerase gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50150"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG3"
FT                   /protein_id="ADU50150.1"
FT                   /translation="MDIRELVQAMDRRGKHIRGTGVWRENRELLVIACMACGREWFCWS
FT                   PPPANWWLEVGRDCEHCGDAGDMDAVSGGARR"
FT   gene            24457..24810
FT                   /locus_tag="Tmar_0026"
FT   CDS_pept        24457..24810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: adg:Adeg_1839 transposase; SPTR: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50151"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG4"
FT                   /protein_id="ADU50151.1"
FT                   /translation="MPSKIEHHAQVGDLVLASRTRTVWYQDRIERTSRWYLFRVELVDR
FT                   KGRVRALREHDSYHANPVMTVDSPIYVVSRDQFDVDTAMAAYAQEHPEGFDSFEEAREF
FT                   LRRFLKAADAKEG"
FT   gene            24812..25123
FT                   /locus_tag="Tmar_0027"
FT   CDS_pept        24812..25123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_0209 hypothetical protein; SPTR:
FT                   ORF18"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50152"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG5"
FT                   /protein_id="ADU50152.1"
FT                   /translation="MADPKWTPGPWELCRLSDRALAVKKAGETWGNCGIAIVLSDNREA
FT                   DGHLITAAPDMYEACEAALLAIETNPIDRFLTPEEVDAVEKLQAALRKARGEQEEGDA"
FT   gene            25120..25392
FT                   /locus_tag="Tmar_0028"
FT   CDS_pept        25120..25392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0984 protease Do; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50153"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG6"
FT                   /protein_id="ADU50153.1"
FT                   /translation="MIPIGTEVEWVSQSQGWWTVKRGIVIAHLEPGQPVETVLPPGTDR
FT                   RHVRGNRISKHRRYVVAVKRPKGKVTYYYTPVAEWLENGVASKDG"
FT   gene            25515..26714
FT                   /locus_tag="Tmar_0029"
FT   CDS_pept        25515..26714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0029"
FT                   /product="HNH endonuclease"
FT                   /note="InterPro IPR003615: IPR002711; KEGG: dsy:DSY2199
FT                   hypothetical protein; PFAM: HNH endonuclease; SMART: HNH
FT                   nuclease; SPTR: Primosome, DnaD subunit; PFAM: HNH
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50154"
FT                   /db_xref="GOA:E6SKG7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG7"
FT                   /protein_id="ADU50154.1"
FT                   /translation="MAWIESHQSLKDHPKTRRLARRLGISVPAAIGHLHCLWWWALEYA
FT                   QDGSLAQYDADDIADAMMWDGDSQQLVQALVHAGFLDETGDGLRIHDWRDYAGRLIEQR
FT                   ERAAARKREMRQAYEDGVIDQVRARDGSICRYCGKTVNWKDRRGPDGGTYDHIDPNGPS
FT                   TVDNLVVCCRSCHSRKGARTPQEAGMRLLPPGKHQVRSRSVPDPNQNGTGTNLPTVTVT
FT                   QTGEENNPPPPLRGASPHGGDARPADRGATNPPDEQSGRVRRMIPHEAIKDAWNEICGA
FT                   AGLPRVQVLSAKRRQYLTARCTELARYFGEQVYTVDWWRGVFHRVRGSPFCMGAGGRGW
FT                   RATFDWLIERREAVVRLIEGHYDRVADAQTAFERTREQFQPGRTDEDFAGWRKRGGGST
FT                   "
FT   gene            26711..27454
FT                   /locus_tag="Tmar_0030"
FT   CDS_pept        26711..27454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0030"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="COGs: COG1484 DNA replication protein; InterPro
FT                   IPR003593: IPR002611; KEGG: rxy:Rxyl_0041 hypothetical
FT                   protein; PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; SPTR: Putative primosomal protein DnaI;
FT                   PFAM: IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50155"
FT                   /db_xref="GOA:E6SKG8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG8"
FT                   /protein_id="ADU50155.1"
FT                   /translation="MNAAEWFERTYGVPAPRLVYALPTEVAMVTHLYCPDCPGLDHCRS
FT                   PVRGMQCHYCPEESHEYPVFRWQPCPHELMRIVDEHLGRRFARRQFATFRRTPANEEAY
FT                   WRARAYVEAYVPGETGTGLIFVGPPGTGKTHLAAATLREIVRTRGERDFAWVHVPSKLD
FT                   RLEAYAERRLLVLDDLTGTTWSPQAQRQLYVLINRRYEAELPTIVTANMGKERMERLFG
FT                   ADLVDRLNEMCEPCMTGGVSWRSVA"
FT   gene            27554..27994
FT                   /locus_tag="Tmar_0031"
FT   CDS_pept        27554..27994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0031"
FT                   /product="VRR-NUC domain-containing protein"
FT                   /note="InterPro IPR014883; KEGG: abn:AB57_3238 hypothetical
FT                   protein; PFAM: VRR-NUC domain-containing protein; SPTR:
FT                   PmgM; PFAM: VRR-NUC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50156"
FT                   /db_xref="GOA:E6SKG9"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKG9"
FT                   /protein_id="ADU50156.1"
FT                   /translation="MPRELTMMDEHEMQGCGVMPVRRMTLPIPTEDEEQRVVVQWLQLH
FT                   GILFAHVPNGGYRRRVEAAIFRGLGVQPGVPDLLIFDPPPAAPDRRGVALELKRRQGGR
FT                   LTEPQRQWLEALRARGWYATVCRGADEAIETLERLGYGRRSA"
FT   gene            27991..28221
FT                   /locus_tag="Tmar_0032"
FT   CDS_pept        27991..28221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cwo:Cwoe_1723 ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; SPTR: TfuA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50157"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH0"
FT                   /protein_id="ADU50157.1"
FT                   /translation="MIRVWRPWQPVRVGDVYQPVARVLKVRKGRPTVIEIDGERYVWMP
FT                   RSMYMGPGAKHGASGGGGNRPAEGNADGMAG"
FT   gene            28205..28393
FT                   /locus_tag="Tmar_0033"
FT   CDS_pept        28205..28393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1978 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   small protein (DUF2292)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50158"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH1"
FT                   /protein_id="ADU50158.1"
FT                   /translation="MEWRDESRPCERVDGDPSERARIKALARVEAALRQLRYGRVVVTV
FT                   QDGRPMIVEVVEQEKIA"
FT   gene            28481..29089
FT                   /locus_tag="Tmar_0034"
FT   CDS_pept        28481..29089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0034"
FT                   /product="Sigma-70 region 4 type 2"
FT                   /note="InterPro IPR013249; KEGG: gtn:GTNG_2832 positive
FT                   control sigma-like factor; PFAM: Sigma-70 region 4 type 2;
FT                   SPTR: Prophage LambdaBa01, positive control factor Xpf;
FT                   PFAM: Sigma-70, region 4; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50159"
FT                   /db_xref="GOA:E6SKH2"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH2"
FT                   /protein_id="ADU50159.1"
FT                   /translation="MWPDLQPLIEEYRDSLRRVRRAWERATEPADRQIMSSMARDLEWT
FT                   IEYMRTGWPPQPDERSRSWRKARVVPVDPLVMQAIVWQHNRIVERAAMHGVDLTVFDRP
FT                   ERHRTTAAERSALEAVLQDLTAEERDVFVLIAGNRYSEREAARLMGRSQTWVRLRYGSA
FT                   YRKVMERARGITAALISERDSRAGGGGHGPHAARPGRAS"
FT   gene            29052..29510
FT                   /locus_tag="Tmar_0035"
FT   CDS_pept        29052..29510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0035"
FT                   /product="Tb-291 membrane-associated protein"
FT                   /note="KEGG: tcr:509269.4 Tb-291 membrane-associated
FT                   protein-like; SPTR: Tb-291 membrane-associated
FT                   protein-like, putative; PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50160"
FT                   /db_xref="GOA:E6SKH3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH3"
FT                   /protein_id="ADU50160.1"
FT                   /translation="MARTQRVPDEHRREIAEALVAGASAAELARQYGYHRATIYRIARE
FT                   AGINMVDVRTQQATRARRDYDKARRLQLLNQGFEAAAAILPEIRKPHQLRDWAIAVATL
FT                   VDKRRLEDGEATERTEVSSVGARERLAERLDELARRRLAREQTGRAAG"
FT   gene            29527..30759
FT                   /locus_tag="Tmar_0036"
FT   CDS_pept        29527..30759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0036"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG5323 conserved hypothetical protein; KEGG:
FT                   xau:Xaut_3704 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Terminase-like family;
FT                   TIGRFAM: phage uncharacterized protein (putative large
FT                   terminase), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50161"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH4"
FT                   /protein_id="ADU50161.1"
FT                   /translation="MAELSDEEAEALLYDWRFWARPKQLPPEGPWRIWLILAGRGFGKT
FT                   RTGAEWVREQVERHGRRRIAIVGRTAADVRDVMVEGESGILSISPPWFRPVYEPSKRRL
FT                   TWPNGAIATLYSADEPDLLRGPQHDAAWADELAAWRRPEAWDNLMFGLRLGPDPRVVVT
FT                   TTPRPVKLIRDLLNDPTCVVTRGSTYENAANLAPAFLEQIISRYEGTRLGRQELYGEVL
FT                   DDVPGALWQRKRIDELRVREAPELVRVVVAIDPAVTSEEGSDETGIVVAGRGVDGDAYV
FT                   LADRSCRMSPDGWARRAVKAYYDFDGDRIVGEVNNGGDLVETVIRTVDPKVPYKAVRAS
FT                   RGKAVRAEPVAALYEQGKVHHVGTFDHLEDQLCQITPDGYQGAGSPDRADALVWALTEL
FT                   MLEDYAEPDIF"
FT   gene            30778..33027
FT                   /locus_tag="Tmar_0037"
FT   CDS_pept        30778..33027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0037"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="COGs: COG4695 Phage-related protein; InterPro
FT                   IPR006944: IPR006528: IPR006427; KEGG: pla:Plav_0903 HK97
FT                   family phage portal protein; PFAM: portal protein; head
FT                   morphogenesis protein SPP1 gp7; SPTR: Phage portal protein,
FT                   HK97 family; TIGRFAM: phage portal protein, HK97 family;
FT                   phage head morphogenesis protein, SPP1 gp7 family; PFAM:
FT                   Phage portal protein; Phage Mu protein F like protein;
FT                   TIGRFAM: phage putative head morphogenesis protein, SPP1
FT                   gp7 family; phage portal protein, HK97 family; phage portal
FT                   protein, PBSX family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50162"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH5"
FT                   /protein_id="ADU50162.1"
FT                   /translation="MKLRDRLRVLFTGRLPIDVFVDQAYERVKQVAGGTVVSPGVARWP
FT                   EDGYANWAREAYGKNELVYACITEIATSVPEAPLRIYRDTAAGWEEVPDHPLRQLIRRP
FT                   NPVLSEYELWELTVVHLYLAGNAYWEIVRSRDGRPKELWPLRPDRVRIIPDPDPRIHHT
FT                   YAYAVDGQLYPLGTDVLHFKFPNPLDEYFGQPPLRAAVRAVAVDNEATAYVQSLLQNDA
FT                   MPRVIVTTQQKLDEDTVERLRSRWRERYGRENRGMPAFLQAGMDVKVLGLNLKDLEFPD
FT                   LRATSESRICAAFGVPPVLVGAKVGLDRSTFANYSEARRSFWEETISPLLRRLADRINH
FT                   KLLPMFRDSEGLEARFDTSEVSALQESVNEKWRRITEAVEAGWLMVDEARAEAGYDPFP
FT                   DGRGRVLLRPTSVAEVPVGGGGEDGGGGGEPGDDEAPARRPRPTPGGDEGGLGEPGDTP
FT                   GAEPSTPTEDGPPPGGDGEPGKQRSGPRRILKSREAIAESRNRLADRYERRWREWAREE
FT                   FQAEARDTLRAFWLATTGRRFKALADDELMEFLTTLEQMGISWRQRIQDGSAELIYEQL
FT                   VDAAGEAGSELDVAFQLNNDFAKRFVERYVFIFAQALSRASQDRIREIILAGQRDGLTI
FT                   NEMKRRLLEEFDDWTAARAERVARTETLRASNAGAMMAYQQAGVQVVEWLPAGDACPYC
FT                   KALKGRRWAVGSALFQVGDEWHPEGVERPYRITYEPVQHPPLHPHCRCTIVPVVD"
FT   gene            33041..34471
FT                   /locus_tag="Tmar_0038"
FT   CDS_pept        33041..34471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0038"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="InterPro IPR006433; KEGG: sro:Sros_3378 hypothetical
FT                   protein; PFAM: peptidase U35 phage prohead HK97; SPTR:
FT                   Mu-like prophage I protein-like protein; TIGRFAM: phage
FT                   prohead protease, HK97 family; PFAM: Caudovirus prohead
FT                   protease; TIGRFAM: phage prohead protease, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50163"
FT                   /db_xref="GOA:E6SKH6"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH6"
FT                   /protein_id="ADU50163.1"
FT                   /translation="MPTRGYPTEFKTVSFSLTRFDESAGTVEGYASTWDRDEDGDVIVK
FT                   GAFKKTIQERVPAGKVKLLDSHRWDSQHVLGTVVEAREEDHGLWIKAIFSGSAEAQAVR
FT                   QKVLEGHLTAFSIGFESLRDEIKADEQGRPTRYIYEVKLYEVSIVPFPANENAVIMAAK
FT                   QANGSGRAGMDKPIEPLFPPGTRVRLLVPPHIEGQPTEAIVREAVVGVAYGLLFEGDST
FT                   IHRWYVESELAPADGGQAEGHSAGHKYKGVVPFQDLPLADRDRPWDADAAVQRVRRWAS
FT                   RDGSGEKDTIDWARYRRAFVWYDSSNAEHFGSYKLPVADVIDGQLRAVPRAIFAAAAAV
FT                   QGARGGVDIPASDLPAVRNHLARYYRKMGETPPWEQDSLDLIVAEVKAGRRNSQADFER
FT                   IAGAISLLWEALNDDEKAQVMERLGLAPAAGPDETPPTDGGEVKGEATEPPTEDASALM
FT                   AALEVLDAELDLLETEVA"
FT   gene            34474..35748
FT                   /locus_tag="Tmar_0039"
FT   CDS_pept        34474..35748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0039"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="COGs: COG4653 phage phi-C31 gp36 major capsid-like
FT                   protein; InterPro IPR006444; KEGG: lga:LGAS_1485 phage
FT                   phi-C31 GP36 major capsid-like protein; SPTR: Phage major
FT                   capsid protein; TIGRFAM: phage major capsid protein, HK97
FT                   family; PFAM: Phage capsid family; TIGRFAM: phage major
FT                   capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50164"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH7"
FT                   /protein_id="ADU50164.1"
FT                   /translation="MDLKELVGKARQRVEEARRIVEEYAGKAMPADVKEQVDRLLAEAK
FT                   ELKAQADRAAEVQKLQAWLDEPQYRRPMNEGAAKALAPEDEPAEDGGLSEAQKKKQTRA
FT                   FFKALRGGLGVLTREERELLNPARKGLVATKALVEDAAGEILVPEEVEAEIYRRLPKLT
FT                   VIRPLATVRTTGSNRVRRRSLTELQVGWGKLETGTALVQSTPQPGEEYTYVEDLYGLTL
FT                   VGEDELDDTDVNLTSFVADSFAQAIAEAEDTAFIAGTGHANQQPEGILNAADVPTVAAG
FT                   QTAAITTDDILTLIYKVPAQHRRNGVLIANPETVLRLRLLKTTDGQYLWQPSLVAGQPD
FT                   TFAGYPVYDSVDVPTIPTTAGQTNKVAIFGDVRSGYRILDRQGMTVKVLQERYADQGLI
FT                   GYRVRYRVGGSVVRPEAFAILTVAA"
FT   gene            36032..36577
FT                   /locus_tag="Tmar_0040"
FT   CDS_pept        36032..36577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0040"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR011738; KEGG: pla:Plav_0908 phiE125 gp8
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: phage conserved hypothetical protein,
FT                   phiE125 gp8 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50165"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR036558"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH8"
FT                   /protein_id="ADU50165.1"
FT                   /translation="MPQLVTLAEAKSLLQSPAEDDGLVSDLIERASAAVESYTRRRILH
FT                   AKVLDLLPGGSKALVLRYRPVVSVEQVVDLESQQAVSTEDYVIDSRAGLILRRRGKWPK
FT                   GDLRWEVRYTAGYAATVDDVPADIKQAVLLLVQTWYQRRDPAIQQERIGDYSYTLADRR
FT                   GWPDAVQDLLAPYVEVVV"
FT   gene            36578..36811
FT                   /locus_tag="Tmar_0041"
FT   CDS_pept        36578..36811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_26870 hypothetical protein;
FT                   SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50166"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKH9"
FT                   /protein_id="ADU50166.1"
FT                   /translation="MGESRNVIHLQVKVRPAVYAGLVQAVLAAAVRAGLLSPAKALDWF
FT                   WRIYRRTARVCVEPVQVNTTLKVVLDGAAPAE"
FT   sig_peptide     36578..36700
FT                   /locus_tag="Tmar_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            36792..37112
FT                   /locus_tag="Tmar_0042"
FT   CDS_pept        36792..37112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0042"
FT                   /product="phage head-tail adaptor"
FT                   /note="InterPro IPR008767; KEGG: avi:Avi_1340 hypothetical
FT                   protein; SPTR: Gp30; TIGRFAM: phage head-tail adaptor;
FT                   PFAM: Phage head-tail joining protein; TIGRFAM: phage
FT                   head-tail adaptor, putative, SPP1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50167"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI0"
FT                   /protein_id="ADU50167.1"
FT                   /translation="MLHLLNETVQIQRRTRTSDGQGGWKEGWQDVGTARVRIRPASARE
FT                   REAGAVTEALLSHVVYALDGADIRRGDRLVRASGETLAVISVRQPSAGHHLEIDAEAVQ
FT                   RG"
FT   gene            37105..37596
FT                   /locus_tag="Tmar_0043"
FT   CDS_pept        37105..37596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ngk:NGK_1434 putative phage associated
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacteriophage protein of unknown function (DUF646)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50168"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI1"
FT                   /protein_id="ADU50168.1"
FT                   /translation="MAKVVTKWYLGEFMRAAQAHVVRGMTKAVLYCEGVAKQKVSRGNV
FT                   DGKNPSKPGEPPKTVTGTLRANIGHDVAVTPSEVIGMIGVRKGPANKYARRLELGFHGT
FT                   VKVKAHTRTQTHAWGRPLKTPKKVRVRAYSYTVNQAPRPYLRPTVAENKEQILKLIAKG
FT                   "
FT   sig_peptide     37105..37161
FT                   /locus_tag="Tmar_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            37611..38033
FT                   /locus_tag="Tmar_0044"
FT   CDS_pept        37611..38033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_1117 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50169"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI2"
FT                   /protein_id="ADU50169.1"
FT                   /translation="MAALTQALYDRLAGDTELRTMLGTYKGQPAIFTAPPPGDAGEAAY
FT                   PMIVTLGAVSDTPDDTKTSRGREVQRDITCYTLADGSMSQVEAIAERVRQLLHRQPLAV
FT                   DGYHVWLAEVNGPILAETDDTVYGLTLTVRLRMEEV"
FT   gene            38037..38459
FT                   /locus_tag="Tmar_0045"
FT   CDS_pept        38037..38459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_2181 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Phage major tail
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50170"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI3"
FT                   /protein_id="ADU50170.1"
FT                   /translation="MPEGLNGSAVLVLVQTGTDATSGQPIFEAVAKQTGLSDESSRELI
FT                   DDSAKGDDHVSHLYGRAETSVELEAAYVPNDAAFQALWQAYLSKQDVVLRRTENGTMVE
FT                   EARAKIESISREFPDNDRSTVTVSFQLQEFWRKVTA"
FT   sig_peptide     38037..38129
FT                   /locus_tag="Tmar_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            38459..38791
FT                   /locus_tag="Tmar_0046"
FT   CDS_pept        38459..38791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_2180 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3356)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50171"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI4"
FT                   /protein_id="ADU50171.1"
FT                   /translation="MANPLRGEVELKAGGKTYVLRYTTNAMVQLEEMLGRSVLEIVNNP
FT                   SFTDARAMVWAGLLHAHPGLTLEQAGEIMDEAGVVEAIQAAGQALKKAFGRAVDEGKPQ
FT                   GEETIV"
FT   gene            38806..39123
FT                   /locus_tag="Tmar_0047"
FT   CDS_pept        38806..39123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_2310 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50172"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI5"
FT                   /protein_id="ADU50172.1"
FT                   /translation="MEAGLRAGLDIETFWQLTPGEVWEVVKADWERHDRWGQTLAVFFA
FT                   PLINAQGVKRRVRPRDLWRWRAPWARPLKSREEHQREFEQLVQIMGPQAIPVRPEGKGV
FT                   A"
FT   gene            39124..42270
FT                   /locus_tag="Tmar_0048"
FT   CDS_pept        39124..42270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0048"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="InterPro IPR010090; KEGG: nca:Noca_0550 TP901 family
FT                   phage tail tape measure protein; PFAM: tail tape measure
FT                   protein TP901 core region; SPTR: Phage tail tape measure
FT                   protein, TP901 family; TIGRFAM: phage tail tape measure
FT                   protein, TP901 family; PFAM: Phage-related minor tail
FT                   protein; TIGRFAM: phage tail tape measure protein, TP901
FT                   family, core region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50173"
FT                   /db_xref="GOA:E6SKI6"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI6"
FT                   /protein_id="ADU50173.1"
FT                   /translation="MALSAVLGEALVPIRAQFDALERDLKQARQKVEANLGKAMRDVGK
FT                   SLRSTGQTLSTYVTLPIMGAAGAAVKLAGDFEYAMNVLQSVSGATSTELAKMRQLAVEL
FT                   GNDVALPGTSAIDAAEAMTELVKAGLSVEQTMKAARGVLVLSAAAEVSNAEAAEITANA
FT                   LNAFRLSGDKATYVADLLANAANAASGEIIDMAYGLRQSAAVSAMAGQDIADVVTALSL
FT                   MANAGIQGSDAGTSLKQMFLSLINPTDKAKKLMKELGIELFTSSGQLKPLPQLIEEFRG
FT                   ALSKLTPAQRNQALATIFGSDAIRAANIVLMASADEWNNMRAAVTRAGGAQDVAAAKMK
FT                   GFRGALEAFRSTLETLGITLGEKILPHVTAFLQTLTKLVNWFGELPGPVQTTILALAGV
FT                   AAIVGPLLVGLGAVVSAIGTLMTVGPAVAAALGSVVTVAGPVVLAVMGAAAALYVLFRA
FT                   GKAVWPKLAAAAKKAGPAIAGAMDQANKALGRLGQELRSMLGRAVDWVVRTAGQIGSGI
FT                   ERAGQAVADALGRAGDAVTAFVRRGVAQLQTFLVRVASWANGIVSNATSAMARFGSVVA
FT                   SAMSRALSTVSGFVSLATSRLQAIVRYVASWGSSIAARAASAMSAFASAVRSGINRAVS
FT                   FFGDLGNRALSAVRGALGRMVSIGRNLAEGLWSGISKMGGWLKNKILGWAKSVIPDPLE
FT                   RFFGIRSPSRLMARYGKFIAQGLVKGLTGSASEIKRAAEQTARLMRDAFGGAREKRLLA
FT                   MLSANTARLQKLAAQRDAIAKQIAEAHKMAADVASKALEYASIGNLNLGVEGPVTANSV
FT                   IQSLSDRLRQMRAFASNLRILGGMGLSKDLLRQLIDMGVDQGGAYAAALVAGGRSAVAQ
FT                   INKLQRQINAAAQVLGQVAADIMYDAGMLAAKGFLAGLQEQKKDIEAAMRRIAQSVQAT
FT                   LRSELRMRSPSRVMMDLGRNIVRGLVAGMERQAVLVAAAASYLSSQAASAVAASALPPV
FT                   SVVHADMQEAAIMGAGKPITILVPVYLNGRQIARASATYVDEELAARQRRVSRARGEVY
FT                   "
FT   gene            42270..43706
FT                   /locus_tag="Tmar_0049"
FT   CDS_pept        42270..43706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0049"
FT                   /product="phage tail component"
FT                   /note="COGs: COG4722 Phage-related protein; InterPro
FT                   IPR008841: IPR006520; KEGG: bcg:BCG9842_B1390 phage tail
FT                   fiber protein; PFAM: tail component family protein; SPTR:
FT                   Phage-related protein; TIGRFAM: phage tail component; PFAM:
FT                   Phage tail protein; TIGRFAM: putative phage tail component,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50174"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI7"
FT                   /protein_id="ADU50174.1"
FT                   /translation="MAWGFRYDGIHSANKGVHSVTDVRRSILPPVTARTLDTPGRPGVY
FT                   YQGFDYGAREIQVDIILAESTLESLRSRVRNLAAWLRPDDTPRPLVFDDEPELTWYAVL
FT                   SGDTNLEEIVTVGRGTLTFLCPEPYAIGPERVLTIADGATVTAQGTADTYPIIRATVQR
FT                   DITFLSIGTVDRYVLLGTPSEVEQASVPPYERIMSDELTTTEGWVDGLDADGGLVAGTM
FT                   TSNGNEFVVADYGIGSGWHGPALQKGLPELVQDFRVTMWVQAINGKAEVGRVEAYLLDQ
FT                   TGAIIGKIGLADKYAGRDEMWGIARAGNLANGTYIINEYGDRRGVWNDFYGVLRIGRVG
FT                   NTWEAYIAKYDPVKRVYHTRRLRRWTDTKGRWTAPLARVQLHAGAYGENPPMSVRILSV
FT                   TVERVNKLQLSDVPIIAGPGDEIEIDCERFAVRLNGEHALELLDPSSQFFVLRPGEPVT
FT                   FDVSPPGAATVELRYRERWL"
FT   gene            43707..45125
FT                   /locus_tag="Tmar_0050"
FT   CDS_pept        43707..45125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0050"
FT                   /product="phage minor structural protein"
FT                   /note="InterPro IPR007119; KEGG: pth:PTH_2176 hypothetical
FT                   protein; SPTR: Phage-related protein; TIGRFAM: phage minor
FT                   structural protein; PFAM: Protein of unknown function
FT                   (DUF1142); TIGRFAM: phage minor structural protein,
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50175"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI8"
FT                   /protein_id="ADU50175.1"
FT                   /translation="MLQVMVLDRNEVVRAVLGDAPGACPVLEDLHTEDLENADITYEFA
FT                   VPADHPDAWKIENGGYIIIRDLDGLLQLLRVVRVEQTNDQDGKQLRQVLAENAALELNG
FT                   TIVPPQTLRGVSAEQAMAAVLSATRWQPGIVEWAGIQDLVIDQHTTALALVHQIRQKYG
FT                   GEIRWRVEWDRGRATGRYVDLLRQRGRRTGKRVEYRKDIDEMRVIEDTSELVTAMIGLG
FT                   RSDDSGRRLTFVGVEWSTAKGDPVDKPLGQEWVGDPEALQRWGLPGGRHLMGVYEDSEE
FT                   TDPARLLQKTWDALQERIKSRYTYEITAVALERIAGLEHEAVRLGDTVTVHNFDVDPPL
FT                   VLEARVVKLERSYTDPTRDRVYLGYYEPSKLGRAVLDSAERQVRRLRTVVQTIQARDEP
FT                   ALVDITYGPDGRFQKAVSGGWWWEAEYTTGPTGQVVASKITERRPDGTTVAWTLEYDAS
FT                   GRLIRATPAVTAAS"
FT   gene            45139..45552
FT                   /locus_tag="Tmar_0051"
FT   CDS_pept        45139..45552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_06400 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50176"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKI9"
FT                   /protein_id="ADU50176.1"
FT                   /translation="MPAGFGVTVVADGQVRVMDLPHPLYPSKRRPYIKGLQLSVPAVAQ
FT                   TYSVTYTPAEDVELLSIAMAASGYGLGDYWWADVGTERLLDSIYTKELPESVLLGTPWS
FT                   IVYPVAAGTEIKLSFNNASGTAKRVWWNLHMLR"
FT   gene            45565..46818
FT                   /locus_tag="Tmar_0052"
FT   CDS_pept        45565..46818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_06380 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50177"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ0"
FT                   /protein_id="ADU50177.1"
FT                   /translation="MAWIQGYATPATITRVLRDAMVAAGWTEVANPAAEEYILQTTTDP
FT                   EGAIRAPKAVKAALTGAAASGTGFTGGATYDYVVTAEGPKGESVASATASVTQPTTPER
FT                   VKLSWRLLDGALRYHIYRKTGTGGFERVGSTEGQCTTWIDDGATPQAGVTPPAGQSLTI
FT                   LARIRRPSASKFAIEVSMLEAYDTVAATATNESPKVPLYFWYGGATTPSWGDNSQLLYW
FT                   GNVSKNRVAVVIYGDPTIDFSNYRVGFLYLGRLTPFPEAGQDVAGNFALCGNFAGSGTL
FT                   SVPTTYGPYTGSGVLDVMVYKTKSGVLYQRHELAFVTQRSGMTLEDKGFNPSQWTQKYH
FT                   LSPAYVVHGYDGYRGWLEDVLVVQDHNLVHLDEFIVSYPDGGTERYKYFRVDPAGNWPI
FT                   GNASPNSKYSVAILKEAA"
FT   sig_peptide     45565..45660
FT                   /locus_tag="Tmar_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            46834..49959
FT                   /locus_tag="Tmar_0053"
FT   CDS_pept        46834..49959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_32220 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50178"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ1"
FT                   /protein_id="ADU50178.1"
FT                   /translation="MPVAELLASYQPARNSVTLAAGYRVDRLGSQEDLLRAGYLPYAIL
FT                   PGRQEAVPRPVALAIERPAAVAECCPADRVDGRGARIDVGMSAARLPDRQAVAVRRPMA
FT                   GERPLERQAVPPAGTILVARRPIERGGSARWAPTPEGQRIIERAGIPRSGLSAGVRLID
FT                   RPGIAHPVTREAMRPVGRDVTLVVAGAAAGRSIERLGATRPVLVLPDRDAERTALLIAG
FT                   YLPVARDPSHEALVVAGRWADRDASKSAVVMPAPWRAVHDGDRTALVVWGSRPIEYLGG
FT                   NTIIMRPHIMGALNNLRVVEVLPHRPPAARVDEHGAAVGHGLAGARPVEHGADIVWLVA
FT                   GERPSELGAAMIRLGLAGERPTSLGGVMVRLAAAGERPTVHGAVVGGFAAAGSRPAEHG
FT                   STVWHRPLPGGTEARAAAMLWAPMAVRETVEPGLVLARLPLLVPVPKQALVVAPQPMAD
FT                   KAPKDGRLVLPRWWAETAPKEARSGVGLWVERDQGRTTIVVPGRPTGGELPDAIGAAPY
FT                   MPRPKDNERPYDSPQEPWPDTEPITGPYNPPPPPSTDPETGAPVNPPPQNHVEPPPNSV
FT                   ADPVTGEPRHPTGGTDPVTGDPEILPPRDPAHVPGDMCGAVDEADVPEGVLLEFIARFW
FT                   DVWKTFEVYYGHVTADEAVRHLLSELVRWLGDNPYDPRYWVLYCDLRDCARSAVMRYCR
FT                   TYLRKQWGQERASALDYGTDAFNTGNFMDPSRWTVSGWSFRYHLNPTDIALAPDGDGAT
FT                   VTLSCNLPDGGWVDFEYLIATGNAMRLIALPSGTVLWSAEGTVDDPYGVAGPHASVEVP
FT                   PGTTGLQWVFEWKATTRQESIDYGTDDYNAAAFLDATRWTVTGWSFKNQSATDIALAPD
FT                   ADGATAELSCNLPDGGRVEFEVAVTNGNQLQLVALPSGTVVWSSAGTTDEPYGTAWPKV
FT                   AVELPAGTTAIRWQFAGTAVAPSGLRALIDVVTVYRYAYTLAAPPSGLAGILDVVTLWR
FT                   YDYRQVLIGAWPETVCEPNRGNDAVRDAWECWRRKWEERHKDKTLRRRWLVT"
FT   gene            49975..51081
FT                   /locus_tag="Tmar_0054"
FT   CDS_pept        49975..51081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_06350 hypothetical protein; SPTR:
FT                   Virion structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50179"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ2"
FT                   /protein_id="ADU50179.1"
FT                   /translation="MPTIYRTRSGLLFYDDFSAVPLGPSWRVEPESEAARVSLSARPGW
FT                   LQLSHGSVRLFALAPIPDGDLVIEAEVDYDPTDPAEMGGLVLFAAAPDEWAGIVERMDG
FT                   STTVTGWSHLRLVRTGDRWDAYASHDRVTWDWLGAQRFREVTEFGLVLDGAAGDTLDVD
FT                   VVRVYRSTRIRVEAVPAGSTVRLVAEDGTTVLKEAVVPTGATAVELDVGDLRCPIAGSI
FT                   RVYDGAGTMVRDTGLLNDIWGGDVYRAEIMVAVYDDAAKPVPLDREWDFGPVQGTDHAR
FT                   RLELRNDTGLDLADVTVAVIPHPDGTWGDAWVDVAPDAGGVPGTYGDIATIASIPAGTS
FT                   GYVWVRVTRGLDGPPQDRYKFGLRITIP"
FT   gene            51095..52453
FT                   /locus_tag="Tmar_0055"
FT   CDS_pept        51095..52453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2250 putative type IV pilus
FT                   protein; SPTR: Putative type IV pilus biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50180"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ3"
FT                   /protein_id="ADU50180.1"
FT                   /translation="MGSRVAFVRAPRGDATQAPPPIGAYGQLGTSARAAREDHTHEGVH
FT                   QLVAGDGVAVTPSSGLGDVTVAVRHWRPPVPTASALPASGNETGDARVVLDEASIYVWT
FT                   GVVWQRVTATGGGGGPGFDEWGAINRLYLGLEQVAAAGRPALTTLSERYDALVDDSGID
FT                   WTRSANVELRNGRIVAVPAQWVGFGDDWVRIPPRAGRVRTISVLASMAPGSFEQGLPSV
FT                   LGAGDFEAGISGVVTPTPRMHNLATEGLPLSGAIADGSFDAGLTGVIAMLPAAARPPTS
FT                   RKLKVTQRDDGEPARFVPLSPGGFDFGVQSVVDPWGRTGSFEGGVVSTIVARREVVQFA
FT                   TGPMAQVQAADGTFEAGVASVITRPLRRGGTPMAVSERIALPAVPARAYLTARSERVRY
FT                   EVSRDDGVTWTPIEPDRVVDLSTQPVGVRLRVRAILDDEVRSYVEAWAYGASK"
FT   gene            52471..53862
FT                   /locus_tag="Tmar_0056"
FT   CDS_pept        52471..53862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4845 parallel beta-helix
FT                   repeat-containing protein; SPTR: Carbohydrate-binding CenC
FT                   domain protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50181"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011459"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ4"
FT                   /protein_id="ADU50181.1"
FT                   /translation="MATYYVAPYGNDTNAGTSPSAPFATINKAAQVMVDGDVCYVAPGV
FT                   YREAVSVPAQASGTKLVSFIGDTEARNFPGVQPGEVRLDGSDDDVNPVRTTGVSIGSGA
FT                   LVRWRRINVVRFSSYGFTIGSANLNIANIVEECIVNSRDVAFYITNAAFFTIRKVNVEN
FT                   CARALQVPGGNNFVLTAEDMLLESVDVGFDLSTHSWSRVVLRRIYHRAAGSTRLLVFMQ
FT                   AGELYAEDVVVVNGALLSTAVAGSGNFRHVTIVRATAVKPGGTNCLYFSQFNNYDGSDS
FT                   LNVYDSLFAESQYGVYVTSGYPRVLLHSCAFPDVTTAALNADIITGVKNTTTDSQANVI
FT                   LPDFTPVGAQILRAEEQNPIEGLRSARIDVPRVAYYKFQVAVSGPNTITLKAKKSHATG
FT                   TTVKFRVDEDPNKVVTLADTDQVQTVQLGPVEDRGPRFVPLEVWAQQVDYIDGHYLLID
FT                   SIQVI"
FT   gene            53935..54390
FT                   /locus_tag="Tmar_0057"
FT   CDS_pept        53935..54390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0057"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /note="COGs: COG4824 Phage-related holin (Lysis protein);
FT                   InterPro IPR006480; KEGG: cbf:CLI_3253 toxin
FT                   secretion/phage lysis holin; PFAM: Holin toxin
FT                   secretion/phage lysis; SPTR: Toxin secretion/phage lysis
FT                   holin; TIGRFAM: toxin secretion/phage lysis holin; PFAM:
FT                   Holin family; TIGRFAM: toxin secretion/phage lysis holin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50182"
FT                   /db_xref="GOA:E6SKJ5"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ5"
FT                   /protein_id="ADU50182.1"
FT                   /translation="MREDTIWTGAVALAGTVATAVFGAWDRPLQLLLVAMALDYVTGVV
FT                   AAAVTGRLSSEVGLRGVARKLALLGLVAVANLIDQMLAAGAAQALDLALPEGTSAIRTA
FT                   VCFALGVSEVVSIIENLGEAGAPIPEPLRRMVAALKRAEGGAEDGRA"
FT   sig_peptide     53935..54003
FT                   /locus_tag="Tmar_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            54377..55189
FT                   /locus_tag="Tmar_0058"
FT   CDS_pept        54377..55189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0058"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="COGs: COG0860 N-acetylmuramoyl-L-alanine amidase;
FT                   InterPro IPR002508: IPR001119; KEGG: hmo:HM1_2806
FT                   N-acetylmuramoyl-L-alanine amidase, putative; PFAM: cell
FT                   wall hydrolase/autolysin; S-layer domain-containing
FT                   protein; SMART: cell wall hydrolase/autolysin; SPTR:
FT                   N-acetylmuramoyl-l-alanine amidase, putative; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase; S-layer homology
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50183"
FT                   /db_xref="GOA:E6SKJ6"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ6"
FT                   /protein_id="ADU50183.1"
FT                   /translation="MAVRKVYVDPGHGGSDPGAVGNGVREADVALAVAVKVADHLRRHG
FT                   LEVRLSRTVDTAKSLQARTDEANAWGADAYVSIHCNAAGTPEASGWEVWHTIHEERSMG
FT                   DELAEAIADQLKRLPMVARGTKSKPSTSNPQTDYYHVIRETRMPAVIVECGFVTSPKDA
FT                   GYLKSAEGQAAIAEAIARGVIAWAGLAWRPAEQPKSAPVPSPAPKAPVKPGPFRDVPGD
FT                   HWAAVSIERLKRAGIIEGFADGTFRPDEPVTRAQLAAILDRLQSALRK"
FT   gene            complement(55237..55650)
FT                   /locus_tag="Tmar_0059"
FT   CDS_pept        complement(55237..55650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_2499 peptidase S1 and S6,
FT                   chymotrypsin/Hap; SPTR: Peptidase S1 and S6
FT                   chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50184"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ7"
FT                   /protein_id="ADU50184.1"
FT                   /translation="MGVNLSAIQSIEDLLAACEGDPVSLEHARNWAAGRLHTYLGVKED
FT                   SLRPGYLYLHDSYEAQALVATDIIFVRASYDPEETKAWVREARKYTDRVIKVPPPFRFR
FT                   PWFPLEESFEEWRTAMRSAAEEYRKLVETLMAE"
FT   gene            complement(55903..56220)
FT                   /locus_tag="Tmar_0060"
FT   CDS_pept        complement(55903..56220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfi:NFIA_062390 polyprenyl synthetase,
FT                   putative; SPTR: Chromosome 2 SCAF15032, whole genome
FT                   shotgun sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50185"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ8"
FT                   /protein_id="ADU50185.1"
FT                   /translation="MEGTLEDILRALWAEGRDMIDAPGGSVIDDVAADIIGRHRKARVY
FT                   WYATPEPLRDANGVLHPAFRGGNANWRVALPGWSEDTAAVLGEVEVDGDDMTYYIVGDP
FT                   H"
FT   gene            complement(56314..56730)
FT                   /locus_tag="Tmar_0061"
FT   CDS_pept        complement(56314..56730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppl:POSPLDRAFT_93294 hypothetical protein;
FT                   SPTR: Plasmid partitioning protein, ParA1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50186"
FT                   /db_xref="GOA:E6SKJ9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKJ9"
FT                   /protein_id="ADU50186.1"
FT                   /translation="MAKEAVLLKIDPALAQRLRVRAAEERTTMSAIVERALRKELGEMT
FT                   NRDEFARTLGYADWDALMAASEEVAVEGDISWYVSRLPDGRWAAWDDAEIALDRVSIHA
FT                   TREEAVAYQYDGWTASHEEEAETERVRWLAERPD"
FT   sig_peptide     complement(56665..56730)
FT                   /locus_tag="Tmar_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(57103..57588)
FT                   /locus_tag="Tmar_0062"
FT   CDS_pept        complement(57103..57588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: llo:LLO_1565 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50187"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK0"
FT                   /protein_id="ADU50187.1"
FT                   /translation="MRRVLWSRITFALCAAALILTGLAGCSDTAGDSAASGDLAQQVVA
FT                   SLGKQEGDESSGAVSAKLVGDGHIQVEYRFYPLGAVDVERELGVHLSPKLRKVFRDHAD
FT                   LQRLDMQVYLPYDDGYGNTTWKPAFSFAFDRNLYEKINWDNFVPQNLLDVVDNRPSQ"
FT   sig_peptide     complement(57484..57588)
FT                   /locus_tag="Tmar_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            57828..58136
FT                   /locus_tag="Tmar_0063"
FT   CDS_pept        57828..58136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_3779 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50188"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK1"
FT                   /protein_id="ADU50188.1"
FT                   /translation="MVKATILVPVKDNDGRPFEWEAWQELQQRLLQFGGYTDGGLVAGA
FT                   WESEGRVYQDENRQFIIALSSWRDVPRFLDLAEWVRVRFRQEAVYIEIAGIPEILAG"
FT   gene            58231..58740
FT                   /locus_tag="Tmar_0064"
FT   CDS_pept        58231..58740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0034 DNA helicase/exodeoxyribonuclease
FT                   V, subunit B; SPTR: Response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50189"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK2"
FT                   /protein_id="ADU50189.1"
FT                   /translation="MTYTTLDGRVLDLGGLTEVEQQHLDRCIEAYRQGMDWDQFMRLVD
FT                   TPENPLVRTVGRGWVTREVAVRPMYQAIRDMADRLAIQQGYMAPSEGIDPDSDPFADEW
FT                   IPAREAAERKGVSLVALHKAIDRGDIIARPATPGGGRIVVSARSLEKWKVDRARQQAGR
FT                   ARARTR"
FT   gene            complement(58834..59085)
FT                   /locus_tag="Tmar_0065"
FT   CDS_pept        complement(58834..59085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1887 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50190"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK3"
FT                   /protein_id="ADU50190.1"
FT                   /translation="MGLVDQPVQAWADAQGRPAAFLWRGVRRRVVEILDEWRELGRWWE
FT                   GDPPEERYVYRVRTEDGGVYEIEYRRPAGRWFLYKVWD"
FT   gene            59262..59340
FT                   /locus_tag="Tmar_R0005"
FT   tRNA            59262..59340
FT                   /locus_tag="Tmar_R0005"
FT                   /product="tRNA-Arg"
FT   gene            59519..61363
FT                   /locus_tag="Tmar_0066"
FT   CDS_pept        59519..61363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0066"
FT                   /product="GerA spore germination protein"
FT                   /note="InterPro IPR004995; KEGG: bbe:BBR47_36580 putative
FT                   spore germination protein; PFAM: GerA spore germination
FT                   protein; SPTR: GerA spore germination protein; PFAM:
FT                   Bacillus/Clostridium GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50191"
FT                   /db_xref="GOA:E6SKK4"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK4"
FT                   /protein_id="ADU50191.1"
FT                   /translation="MRDRTPCHAKRGGQARRVGARPTIPGKFAARERALARRDRRCPPG
FT                   GFCQGRAGRGEVTPAVSMFYRPGPWYRKQGTEDDTPWRNLEGSLRHLETSLLDLRSTLD
FT                   RTLLLDRRNLSGRLQEDIQLFQHALERVDDFVVRRLFLRNGTGVALMFIEGLVDTRAVQ
FT                   EFIVAPLLRVRAARLPRGRRLQRVLAQRILPTTGNVATRSIDGLLKGLLSGSVVVLIDG
FT                   CTEALHIDVRKLPERSVEEPTVEAVIRGPRDGFTEDLRTNISLIRRRLADIRFKVEELR
FT                   VGRVTHTLVAVCYLQGIVNPHLVTEVKSRINRITADAILESGYIEEWIEDCPSSLFPQI
FT                   LHTERPDVVAGALLEGRVAVITDGTPFALVVPVSLWTLLQTPEDYNERFIATTALRWLR
FT                   YLFALVALLLPSLYVAITTYHPEMLPTPLLMTVAASREGIPFPAMVEALLVEIIFEALR
FT                   EAGVRLPRTIGQAVSIVGAIVIGEAAVMAGIISAPMVIIVATTGIANFTVARFNLAFTI
FT                   RLLRFPLRVLAGMFGLYGIILGLLAILIHLAGLRSFGYPYLSPVAPLNAPDLRDVVIRA
FT                   PRWALTRRPTQLPRRNWRRARPGLQPHAGRWPGLGGAR"
FT   gene            61504..62643
FT                   /locus_tag="Tmar_0067"
FT   CDS_pept        61504..62643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0067"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="InterPro IPR008844; KEGG: gwc:GWCH70_2165
FT                   germination protein, Ger(X)C family; PFAM: spore
FT                   germination B3 GerAC family protein; SPTR: Germination
FT                   protein, Ger(X)C family; TIGRFAM: germination protein,
FT                   Ger(x)C family; PFAM: Spore germination B3/ GerAC like,
FT                   C-terminal; TIGRFAM: germination protein, Ger(x)C family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50192"
FT                   /db_xref="GOA:E6SKK5"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK5"
FT                   /protein_id="ADU50192.1"
FT                   /translation="MLVVAAFLLTGCWDRIEINDRAIVLGMAVDRDPRGGFLLTLSVAD
FT                   PARFPRPGQPGGALQPGQKPVSYVQGSGRTLAEALSLMQESEPRRFFFGHLKVVLIGEQ
FT                   VARQGIGPALDFLVREPQPRPEVMMAVTPGPAGSLLMQATPPLESLPSEALRELIRLRL
FT                   GMVVPLYRLVRALYEEGIEAVVPRVELVPMVDDGLRVKGWRVNGVGVFRGDRLVGWLDD
FT                   GQTRGLMWLRGEVQRGTLTVDIDGSPVSLRLLRARSQLRPVVEGDRVVMEVRVVTEDDL
FT                   VDNPAGLDLTSPAAIRDIERRAAEAIIKRAEVARTIAQQQLRTDILGFGDAVRRRAPAA
FT                   WARLGPAWAEIFPRVEVRYDVRVFLRRPGLATASPGRSR"
FT   gene            62741..62953
FT                   /locus_tag="Tmar_0068"
FT   CDS_pept        62741..62953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pis:Pisl_0311 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50193"
FT                   /db_xref="GOA:E6SKK6"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK6"
FT                   /protein_id="ADU50193.1"
FT                   /translation="MMVLALLAALAAVLWLELPSIVQAGSRRLVAVYLLLLFLAAAIGF
FT                   VLVLPGRTPTLTDVTNAVFARGGRG"
FT   sig_peptide     62741..62812
FT                   /locus_tag="Tmar_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            63025..64206
FT                   /locus_tag="Tmar_0069"
FT   CDS_pept        63025..64206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0069"
FT                   /product="spore germination protein"
FT                   /note="InterPro IPR004761; KEGG: tjr:TherJR_2524 spore
FT                   germination protein; PFAM: Spore germination protein; SPTR:
FT                   Spore germination protein; TIGRFAM: spore germination
FT                   protein; PFAM: Spore germination protein; TIGRFAM: spore
FT                   germination protein (amino acid permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50194"
FT                   /db_xref="GOA:E6SKK7"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK7"
FT                   /protein_id="ADU50194.1"
FT                   /translation="MVPFDPRREQISAWQLFVLLFFTISPTAILTLSALIGRYAGHDAW
FT                   LSIILATGLGVAVAWLHLALARRFPGQGWTDIHRLVLGRWLGTGLNLLVWVWILQTAGV
FT                   IVREFGEFVVATVLPLTPLVVIHGSAMLLVMWAARAGIEVLARVGELLLPLIVISLLFV
FT                   LVLLIPNADWRSALPVLESGWTNLVRGGLPLVAWLGETVLALVILPSLAQWQGAGRAAV
FT                   MAVLAVGGLLALLTLGTILVLGDTAPLFTFPPFAATRTVTVANFLERLEPVITAVWVGG
FT                   LVVKMGIWLYAATVTGAAVFGIEDYRPLVTPMAALMLALSLWLFDDSLEMTDYLARTWP
FT                   FYALFFQVVVPAVVTLAAMIRGLPVRGRGRPPPEPQGTGSGTAGEGPGAQAQP"
FT   sig_peptide     63025..63126
FT                   /locus_tag="Tmar_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(64390..64896)
FT                   /locus_tag="Tmar_0070"
FT   CDS_pept        complement(64390..64896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0070"
FT                   /product="protein of unknown function DUF988"
FT                   /note="COGs: COG4708 membrane protein; InterPro IPR010387;
FT                   KEGG: hor:Hore_07380 predicted membrane protein; PFAM:
FT                   protein of unknown function DUF988; SPTR: Predicted
FT                   membrane protein; PFAM: QueT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50195"
FT                   /db_xref="GOA:E6SKK8"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK8"
FT                   /protein_id="ADU50195.1"
FT                   /translation="MELRRWLRAGMIAAIYVVLTMLFQPISFGQIQFRISEALTLLPMI
FT                   WPEAVPGLFVGVALANLQSPFGLWDVVGGSLVTLAAALVTRRWRFHPAGYLSPVVLNAV
FT                   LVGAYLAYLTHTPYLPWVLWIGLGEAGVVFLLGYPLLQVLRRRAFGEGGGTGPEPAFRN
FT                   PGRQP"
FT   sig_peptide     complement(64810..64896)
FT                   /locus_tag="Tmar_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            65183..65258
FT                   /locus_tag="Tmar_R0006"
FT   tRNA            65183..65258
FT                   /locus_tag="Tmar_R0006"
FT                   /product="tRNA-Arg"
FT   gene            65408..66031
FT                   /locus_tag="Tmar_0071"
FT   CDS_pept        65408..66031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0071"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR002125: IPR016192; KEGG: nde:NIDE1745 tRNA-specific
FT                   adenosine deaminase; PFAM: CMP/dCMP deaminase zinc-binding;
FT                   SPTR: CMP/dCMP deaminase, zinc-binding; PFAM: Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50196"
FT                   /db_xref="GOA:E6SKK9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKK9"
FT                   /protein_id="ADU50196.1"
FT                   /translation="MLQPHRPKEPATATRAASGSPRGPEASQDEALAAPAARPAPDDPD
FT                   VLYMAEALAEARRALALGEVPVGAVAVHDGRIIARGHNLRERLGDPTAHAEILVLREAA
FT                   ARLGGWRLEGVTLYVTLEPCPMCAGAIVLARVPRLVYGAPDPKAGAAGSLMNLVQHDKL
FT                   NHRVELRAGVLAEASAALLRGFFRQLRGAGDPAPAPGPAETGDP"
FT   gene            66117..66203
FT                   /locus_tag="Tmar_R0007"
FT   tRNA            66117..66203
FT                   /locus_tag="Tmar_R0007"
FT                   /product="tRNA-Ser"
FT   gene            66339..66428
FT                   /locus_tag="Tmar_R0008"
FT   tRNA            66339..66428
FT                   /locus_tag="Tmar_R0008"
FT                   /product="tRNA-Ser"
FT   gene            66626..66745
FT                   /locus_tag="Tmar_R0009"
FT   ncRNA           66626..66745
FT                   /locus_tag="Tmar_R0009"
FT                   /product="RNA component of signal recognition particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            66857..69334
FT                   /locus_tag="Tmar_0072"
FT   CDS_pept        66857..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0072"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR003593: IPR003959: IPR012763: IPR001270; KEGG:
FT                   mta:Moth_0027 DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; PRIAM:
FT                   DNA-directed DNA polymerase; SMART: AAA ATPase; SPTR: DNA
FT                   polymerase III, gamma and tau subunit; TIGRFAM: DNA
FT                   polymerase III, subunits gamma and tau; PFAM: ATPase family
FT                   associated with various cellular activities (AAA); DNA
FT                   polymerase III subunits gamma and tau domain III; TIGRFAM:
FT                   DNA polymerase III, delta' subunit; DNA polymerase III,
FT                   subunit gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50197"
FT                   /db_xref="GOA:E6SKZ5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKZ5"
FT                   /protein_id="ADU50197.1"
FT                   /translation="MSQPYQALYRSWRPQRFDGVVGQEHVIRTLANALRTGRVAHAYLF
FT                   AGPRGTGKTSVAKLLAKAVNCLSPEGVEPCNRCEVCREINDGSTMDVLEIDAASNRGID
FT                   EIRELRERVRYAPARARYKVYIIDEVHMLTTEAFNALLKTLEEPPAHALFILATTEPHR
FT                   LPATIVSRCQRFDFHRLTPEQILERLQAVCTAMGVEAEPAALRLLARLAEGGLRDALSL
FT                   LDQSLAMAGDRLDAQVVADLLGLAPGEGILALTRAVVEGDVGAGLQAVAELSAQGVDLA
FT                   QALRDWVACWRDLLALRAGLDERHLLYAGPELAGDLAPLARALDDETALACFDALAEGE
FT                   SLLRWSGQPRLALEAALIRAVGERVARQDRAAAGREAAPGGPKGTGAGRAGDDGTRPVA
FT                   AAARRGAAPAAVGTAAAPAPGAGVPGGEPVPEPVLGPVPPPPAGVEDGEPLGTGGSPRR
FT                   EATGDAGALTEDDAAGHVAGGTAAGAAAAPRTPAPAAAFAAPGTGAGDDPATGAGTGTG
FT                   PAVRPGVGTGGAAALAEQWDGFLKALRRRREWTALHALLRAAGRPRAAGEHLEIPFAQP
FT                   GMARTAEVKLPQLRQAIQVFLGSAVPVRVVVEGMPPDSGGDGSGRGTAGTGARRPAGRD
FT                   AADRPASPGPRGTGEGVAPAGEDAPVAAATGRPAAARDPGDPPGAVTRVSVAVPPEPPE
FT                   PAGRDGAQAAGSRPASGPGAGTGPTVAGGGPATMDVTPGGGGGRPVAGAGTPEPRAPVP
FT                   AASQEPSPLASVPESLGSGAPGAAAGLPSEAAPGDLDDVQKAAWELFGGQWIPVKEEWR
FT                   RELRPHGQDAETA"
FT   gene            69294..69626
FT                   /locus_tag="Tmar_0073"
FT   CDS_pept        69294..69626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0073"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="COGs: COG0718 conserved hypothetical protein;
FT                   InterPro IPR004401; KEGG: adg:Adeg_2129 hypothetical
FT                   protein; PFAM: Uncharacterised protein family UPF0133;
FT                   SPTR: UPF0133 protein Adeg_2129; PFAM: Uncharacterised BCR,
FT                   YbaB family COG0718; TIGRFAM: DNA-binding protein,
FT                   YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50198"
FT                   /db_xref="GOA:E6SKZ6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKZ6"
FT                   /protein_id="ADU50198.1"
FT                   /translation="MSFGPMGKMLKQLEKVQQEMARLQEELAQREVEATAGGGMVKAVV
FT                   NGRQELLRLEIAREAVDPDDVELLQDMIVAAVNEANRKAQELLQAEMARVTGGLKLPKL
FT                   PGFPGF"
FT   gene            69643..70242
FT                   /locus_tag="Tmar_0074"
FT   CDS_pept        69643..70242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0074"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="COGs: COG0353 Recombinational DNA repair protein
FT                   (RecF pathway); InterPro IPR006154: IPR015967: IPR006171:
FT                   IPR000093; KEGG: hmo:HM1_0809 recombination protein RecR;
FT                   PFAM: TOPRIM domain-containing protein; Zinc finger
FT                   C4-type, RecR; SMART: Toprim sub domain-containing protein;
FT                   SPTR: Recombination protein recR; TIGRFAM: recombination
FT                   protein RecR; PFAM: Toprim domain; RecR protein;
FT                   Helix-hairpin-helix motif; TIGRFAM: recombination protein
FT                   RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50199"
FT                   /db_xref="GOA:E6SKZ7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKZ7"
FT                   /protein_id="ADU50199.1"
FT                   /translation="MEHAPAFARLIAELEKLPGIGPKTAQRLAYHLLFRPQDEVRALAE
FT                   AMVQARASVRYCSICFNLTDRDPCPVCRDPGRDARVICVVEQPRDVVAMERTREFRGRY
FT                   HVLHGVISPMDGIGPEQLRVRELLARLRQDPPVDEVILATNPTVEGEATALYLARLIKP
FT                   LGIRVTRIARGVPEGGDLEYVDELTLTRALQGRQAL"
FT   gene            70410..70901
FT                   /locus_tag="Tmar_0075"
FT   CDS_pept        70410..70901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2803 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF2508)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50200"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKZ8"
FT                   /protein_id="ADU50200.1"
FT                   /translation="MGTEWGTAWRRRWRWPWHRPRRLAGPADARAAGAGPPGGSPSVSA
FT                   AAVGPAEVLARWRAGDRGPGRGSHRTRRQPAAAFERGADPAEADDFDWVAAVDQARRDW
FT                   EQARRYFECVTDRDLVDQAIHLVLAAEKRYAYLLKQARMRGIRGLPPHPGAAADRRVAP
FT                   "
FT   gene            70917..71210
FT                   /locus_tag="Tmar_0076"
FT   CDS_pept        70917..71210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_0054 hypothetical protein; SPTR:
FT                   Inner-membrane translocator; PFAM: SigmaK-factor processing
FT                   regulatory protein BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50201"
FT                   /db_xref="GOA:E6SKZ9"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:E6SKZ9"
FT                   /protein_id="ADU50201.1"
FT                   /translation="MRAIAGEGTWAAAGLAAVVVGALAWRSATAPTAGEALARVAADLA
FT                   VGSGWIVGLNVLLAPLGAHVGWNPATAWLAGGLGLPGVLALALLAVMARWQP"
FT   sig_peptide     70917..71030
FT                   /locus_tag="Tmar_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            71538..73058
FT                   /locus_tag="Tmar_0077"
FT   CDS_pept        71538..73058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0077"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase; InterPro IPR020058: IPR004527: IPR001412:
FT                   IPR020060; KEGG: mta:Moth_1132 glutamyl-tRNA synthetase;
FT                   PFAM: Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   catalytic domain; SPTR: Glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: tRNA synthetases class I (E
FT                   and Q), catalytic domain; TIGRFAM: glutamyl-tRNA
FT                   synthetase, bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50202"
FT                   /db_xref="GOA:E6SL00"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL00"
FT                   /protein_id="ADU50202.1"
FT                   /translation="MSQPVRVRYAPSPTGYLHIGGVRTILFNWLFARKYGGRFVLRFED
FT                   TDPERSRDELIEPMLESIRWLGLDWDEGPDVGGPYGPYRQSQRLHLYREALDRLLAEGK
FT                   AYYCYCTPEELDAEREAARAAGRPAVYGGRCRHLTEEERRRLEAEGCRPAVRLRVPDAG
FT                   EITVRDLVKGDVTFDVGQFGDFIIARADGMPVYNFAVVVDDHHMAITHVIRGDEHLSNT
FT                   PKQLLVYRALGWEPPHFAHVPMILAPDRTKLSKRHGAVAVDEYRRQGFLPEAILNYVAL
FT                   LGWSPGDDREILSLGEMIELFDLDRVSRTAAIYDVEKMAWMNGHYLRELDLDQVVERAI
FT                   PRFVAAGLIQGEPHGEERRRLYAIVDAVRQRVRTLEELVEASRYFFTDFDGYEEAGVRK
FT                   HFDRDDAIPILEAVAETLAQVEPWSQAAIEQALRGLAERKGVGTGRIFHPTRLAVSGRT
FT                   VGPGVFDVICWVGRERCLERIQRAIEWIRQRRAARATAQPAGPAGATG"
FT   gene            73447..73517
FT                   /locus_tag="Tmar_R0010"
FT   tRNA            73447..73517
FT                   /locus_tag="Tmar_R0010"
FT                   /product="tRNA-Gln"
FT   gene            73522..73594
FT                   /locus_tag="Tmar_R0011"
FT   tRNA            73522..73594
FT                   /locus_tag="Tmar_R0011"
FT                   /product="tRNA-Glu"
FT   gene            73909..75456
FT                   /locus_tag="Tmar_R0012"
FT   rRNA            73909..75456
FT                   /locus_tag="Tmar_R0012"
FT                   /product="16S ribosomal RNA"
FT   gene            75624..75700
FT                   /locus_tag="Tmar_R0013"
FT   tRNA            75624..75700
FT                   /locus_tag="Tmar_R0013"
FT                   /product="tRNA-Ile"
FT   gene            75722..75794
FT                   /locus_tag="Tmar_R0014"
FT   tRNA            75722..75794
FT                   /locus_tag="Tmar_R0014"
FT                   /product="tRNA-Ala"
FT   gene            75965..78953
FT                   /locus_tag="Tmar_R0015"
FT   rRNA            75965..78953
FT                   /locus_tag="Tmar_R0015"
FT                   /product="23S ribosomal RNA"
FT   gene            79047..79163
FT                   /locus_tag="Tmar_R0016"
FT   rRNA            79047..79163
FT                   /locus_tag="Tmar_R0016"
FT                   /product="5S ribosomal RNA"
FT   gene            79276..79350
FT                   /locus_tag="Tmar_R0017"
FT   tRNA            79276..79350
FT                   /locus_tag="Tmar_R0017"
FT                   /product="tRNA-Asn"
FT   gene            79643..80359
FT                   /locus_tag="Tmar_0078"
FT   CDS_pept        79643..80359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0078"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="COGs: COG0125 Thymidylate kinase; InterPro
FT                   IPR000062: IPR018094: IPR018095; KEGG: gob:Gobs_0609
FT                   thymidylate kinase; PFAM: thymidylate kinase; PRIAM: dTMP
FT                   kinase; SPTR: Thymidylate kinase; TIGRFAM: thymidylate
FT                   kinase; PFAM: Thymidylate kinase; TIGRFAM: thymidylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50203"
FT                   /db_xref="GOA:E6SL01"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL01"
FT                   /protein_id="ADU50203.1"
FT                   /translation="MCEEPKSSRHTPDGDGAPRQPGGRRRGWFISLEGGEGSGKSTQAA
FT                   VVMDWLRSRGMPCRLVREPGGTPLGERLRELLLNGTGRPVPVAEMLLFAAARAQLVETV
FT                   ILPSLLAGETVVCDRYVDSSLAYQGSGLGLGWEAVWSANRWATRGIMPDLTLLFDCPPE
FT                   LARARHRRPGDDIERRGQGFHRRVREGYRALARAHGNRVVVIDASRPALEVAAEVRRVL
FT                   ERWFVSTGAPVAPGPR"
FT   gene            80447..80776
FT                   /locus_tag="Tmar_0079"
FT   CDS_pept        80447..80776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0079"
FT                   /product="protein of unknown function DUF970"
FT                   /note="COGs: COG3870 conserved hypothetical protein;
FT                   InterPro IPR010375; KEGG: sth:STH3257 hypothetical protein;
FT                   PFAM: protein of unknown function DUF970; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF970)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50204"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL02"
FT                   /protein_id="ADU50204.1"
FT                   /translation="MKLVVAVVQDKDAGRLIEELVDRGYRATKLASTGGFLKEGNTTLL
FT                   VGAEDPQVDEVVAIIKRVCRPREQVVTPLGPIGGAVDTYVPYPVEVIVGGATIFVLNVE
FT                   RFEHV"
FT   gene            80769..81767
FT                   /locus_tag="Tmar_0080"
FT   CDS_pept        80769..81767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0080"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   KEGG: saq:Sare_4403 DNA polymerase III, delta prime
FT                   subunit; SPTR: DNA polymerase III, delta prime subunit;
FT                   TIGRFAM: DNA polymerase III, delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50205"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL03"
FT                   /protein_id="ADU50205.1"
FT                   /translation="MSEPMARLWSRRVSHAYLLAGPPGAGQREAADQVAAALLCPQARD
FT                   GIACGTCPACRQVAAGVHPDLIVPDGHGIDAVRRTLALLPLRPQAGPRKVVVWRDADRL
FT                   TPQAANALLKSVEEPPPFVVFLFTTDHLTAVLPTLRSRCRVVPFRPRPREERARDLAEA
FT                   TGVRLLAAYWALRVCGDVAAEARRYLDEPGCAAEVEGLEAAAAALEHGPLTAALDAARR
FT                   LAEWGDKAEAAADVLIWRLRQGDAGDDPGRRLGWTRALAAFRRAWQANANRQLALEVFA
FT                   WRCWAVTRGGGPAPAATATGHATGHLPGMGTGRVPGSGSPGRPGIVTRPGP"
FT   sig_peptide     80769..80816
FT                   /locus_tag="Tmar_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            81785..83080
FT                   /locus_tag="Tmar_0081"
FT   CDS_pept        81785..83080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0081"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="COGs: COG0313 methyltransferase; InterPro IPR000878:
FT                   IPR008189; KEGG: dau:Daud_0039 uroporphyrin-III
FT                   C/tetrapyrrole methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; SPTR:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: probable
FT                   S-adenosylmethionine-dependent methyltransferase, YraL
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50206"
FT                   /db_xref="GOA:E6SL04"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL04"
FT                   /protein_id="ADU50206.1"
FT                   /translation="MKANSGGRPGAGEGAGAPEPVTPAPAGPPRPKRRQAAYEHIAQGG
FT                   PGGTHATVPEARGDAVPEARTAGGEPAADRGGWIRPGTLYVCATPIGNLGDVTFRLLEV
FT                   LRRADRVLAEDTRRARRLLAAYGIAARVVSCHEYNEVERAEEVAGWLAREEVVALLTDA
FT                   GTPGVADPGARLVARIAAAGWPVVPVPGPSAALAALSVAGIPAARVLFEGFLPRAAARR
FT                   RQRMASWRAWEGAVVFFEAPHRLHKVLADLLDLLPDGYLVVARELTKQHEEIRRGLVAR
FT                   LVPELLRVAPRGEYTLVLAPPAAPRPALDGEEPGVAAAPRPSPEADAAGSVPVSEAAVT
FT                   GVALPGVQRPAATTGGRLGEDAPGPRNGHGARRAGGAMPSDQALAAAIATEVAAGLAPS
FT                   EAARRVARRYGVSRNRAYRAYLNHAGNAEARD"
FT   gene            complement(83668..83919)
FT                   /locus_tag="Tmar_0082"
FT   CDS_pept        complement(83668..83919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0082"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="COGs: COG2002 Regulators of stationary/sporulation
FT                   gene expression; InterPro IPR007159: IPR006339; KEGG:
FT                   sth:STH3253 sporulation-related transcriptional regulator
FT                   AbrB; PFAM: SpoVT/AbrB domain-containing protein; SPTR:
FT                   Sporulation-related transcriptional regulator AbrB;
FT                   TIGRFAM: transcriptional regulator, AbrB family; PFAM:
FT                   SpoVT / AbrB like domain; TIGRFAM: looped-hinge helix DNA
FT                   binding domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50207"
FT                   /db_xref="GOA:E6SL05"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL05"
FT                   /protein_id="ADU50207.1"
FT                   /translation="MMKSTGIVRKVDELGRVVIPIELRRTLDIQEKDSLEIYVDGDKII
FT                   LRKYEPACIFCGNAYNVENFKGKNVCKSCMAIMATRAS"
FT   gene            84890..86923
FT                   /locus_tag="Tmar_0083"
FT   CDS_pept        84890..86923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0083"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="COGs: COG0143 Methionyl-tRNA synthetase; InterPro
FT                   IPR015413: IPR002547: IPR002304: IPR004495: IPR 001412:
FT                   IPR014758; KEGG: sth:STH3252 methionyl-tRNA synthetase;
FT                   PFAM: tRNA synthetase class I (M); t-RNA-binding
FT                   domain-containing protein; SPTR: Methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetases class I
FT                   (M); Putative tRNA binding domain; TIGRFAM: methionyl-tRNA
FT                   synthetase C-terminal region/beta chain; methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50208"
FT                   /db_xref="GOA:E6SL06"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL06"
FT                   /protein_id="ADU50208.1"
FT                   /translation="MAGSSEARGRFYITTPIYYPNDRLHIGHTYTTVAADALARYHRLR
FT                   GDDTWFLTGTDEHGQKIERAARKAGKEPLEYIDPIVEATKQLWHRLHISYDDFIRTSEP
FT                   RHEQRVQQIFQRLYEQGDIYKGVYEGLYCTACEAYYTEAELLDGQRCPVHETPVERLQE
FT                   ESYFFRLSKYAQPLLEHIERNPEFIQPPSRRNEVVAFIRQGLQDLSVSRTSFRWGIPVP
FT                   FDPDHVIYVWIDALANYITALGWPDGERYRRFWPADLHLIGKDILRFHAIIWPALLMAL
FT                   GEPLPRCVYGHGWLLIDGGKIGKSRAGGQVIDPVQLIEKYGVDPVRYFLLREVPFGDDG
FT                   SYSEDALVRRLNTDLANDLGNLAWRTTGMIQRFLDGRIPEPPGAASDGVLAAAARETVA
FT                   RVERAMAGFDLPAALQAIWDLIGRANKYIDEQAPWALRREGRRDRLEAVLYDVAETARV
FT                   VGVLLSPFLVETPPRLWTQLGLGPDYRPAGWREGLEWGQLPGGVRVVRDQPLFPRIDLD
FT                   EAAGAGGGEGTGPGAAGEPVAAAAASRDGGTAGVPATGAGGQGTAAAARDGGAEQVTID
FT                   EFARIELRTARVLVAEKHPRADRLLRLEVDLGGERRQIVAGIAAHYRPEELVGKTIVVV
FT                   ANLKPAVIRGVESQGMVLAAEDGQGLALLTTDRPIAEGSRIR"
FT   gene            86920..87792
FT                   /locus_tag="Tmar_0084"
FT   CDS_pept        86920..87792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0084"
FT                   /product="hydrolase, TatD family"
FT                   /note="COGs: COG0084 Mg-dependent DNase; InterPro
FT                   IPR001130: IPR015991: IPR012278: IPR018228; KEGG:
FT                   dau:Daud_0042 TatD family hydrolase; PFAM: TatD-related
FT                   deoxyribonuclease; SPTR: Hydrolase, TatD family; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD related DNase; TIGRFAM:
FT                   hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50209"
FT                   /db_xref="GOA:E6SL07"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL07"
FT                   /protein_id="ADU50209.1"
FT                   /translation="MTRNLAGAEPPAGSSTGPVLVDTHCHLDFPEFDPDRDQVVEAARA
FT                   AGVAAMITIGVDVASSRRAVDLAERYAGVYAAVGIHPHSAEEATPAALKELRGLAGHPR
FT                   VVAVGEIGLDYHRGRAGEVAQKRALRAQLELAAEFGLPVIIHQRDAVDDLWALLTAPAT
FT                   PRVPGVLHCFSAGPQWAMRWAEAGWFVGLDGPVTFKNGEDARAVARAVPLDRLLVETDA
FT                   PFLAPHPHRGRRNQPAWVRLVAERIAQERGLSLEELAARTTANAVRLFRLPLPGAGGTD
FT                   PAAGRPNQR"
FT   gene            87870..88802
FT                   /locus_tag="Tmar_0085"
FT   CDS_pept        87870..88802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0085"
FT                   /product="dimethyladenosine transferase"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro IPR020598: IPR001737: IPR011530:
FT                   IPR020596; KEGG: dau:Daud_0045 dimethyladenosine
FT                   transferase; PFAM: ribosomal RNA adenine methylase
FT                   transferase; PRIAM: rRNA (adenine-N(6)-)-methyltransferase;
FT                   SMART: Ribosomal RNA adenine methylase transferase-like;
FT                   SPTR: Ribosomal RNA small subunit methyltransferase A;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: Ribosomal RNA
FT                   adenine dimethylase; TIGRFAM: dimethyladenosine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50210"
FT                   /db_xref="GOA:E6SL08"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL08"
FT                   /protein_id="ADU50210.1"
FT                   /translation="MEAGSSRDAEPITRRAELRRWLEQYGVRPSRRLGQNFLVDDHWAE
FT                   RIVGAVEPGPDDVVLEVGPGLGALTERLVRRAGRVVAVEVDRRLAEALRQRLACVDNFQ
FT                   LVVADVLQVDLADLVARHLAPVGGDDMPAVKLASNLPYAITSPFLVRWLGSSVRWERAV
FT                   LTLQAEVVDRLVAAPGTAAYGALTVFVAYHARVERLGIVPAGAFWPRPEVDSAVVRLWP
FT                   HPQPPVAVADPDALFALVRAAFSQRRKRLANALAAHPAVDRRQAEAACRAAGLDPGARP
FT                   EEVDLEGFARLANQLFSSAAGRGPGPSAS"
FT   gene            88866..89342
FT                   /locus_tag="Tmar_0086"
FT   CDS_pept        88866..89342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0086"
FT                   /product="protein of unknown function DUF458"
FT                   /note="COGs: COG1978 conserved hypothetical protein;
FT                   InterPro IPR007405; KEGG: mta:Moth_0053 hypothetical
FT                   protein; PFAM: protein of unknown function DUF458; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF458)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50211"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL09"
FT                   /protein_id="ADU50211.1"
FT                   /translation="MQTPFISPTRGALSFDAMCAEILDYIRAEPDAQYKLIIGTDSQVR
FT                   QQTQFVTAVVVHRLGKGARYFYQARKQRKITSLRQKIFYEASLSLSLATRLAERLAARG
FT                   GTLPNVEIHLDVGMQGETRDLIREIVGMVVGSGFDAKIKPESYAASSVADRYTK"
FT   gene            complement(89303..89443)
FT                   /locus_tag="Tmar_0087"
FT   CDS_pept        complement(89303..89443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50212"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL10"
FT                   /protein_id="ADU50212.1"
FT                   /translation="MSSENCREEPKRRTLPRRGAQPVPGVRTLRHRALHFVYRSATDEA
FT                   A"
FT   gene            89539..89826
FT                   /locus_tag="Tmar_0088"
FT   CDS_pept        89539..89826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0088"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="COGs: COG4466 Uncharacterized protein; InterPro
FT                   IPR009366; KEGG: sth:STH3247 hypothetical protein; PFAM:
FT                   protein of unknown function DUF1021; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1021)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50213"
FT                   /db_xref="GOA:E6SL11"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL11"
FT                   /protein_id="ADU50213.1"
FT                   /translation="MGESRNVLAAIRRDLENYVGKRVRIRANKGRRRIVEREGTLEKTY
FT                   PNLFVIKLDEEYQNRRLSYTYADLLTAMVEVSVYNGKERKKLNYSASSAS"
FT   gene            90162..91169
FT                   /locus_tag="Tmar_0089"
FT   CDS_pept        90162..91169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0089"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR006204: IPR013750: IPR004424; KEGG:
FT                   dau:Daud_0058 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   PRIAM: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase; SPTR: 4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase; TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinases C terminal; GHMP kinases N
FT                   terminal domain; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50214"
FT                   /db_xref="GOA:E6SL12"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL12"
FT                   /protein_id="ADU50214.1"
FT                   /translation="MGRRGADDAGFPAGTVRLRAYAKVNLHLRIGPRRPDGYHEIDSVM
FT                   HRISWHDDLELRVRSDGAIRLEVVAGGGPGAASLAAVPSGPANLAWRAARLLQEAAGVR
FT                   RGADIRLVKRVAVGAGLGGGSADAAAVLFGLRRLWRLPLDARALRRLGEALGADVPFLL
FT                   GGRAARVRGKGECIEPLPPWPGLNLVLVPVARPVSTAWAYARWDRVQAARAGGPPPGPS
FT                   GVEPSGLQPETAGPGGPPVVWEFDGGAVAEALRNRDLGTLAHLVRNDFEPVVAADVPEV
FT                   AAALDALRQEGALAARMSGSGPVVWGIFPNGEAAARACRRLATRFPAARPVRTL"
FT   gene            91195..92007
FT                   /locus_tag="Tmar_0090"
FT   CDS_pept        91195..92007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: adg:Adeg_2095 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50215"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL13"
FT                   /protein_id="ADU50215.1"
FT                   /translation="MDGVIGAVILAGRRNEGALREIDPAEWEGLVPLAGRPMVAWVASA
FT                   CLEAPSVRQVVLVGPDPAPADAALAQAVEAGRLRVVEPGRDLLGSVRNGLVALQRALPG
FT                   VTGVLLVTGDVPLLTGAMLERFLAAIPAGADVGYPIARRQRMEARFPGAARTYVRLRDG
FT                   EFTGGNALYLRLAAAPRALGWAESLYAARKQPWKLAWMFGPGVLWRVLSRRATVAELER
FT                   RMGGLAGLRAHAVEVADPELAMDVDKVADYRQAEAWLQAAAGGGAARG"
FT   gene            92000..92815
FT                   /locus_tag="Tmar_0091"
FT   CDS_pept        92000..92815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0091"
FT                   /product="purine operon repressor, PurR"
FT                   /note="COGs: COG0503 Adenine/guanine
FT                   phosphoribosyltransferase and related PRPP-binding protein;
FT                   InterPro IPR015265: IPR000836: IPR010078; KEGG: sth:STH3244
FT                   pur operon repressor; PFAM: purine repressor ;
FT                   phosphoribosyltransferase; SPTR: Purine operon repressor,
FT                   PurR; TIGRFAM: pur operon repressor; PFAM: Phosphoribosyl
FT                   transferase domain; Bacterial purine repressor, N-terminal;
FT                   TIGRFAM: pur operon repressor, Bacillus subtilis type"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50216"
FT                   /db_xref="GOA:E6SL14"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL14"
FT                   /protein_id="ADU50216.1"
FT                   /translation="MAKLKRSERIAALVKLLADRPGHLWSLSQFAERFATAKSTISDDL
FT                   ALIKAVLDQEGLGTIRTYPGVAGGVSYEPRMTEAAAWQLAEELAAQLRDPQRILPGGFL
FT                   YMTDLLFTPFWVERLGALFATRFRAEEPDLVATVETKGIPLALMTARALGRPLVLLRRD
FT                   SRVTEGPSVSITYVSGSSQRIANMSVPRRAVPQGARVLLVDDFMKGGGTARGMMDLMRE
FT                   VGARVVGLGVVIATAEPARKLVEDYFAVAVLEGVDTVRRQVRIRPSLGR"
FT   gene            92907..94355
FT                   /locus_tag="Tmar_0092"
FT   CDS_pept        92907..94355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0092"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="COGs: COG1171 Threonine dehydratase; InterPro
FT                   IPR001926: IPR002912: IPR005789: IPR017975; KEGG:
FT                   drm:Dred_0097 threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; SPTR: L-threonine
FT                   ammonia-lyase; TIGRFAM: threonine dehydratase; PFAM: ACT
FT                   domain; Pyridoxal-phosphate dependent enzyme; TIGRFAM:
FT                   threonine ammonia-lyase, biosynthetic, long form; threonine
FT                   dehydratase, medium form"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50217"
FT                   /db_xref="GOA:E6SL15"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL15"
FT                   /protein_id="ADU50217.1"
FT                   /translation="MADGNASETVGHGPAAGGTGSGGAVIGGVEGGPGTGGARVDGAGG
FT                   AVSGTGERPEAVVPARAGGGQVPGGAGDPVDLEAIRRAAAAIAGFVHRTPLLGSAAFSE
FT                   LAGADVFLKLENLQKTGSFKVRGAFNRLSRLDAAARARGVICASAGNHAQGVALAGARL
FT                   GVPVTVVMPETAPTTKVVATRGYGAEVVLHGEGYDGAYDRACQLAEERGLTFIHAFDDP
FT                   LVVAGQGTVGLEILEDLPDVDTVVVPVGGGGLIAGIAIAVKAQKPGVRVVGVQPQEAPA
FT                   LARAFATGRLEPVVRARTIADGLAVKTPREMTFRLIQRYVDDMVTVTEEEIARAILLLL
FT                   ERAKLVAEGAGAAALAALLYGKVQHAGRVAVVVSGGNIDVNLLARIIERGLLEDGRLIR
FT                   IRTLVADRPGALQALLKVIADHRGNILAVYHDRLRHEVALGETEVELIIETRDAAHVDE
FT                   IRSALADRGYAVQGLEVQPAVRRP"
FT   gene            94593..94877
FT                   /locus_tag="Tmar_0093"
FT   CDS_pept        94593..94877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0093"
FT                   /product="SpoVG family protein"
FT                   /note="COGs: COG2088 Uncharacterized protein involved in
FT                   the regulation of septum location; InterPro IPR007170;
FT                   KEGG: lwe:lwe0165 regulatory protein SpoVG; PFAM: SpoVG
FT                   family protein; SPTR: SpoVG-1 protein; PFAM: SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50218"
FT                   /db_xref="GOA:E6SL16"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL16"
FT                   /protein_id="ADU50218.1"
FT                   /translation="MDISEVRIRPVKGAGRMRAFASIVFGGQFVVHELKVVEGAEGRMF
FT                   VAFPSKRAASGEYFDIAHPITAEARDRIQQAVLAAYRQQVGSVAAEQAG"
FT   gene            95354..95833
FT                   /locus_tag="Tmar_0094"
FT   CDS_pept        95354..95833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0094"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro IPR000866:
FT                   IPR017936; KEGG: sli:Slin_1584 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; PRIAM: Peroxiredoxin; SPTR: Alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50219"
FT                   /db_xref="GOA:E6SL17"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL17"
FT                   /protein_id="ADU50219.1"
FT                   /translation="MAAQVGDKAPDFRLPATGPEETISLGQFRGKKNVVLYFFPFAFSS
FT                   VCTQEMCALRDTYNEQFSGLDAQVLGISVDSPFTLRAWAEQQKFDFPLLSDFNKEVAKA
FT                   YDVYYDELMNLRGVAKRAAFVIDKDGVIRYRWVTDDPKVLPDQEAIRRVLADLQG"
FT   gene            95842..96306
FT                   /locus_tag="Tmar_0095"
FT   CDS_pept        95842..96306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0095"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tbd:Tbd_1995 putative
FT                   transmembrane protein; PFAM: RDD domain containing protein;
FT                   SPTR: Putative transmembrane protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50220"
FT                   /db_xref="GOA:E6SL18"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL18"
FT                   /protein_id="ADU50220.1"
FT                   /translation="MPVDRLDPAPLPLRWAAGLVDLILLGAVGNLAGLTVLELAGARGG
FT                   WGTVGLAVLVVLATAAAYFAAGEGRWGTTLGKLAVGIRVVAGDGRPPGFRRALGRFAVR
FT                   LVGTALLGAGWWPALVGSPRERGRTWHDAVAGTRAVRWRPWQQATGAAAR"
FT   gene            96440..97840
FT                   /locus_tag="Tmar_0096"
FT   CDS_pept        96440..97840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0096"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase;
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="COGs: COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains); InterPro IPR005835:
FT                   IPR001451: IPR005882: IPR018357; KEGG: tjr:TherJR_0131
FT                   UDP-N-acetylglucosamine pyrophosphorylase; PFAM:
FT                   Nucleotidyl transferase; transferase hexapeptide repeat
FT                   containing protein; SPTR: Bifunctional protein glmU;
FT                   TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase; PFAM:
FT                   Nucleotidyl transferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50221"
FT                   /db_xref="GOA:E6SL19"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL19"
FT                   /protein_id="ADU50221.1"
FT                   /translation="MDQPLCAVILAAGLGKRMRSGRAKVLHEVAGRPMVEHVVRAAEAA
FT                   GVDRIVVVVGHQASRIRDLLGNRVVYAEQAQPLGTGHAVLQAEGAVADAADVLVLYGDT
FT                   PLLEGELLRELIAAHRRSGAAATLLTVELDDPTGYGRIVRDETGQVARIVEEADATPAE
FT                   RAIREVNTGIACYRREPLFAALRQLTPANAQGEYYLVDVVARLRERGLPVATVTAPDPQ
FT                   QVEGVNDREALARAEALLRQRIRRRWMAAGVTLIDPASTWIDDDVEIGRDTVIYPHTVL
FT                   AAGSRIGEGCRLGPGAHITGSVLGRDVQVWYSVVEDSELGDGCRVGPFSHLRPGCRIAP
FT                   GVHIGNFAELKNAQVGEGTKVNHHSYLGDAQVGAGVNIGAGTVTVNYDGHRKLPTVIED
FT                   GAFIGCNTNLVAPVRVGRGAYIAAGSTINQDVPADALAIARERQVNKEGWAARWRQRAR
FT                   GRNGDGVR"
FT   gene            97827..98774
FT                   /locus_tag="Tmar_0097"
FT   CDS_pept        97827..98774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0097"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR000836: IPR005946: IPR000842; KEGG:
FT                   chy:CHY_0193 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: Ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50222"
FT                   /db_xref="GOA:E6SL20"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL20"
FT                   /protein_id="ADU50222.1"
FT                   /translation="MAYDSARLKLFSGSANPELARAIAQHIGVPLGDLELGRFANGEVR
FT                   VSVNESVRGADVFVIQPTCYPPNDTLMELLVLLDALKRASAWRVNAVVPFYGYARQDRK
FT                   TRPREPITAKLVANLLTVAGADRVVTMDLHAGQIQGFFDVPVDHLTAVPLLADYFARKQ
FT                   LEKPVVVSPDHGGVSRARELADRLGVPIAIIDKRRPEPGVAEVMSVVGEVKGRTAIMID
FT                   DIIDSGGTIRHGAEALIALGARAVYACCTHAVFSGNALQKLAEAPIEEIVVTDTIPLPP
FT                   GAEKARVKVLSVAPLLGEAIVRIHEDLSVSRLFT"
FT   gene            98881..99504
FT                   /locus_tag="Tmar_0098"
FT   CDS_pept        98881..99504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0098"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="COGs: COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc); InterPro IPR020055: IPR001021; KEGG:
FT                   adg:Adeg_1818 50S ribosomal protein L25/general stress
FT                   protein Ctc; PFAM: Ribosomal protein L25-like; SPTR: 50S
FT                   ribosomal protein L25; TIGRFAM: ribosomal 5S rRNA E-loop
FT                   binding protein Ctc/L25/TL5; PFAM: Ribosomal L25p family;
FT                   TIGRFAM: ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50223"
FT                   /db_xref="GOA:E6SL21"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL21"
FT                   /protein_id="ADU50223.1"
FT                   /translation="MQAVLRAVPREPGHARRVRREGGIPAVLYGPSGNFPVRLDAREFH
FT                   RLLASGRARGVLTVELVRDGQTRQLSAMVKELQWHPARGDLLHVDLFEVREDEPVRAVV
FT                   PIALTGTEEAEKRGIVQHQLAELEIECLPRYIPPVVEADVANLPVGEEVRVKDLVVPPQ
FT                   VRVLNDPDEIVAVLLPPKELVDEEAQPEEAGEAAAAAPKTEGES"
FT   gene            99663..100325
FT                   /locus_tag="Tmar_0099"
FT   CDS_pept        99663..100325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0099"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COGs: COG0193 Peptidyl-tRNA hydrolase; InterPro
FT                   IPR001328: IPR018171; KEGG: sth:STH3238 peptidyl-tRNA
FT                   hydrolase; PFAM: peptidyl-tRNA hydrolase; PRIAM:
FT                   Aminoacyl-tRNA hydrolase; SPTR: Peptidyl-tRNA hydrolase;
FT                   TIGRFAM: peptidyl-tRNA hydrolase; PFAM: Peptidyl-tRNA
FT                   hydrolase; TIGRFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50224"
FT                   /db_xref="GOA:E6SL22"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL22"
FT                   /protein_id="ADU50224.1"
FT                   /translation="MPRIIVGLGNPGPEYEGTRHNVGFAVVDALARRLRTAGWRRGFAS
FT                   LWAEGSWRGQPVALLKPQTYMNASGEAVQQACRAWRVPPAEVLVVYDDLDLPPGHLRLR
FT                   PRGSAGGHRGVASIIAALGGEDFPRLRIGIGRPPAGVDAAEYVLAPFDPAEQPLMEAAV
FT                   QRAAEAVLAVLATGLQLAMSRYNGPTPWPPGEGGGRGDGGSAAGRSGGSGGGGGKDR"
FT   gene            100322..103981
FT                   /locus_tag="Tmar_0100"
FT   CDS_pept        100322..103981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0100"
FT                   /product="transcription-repair coupling factor"
FT                   /note="COGs: COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase); InterPro IPR014001: IPR001650:
FT                   IPR003711: IPR011545: IPR 005118: IPR004576: IPR014021:
FT                   IPR018106; KEGG: sth:STH3235 transcription-repair coupling
FT                   factor; PFAM: transcription factor CarD; DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; TRCF
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: Transcription-repair coupling factor;
FT                   TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   Helicase conserved C-terminal domain; TRCF domain;
FT                   CarD-like/TRCF domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   transcription-repair coupling factor (mfd)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50225"
FT                   /db_xref="GOA:E6SL23"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL23"
FT                   /protein_id="ADU50225.1"
FT                   /translation="MTTLPAQDLTEDLLRLWQQLPEFPSLAGGVRRELPAQAVYGLAGP
FT                   AAASLLAALAAATGRTLFIFTADQGAADALAADLRAWAPAEQVVVFPSIEVLPFEVLAA
FT                   SPELLALRLEALARIRQGPCLVVAPVGAVARRLPRPERWAAGLIDLEPGRVLDRDELLA
FT                   RLVAAGYQRAEQVDRPGEVAVRGGIVDVYPPAGEPVRIEFFGDEIDSLRRFDPGSQRST
FT                   ETLARVRLVPARELVLDGPAWQQGLRALAGEIERLREQTRQRRGGAARQLLERLEQDLA
FT                   RLEAERPLDLAERYLPFFEPAMATLLDYAPGPALAVWVEPRNLEEAVADRERQWQERQA
FT                   DLLSRGEILPAQASLYLDEPGLWRALASRPVLYLSLLLRAPGQGPDPRQVYGITARPAP
FT                   MFHGQWDLFEEEVRTWKRQQYRVLVVAGDGERAERLRRALDEADVVARLVPGLTLPAPG
FT                   EVLVAPAALSEGFEVPALRWVVLTEREVLGRRVARRRSPTTAADRAETQALERLVDLKP
FT                   GDYVVHVHHGIGRFLGLRTMEIQGVHRDYLTIQYAGGDRLYVPTDQIELVQKYVGAEGH
FT                   QPRLAKLGSGEWNKVKQRVKESVRELAGELLALYAARQTLRGHAFGPDTPWQRQFEDAF
FT                   PYQETPDQLEAIAAIKADMERPVPMDRLLVGDVGFGKTEVAMRAAFKAVQDGKQVAVLV
FT                   PTTVLAYQHERTFKERFAPFPVTIRTLSRFASPAEQAEILTGLAQGTIDIVIGTHRLVQ
FT                   PDVRFKDLGLLIIDEEHRFGVAHKERLKQLKQNVDVLTLSATPIPRTLHMALAGIRDLS
FT                   RIDTPPENRFPVQTFVVEWHESLVRDAIQRELRRGGQVFYVHNRVQSIQAVRRRLERLV
FT                   PEARFAVAHGQMGEGELERVMVDFMAGKADVLVCTTIIESGLDMPNVNTLIVEDADRFG
FT                   LAQLYQLRGRVGRSDRVAYAYFTYRRDKVLTEDAQKRLQAIKDFTELGAGFKLALRDLE
FT                   IRGAGNLLGAEQHGFMLSVGFDLYAQLLEEAVAELRGRRRPARLKPVVDLVVDAHIPDS
FT                   YIRDARQKIEFYKRVNLAETPADLAEVREALQDRYGPPPEPVRNLLALAEIRQLAARCG
FT                   VFRIEQQGTRVDLEAVAPQAEPLARTCEALRPQLGRRLQPVRGRPAAFFRTDGLGEREV
FT                   LTALRRFLRELVRHTPGGGGGPEGGEGEDAEKAAAGTPDEPAPATPVRGGVRS"
FT   gene            104241..104801
FT                   /locus_tag="Tmar_0101"
FT   CDS_pept        104241..104801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0101"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="InterPro IPR007159: IPR014213: IPR006339; KEGG:
FT                   tjr:TherJR_0180 transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein; SPTR:
FT                   Transcriptional regulator, AbrB family; TIGRFAM: stage V
FT                   sporulation protein T; transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT / AbrB like domain; TIGRFAM:
FT                   looped-hinge helix DNA binding domain, AbrB family; stage V
FT                   sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50226"
FT                   /db_xref="GOA:E6SL24"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL24"
FT                   /protein_id="ADU50226.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPIGELGDFAKELADSLHEAVHHIALVADRDAIIAVAGAPRKEFMEKRIGGAVEE
FT                   AMAKRQPVLRNRPARNPGAGTLLADDETDERFSAYVIAPILATGDVIGAVILASKDPAV
FT                   QMGDLELKLAETAAAVLRKQMED"
FT   gene            104840..105997
FT                   /locus_tag="Tmar_0102"
FT   CDS_pept        104840..105997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0102"
FT                   /product="MazG family protein"
FT                   /note="COGs: COG3956 Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain; InterPro IPR004518: IPR011551;
FT                   KEGG: bts:Btus_0079 MazG family protein; PFAM: MazG
FT                   nucleotide pyrophosphohydrolase; SPTR: MazG family protein;
FT                   TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase domain; TIGRFAM: MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50227"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL25"
FT                   /protein_id="ADU50227.1"
FT                   /translation="MKEEHRTVPDAPGPVGPGPRPADPGPARGAASSGPDPGAGRGAAS
FT                   DAGPGGDPYGFGRVVELVRRLRAPGGCPWDRAQTHRSLRRFALEEAYEVVAAIDAGDPR
FT                   HLADELGDLLLQVLLHAQIAAEAGHFTIADVCHALADKLIRRHPHVFGGVEADSPADVQ
FT                   RLWAAIKRAEAAAREGVPAGEAAGAGGREGGASAAGVPEGQAGAGPAAGEAVAGPPSGA
FT                   AGEPVPEVAGGRDDEPWTPAALVEAYRVQERAARLGLDWPDPRGPRAKLDEELAELDAA
FT                   VAEGDPQHVEEELGDVLFVLVNAGRHWGVHAETALLGAVRKFRRRIHQMEEQARRQGRT
FT                   LEELSPAELDRLWEAAKARETGRIQGLSAEHTSGTRPDARGGKRG"
FT   gene            105994..106266
FT                   /locus_tag="Tmar_0103"
FT   CDS_pept        105994..106266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0103"
FT                   /product="bacterial nucleoid protein Hbs"
FT                   /note="COGs: COG0776 Bacterial nucleoid DNA-binding
FT                   protein; InterPro IPR000119: IPR020816; KEGG: sth:STH3230
FT                   non-specific DNA-binding protein; PFAM: histone family
FT                   protein DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein; SPTR: Non-specific DNA-binding
FT                   protein; PFAM: Bacterial DNA-binding protein; TIGRFAM:
FT                   integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50228"
FT                   /db_xref="GOA:E6SL26"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL26"
FT                   /protein_id="ADU50228.1"
FT                   /translation="MNKPELVNAIAEKTGLNRKDSEKAVNAFVESISEALAKGEKVSLV
FT                   GFGTFEVRTRQARTGRNPRTGQTLTIPAAKVPAFKPGKQLREVVK"
FT   gene            106737..107033
FT                   /locus_tag="Tmar_0104"
FT   CDS_pept        106737..107033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0104"
FT                   /product="sporulation protein YabP"
FT                   /note="InterPro IPR012504; KEGG: sth:STH3228 hypothetical
FT                   protein; PFAM: YabP family protein; SPTR: Sporulation
FT                   protein YabP; TIGRFAM: sporulation protein YabP; PFAM: YabP
FT                   family; TIGRFAM: sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50229"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL27"
FT                   /protein_id="ADU50229.1"
FT                   /translation="MAEGQAAPGNRGRHTLTLAGRERLDLDGVQRVENFDDHTVVLETV
FT                   MGRLTIRGEGLHIHELNLEEGRLRMTGRVSLLAYEDSAQRRRDRRNLLERLLK"
FT   gene            107080..107745
FT                   /locus_tag="Tmar_0105"
FT   CDS_pept        107080..107745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0105"
FT                   /product="Spore cortex biosynthesis protein, YabQ"
FT                   /note="InterPro IPR019074; KEGG: sth:STH3227 hypothetical
FT                   protein; PFAM: Spore cortex biosynthesis protein,
FT                   YabQ-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   Spore cortex protein YabQ (Spore_YabQ); TIGRFAM: spore
FT                   cortex biosynthesis protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50230"
FT                   /db_xref="GOA:E6SL28"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL28"
FT                   /protein_id="ADU50230.1"
FT                   /translation="MFSLTVQTYMLAVNVALGLTLGFVFDACRALRAVLAGGRPARRPW
FT                   LDAVMDAVFWLAALPAVLLTWGWGNWGQVRLFTFLGLALGLGLYAALGSPVLFPALAAT
FT                   YRATGQGAVRFVRWNRRVARAAGRAAWRGARGLLRLVRWVLKPVTVPLGWLLAPLLAPV
FT                   NRYVVDPVRARVQRFVVEPARRRVAAARHRFAAGWDRLRSVLAAWLRPGEDEPPPPAT"
FT   sig_peptide     107080..107169
FT                   /locus_tag="Tmar_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            108019..108303
FT                   /locus_tag="Tmar_0106"
FT   CDS_pept        108019..108303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0106"
FT                   /product="Sigma-70 region 4 type 2"
FT                   /note="InterPro IPR013249: IPR000792; KEGG: dau:Daud_0081
FT                   regulatory protein, LuxR; PFAM: Sigma-70 region 4 type 2;
FT                   SPTR: Regulatory protein, LuxR; PFAM: Sigma-70, region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50231"
FT                   /db_xref="GOA:E6SL29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL29"
FT                   /protein_id="ADU50231.1"
FT                   /translation="MRIEIRGAERLSFRERQVVVLKETGYSTEAIARRLGLAPGTVATL
FT                   YNRARSKGYEVVIVIDGDPLRLFGEGDEDAPDEGPAGPGGTGADGTEGP"
FT   gene            108417..108947
FT                   /locus_tag="Tmar_0107"
FT   CDS_pept        108417..108947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0107"
FT                   /product="Septum formation initiator"
FT                   /note="InterPro IPR007060; KEGG: kra:Krad_1074 septum
FT                   formation initiator; PFAM: Septum formation initiator;
FT                   SPTR: Septum formation initiator; PFAM: Septum formation
FT                   initiator; General secretion pathway protein L (GspL)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50232"
FT                   /db_xref="GOA:E6SL30"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL30"
FT                   /protein_id="ADU50232.1"
FT                   /translation="MGPAGLLRPVPVTPLPRAVPAPVSKGAGRSPAGRPYDPGRALAGR
FT                   EVRGGSGEAVGAATGPRPVRRRWRLRWGRLAATAVAAYLLAGLVLQQVALWQARQELRA
FT                   LDRQLQELRGQQAELRAAEQRVDDPAYVDETARQRLGLVKPGETVIQLVDEPGAAGSPA
FT                   AQSPGSPGAPAGR"
FT   sig_peptide     108417..108497
FT                   /locus_tag="Tmar_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            109262..109344
FT                   /locus_tag="Tmar_R0018"
FT   tRNA            109262..109344
FT                   /locus_tag="Tmar_R0018"
FT                   /product="tRNA-Leu"
FT   gene            109548..109772
FT                   /locus_tag="Tmar_0108"
FT   CDS_pept        109548..109772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_3116 binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50233"
FT                   /db_xref="GOA:E6SL31"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL31"
FT                   /protein_id="ADU50233.1"
FT                   /translation="MDGELGTLLMKLVLALVGGGLTIVGLAGIIQGSLSSLRVPNRVVA
FT                   TVVFIVGLALVTIFGEPDLVTKIMGAMGE"
FT   sig_peptide     109548..109613
FT                   /locus_tag="Tmar_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(109836..110780)
FT                   /locus_tag="Tmar_0109"
FT   CDS_pept        complement(109836..110780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0109"
FT                   /product="Na+/Picotransporter"
FT                   /note="COGs: COG1283 Na+/phosphate symporter; InterPro
FT                   IPR003841; KEGG: mvo:Mvol_0827 Na/Pi-cotransporter
FT                   II-related protein; PFAM: Na+/Picotransporter; SPTR:
FT                   Na/Pi-cotransporter family protein; PFAM:
FT                   Na+/Pi-cotransporter; TIGRFAM: Na/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50234"
FT                   /db_xref="GOA:E6SL32"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL32"
FT                   /protein_id="ADU50234.1"
FT                   /translation="MPFAPLGRIAVNVAGLAAGLALTTWGLRQAAGDRLEQTVHRLHDA
FT                   GPYHGLVAGLVLTALLQSSSTFGLLLLAAAAAGWAPRSAARGALVGANLGTTLTAHLTA
FT                   APSAGLAVLLAGGGLALAAATWRRPRLRAAGLAALGFAAALTGLDGLGRALGSLTGASA
FT                   GGAGGAGAWAAWVRQPWAGFTAGLVLSAAALSSSAVLALLQRAVAAGFLRPGEALPVVY
FT                   GANVGTTSDVLLAGLLLRGPALDLALFHLGMNAATAAVALPLGPALAAAAHALTDDPAR
FT                   QVAWAHTLFNVLGAVLVWPWVTGGPRPRKEAGP"
FT   sig_peptide     complement(110691..110780)
FT                   /locus_tag="Tmar_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(111057..111164)
FT                   /locus_tag="Tmar_0110"
FT   CDS_pept        complement(111057..111164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50235"
FT                   /db_xref="GOA:E6SL33"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL33"
FT                   /protein_id="ADU50235.1"
FT                   /translation="MRLTMRTRAKTRIPNWVISAAGAVAAMIIARLIRR"
FT   sig_peptide     complement(111090..111164)
FT                   /locus_tag="Tmar_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(111276..112235)
FT                   /locus_tag="Tmar_0111"
FT   CDS_pept        complement(111276..112235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0111"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR013027: IPR005982: IPR008255: IPR000103; KEGG:
FT                   ttr:Tter_1226 thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; SPTR:
FT                   Thioredoxin reductase; TIGRFAM: thioredoxin reductase;
FT                   PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   TIGRFAM: thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50236"
FT                   /db_xref="GOA:E6SL34"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL34"
FT                   /protein_id="ADU50236.1"
FT                   /translation="MSSQRVVIVGSGPAGLTAAIYAARANLDTTVVAGWEAGGQLMLTT
FT                   EVENFPGFPDGILGPDLMARMRQQAERAGARFVDGDVTGVDFSQRPFKLKVGSKELEAD
FT                   AVIIATGASAKWLGLPGEKKLMGRGVSSCATCDGAFFRDQDVVVVGGGDTAMEEALYLA
FT                   RICRSVTVIHRRDRLRASKIMQERAMAHDRIRFVWDTVVEDILGEDKVEGVRVRNVKTG
FT                   EVSQIPCAAVFVAIGHKPNTEFLRGHLDLDERGYIIADGPRTRIPGVFVAGDVRDHRYR
FT                   QAVTAAAEGCKAAMEAAWFLEGTSDVVPAAPGQEAGVR"
FT   sig_peptide     complement(112161..112235)
FT                   /locus_tag="Tmar_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            112449..112943
FT                   /locus_tag="Tmar_0112"
FT   CDS_pept        112449..112943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0112"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR002563; KEGG: cag:Cagg_2035 flavin reductase
FT                   domain protein FMN-binding; PFAM: flavin reductase domain
FT                   protein FMN-binding; SPTR: Flavin reductase domain protein
FT                   FMN-binding; PFAM: Flavin reductase like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50237"
FT                   /db_xref="GOA:E6SL35"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL35"
FT                   /protein_id="ADU50237.1"
FT                   /translation="MPIVPQLLRQAMGQFATGVTLVTAEVDGTVHAMTANAITSVSLEP
FT                   PLVLVCVGRERVMHGVLEQAGRYGINVLAAEQEPVARFFARQTDQEPAYRFIKEPPRAP
FT                   RLEGALAYLDCRIVERLPGGDHTIFLAEVEHAEVQGGDPLLFFGGRYGRLASQPAAPSL
FT                   R"
FT   gene            complement(113641..114042)
FT                   /locus_tag="Tmar_0113"
FT   CDS_pept        complement(113641..114042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0113"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR002871: IPR011341; KEGG:
FT                   ttr:Tter_1695 SUF system FeS assembly protein, NifU family;
FT                   PFAM: nitrogen-fixing NifU domain protein; SPTR: SUF system
FT                   FeS assembly protein, NifU family; TIGRFAM: SUF system FeS
FT                   assembly protein, NifU family; PFAM: NifU-like N terminal
FT                   domain; TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50238"
FT                   /db_xref="GOA:E6SL36"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL36"
FT                   /protein_id="ADU50238.1"
FT                   /translation="MGSDFYRENILDHYRNPRNRGTLEGAQIRHEDMNPLCGDQVRFEV
FT                   RLDDGGRVEAAAFDGRGCAISQASASMLTEAVQGKTLDEIKTMDKDDVLAMLGIPLSPV
FT                   RLKCALLALKVLQAGIYRYEAEHAGGREA"
FT   gene            complement(114073..115368)
FT                   /locus_tag="Tmar_0114"
FT   CDS_pept        complement(114073..115368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0114"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /EC_number="4.4.1.16"
FT                   /note="COGs: COG0520 Selenocysteine lyase; InterPro
FT                   IPR000192: IPR010970: IPR020578; KEGG: sti:Sthe_1525
FT                   cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; SPTR: Cysteine desulfurase;
FT                   TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   Aminotransferase class-V; TIGRFAM: cysteine desulfurases,
FT                   SufS subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50239"
FT                   /db_xref="GOA:E6SL37"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL37"
FT                   /protein_id="ADU50239.1"
FT                   /translation="MAIPGRPSAGAPVPAPGAGTSPASFDPAVIRRDFPILQRQVHGRP
FT                   LAYLDSAATSQKPGAVIDALAEFYRQSNANVHRGIHTLAEEATAAYEGARARTAAFLGA
FT                   REDEIVFTRGATEALNLVAWGWALHRLRPGDTILVTLMEHHSNLVPWQQVAARGGFHLR
FT                   AVPLTGDGRLDRDAFTRLLEEHRPKVVALAHMSNVLGTINPVAELARQARQAGAVVVVD
FT                   GAQSVPHLPVDVAELGVDFLAFSAHKMLGPTGLGVLYGRRERLAEMEPLLGGGGMIRQV
FT                   EVERSTWADPPHRFEAGTPPIAEAAAFTAALDYLERLGMEAVAAHERELVRYAWERLRE
FT                   IPGLTIYGPAPEHRGGVISFTVEGVHPHDLAQVLDGEGVAIRAGHHCTQPLHRHLGVVA
FT                   TARASFYIYNDRDDVDRLVAALHHARRLLAGS"
FT   sig_peptide     complement(115300..115368)
FT                   /locus_tag="Tmar_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(115543..116865)
FT                   /locus_tag="Tmar_0115"
FT   CDS_pept        complement(115543..116865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0115"
FT                   /product="SufBD protein"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR000825; KEGG: rxy:Rxyl_0168 iron-regulated ABC
FT                   transporter permease protein SufD; PFAM: SufBD protein;
FT                   SPTR: Iron-regulated ABC transporter permease protein SufD;
FT                   PFAM: Uncharacterized protein family (UPF0051); TIGRFAM:
FT                   FeS assembly protein SufD, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50240"
FT                   /db_xref="GOA:E6SL38"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL38"
FT                   /protein_id="ADU50240.1"
FT                   /translation="MANSLDNLDTLAQAQGFTADLVDRIARAHDEPDWLVERRREALRI
FT                   FNELPLPSWRHTKVDDLNLQALRPVAPASALPAWAEAALPPATEAAAIAVQTDGRVEVR
FT                   HMDPALADRGLVVTDLHTAARTHADLVEKYYMKSGLDPRSDRFAALHAAFWTGGFFVYV
FT                   PRGLVVEKPIYLITLITAGAAGASVSGHGLVVVDEQAQATLFDESDAHDLSEAALYTGQ
FT                   LEIHVQPAARLDYVSVQNWRAPVREFSQKAGVVRRDATLVATTGFFGGSQTRNLFTLEM
FT                   VEPGASMENILAYAASGQQHFDLFTKSRHASQSTFGNMTARGILTGASRLVYQGLIRIE
FT                   RGAHKSEDYLSSNTLILSPEAKVLDDIPSLEIEADDVKASHGATVGQVDQEQLFYLRSR
FT                   GLDEKQARRLLVSGFFEPLLGKIPNDAARERISELVLEKVV"
FT   gene            complement(116892..117671)
FT                   /locus_tag="Tmar_0116"
FT   CDS_pept        complement(116892..117671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0116"
FT                   /product="Iron-regulated ABC transporter ATPase subunit
FT                   SufC"
FT                   /note="COGs: COG0396 ABC-type transport system involved in
FT                   Fe-S cluster assembly ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR010230; KEGG: rxy:Rxyl_0171 FeS assembly
FT                   ATPase SufC; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: FeS assembly ATPase SufC; TIGRFAM: FeS
FT                   assembly ATPase SufC; PFAM: ABC transporter; TIGRFAM: FeS
FT                   assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50241"
FT                   /db_xref="GOA:E6SL39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL39"
FT                   /protein_id="ADU50241.1"
FT                   /translation="MASTLEIRELRCNVEEKEILKGVNLTVRQGEVHAIMGPNGSGKST
FT                   LAYTLMGHPRYEVTGGEVLLDGENILELPPDERAKRGLFLAFQYPQEVPGVSVANFLRT
FT                   AVNSLRGEEPAGPAGSGKNLASLAALQKEIEGALEQLRWDPSFTRRYLNEGFSGGEKKK
FT                   GEMLQMAVLKPKFAIMDETDSGLDIDALKDVARVFNSLRGPQLGAIVITHYQRILKYIE
FT                   PDFVHIMVDGRIVRSGGRELAEEVEAKGYDWIKAQVG"
FT   gene            118033..119124
FT                   /locus_tag="Tmar_0117"
FT   CDS_pept        118033..119124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0117"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="COGs: COG1363 Cellulase M and related protein;
FT                   InterPro IPR008007; KEGG: cag:Cagg_2259 cellulase; PFAM:
FT                   peptidase M42 family protein; PRIAM: Cellulase; SPTR:
FT                   Cellulase; PFAM: M42 glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50242"
FT                   /db_xref="GOA:E6SL40"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL40"
FT                   /protein_id="ADU50242.1"
FT                   /translation="MATRSDTARLLEELAEAPGVPGAEDAVRQVMRRYLEPVAELEQDH
FT                   LGSLIARRRGTADRPRILLAAHMDEVGFMVRRITDEGYLKFQPLGGWWGQVLLAQRVTV
FT                   YTRRGPILGVIGSKPPHVLPPDERKKTVEIKDMFIDVGASGRQQAEEWGIRPGDPVVPY
FT                   GPFTRLHNPDLVLAKALDDRAGCAVIVRVLEELAGTEHPNTVYGVATVHEEVARTGGGA
FT                   RTSAFAVDPDVAVAVDVGIAGDVPGVQPDEAQSRLGRGPTVLLFDSSMVPHRRLRDLVA
FT                   DTAEAEGIPYQFDMMPGGATDAGFFHVHGRGVPSVVVGPPARYVHSHGAIVHLDDVENT
FT                   VRLLVALVRRLDAATVDALRRGG"
FT   gene            119456..119821
FT                   /locus_tag="Tmar_0118"
FT   CDS_pept        119456..119821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0118"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="InterPro IPR000701: IPR014314; KEGG: sti:Sthe_0999
FT                   succinate dehydrogenase, cytochrome b556 subunit; PFAM:
FT                   succinate dehydrogenase cytochrome b subunit; SPTR:
FT                   Succinate dehydrogenase, cytochrome b556 subunit; TIGRFAM:
FT                   succinate dehydrogenase, cytochrome b556 subunit; PFAM:
FT                   Succinate dehydrogenase/Fumarate reductase transmembrane
FT                   subunit; TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50243"
FT                   /db_xref="GOA:E6SL41"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL41"
FT                   /protein_id="ADU50243.1"
FT                   /translation="MGLYRGYRGSQGQWAWMLHRLSGVGIMLFLMMHIVDTFLAGFGPQ
FT                   VYDHVMALYRAPLFMVLEVVLVAGVVYHAVNGLRVIVIDFWPNALRWHKPLIVAEAIVF
FT                   LVLFIPAAVIMLGRLFG"
FT   sig_peptide     119456..119566
FT                   /locus_tag="Tmar_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            119834..120211
FT                   /locus_tag="Tmar_0119"
FT   CDS_pept        119834..120211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0119"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG2142 Succinate dehydrogenase hydrophobic
FT                   anchor subunit; KEGG: tro:trd_0332 succinate dehydrogenase,
FT                   membrane subunit; SPTR: Succinate dehydrogenase, membrane
FT                   subunit; PFAM: Succinate dehydrogenase/Fumarate reductase
FT                   transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50244"
FT                   /db_xref="GOA:E6SL42"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL42"
FT                   /protein_id="ADU50244.1"
FT                   /translation="MSYGEGSPRPASGFELWSWFFMRISGLLLVFLVLGHLYIMHILNS
FT                   VEIIDYNFVARRWANIGWRTYDWVMLALALFHGANGIRVIIDDYAHRPGWRTFWLALLY
FT                   VVTFILLVLGTVVLVTFPFPA"
FT   gene            120284..121969
FT                   /locus_tag="Tmar_0120"
FT   CDS_pept        120284..121969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0120"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR003953:
FT                   IPR004112: IPR014006: IPR011281: IPR 003952; KEGG:
FT                   ttr:Tter_0785 succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; SPTR: Succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; TIGRFAM: succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein subunit;
FT                   succinate dehydrogenase, flavoprotein subunit; PFAM:
FT                   domain; FAD binding domain; TIGRFAM: succinate
FT                   dehydrogenase, flavoprotein subunit, E. coli/mitochondrial
FT                   subgroup; succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunitGram-negative/mitochondrial subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50245"
FT                   /db_xref="GOA:E6SL43"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL43"
FT                   /protein_id="ADU50245.1"
FT                   /translation="MRAAVELAKHPDLKVAVVSKLYPSRSHTGAAQGGIGAALGNIEED
FT                   HWEWHMFDTVKGSDYLGDQDAIEIMCKEAPEAVYELEHMGLPFSRTEDGRINQRRFGGH
FT                   TKEFGKAPVHRSCFAADRTGHMILQTLYQQSIKHGVRFFDEFHVVDLIMDGRRVAGVVA
FT                   IELATGDLHVFHAKATLFATGGAGRMYKVTSNALALTGDGLAIAFRHGIPLEDMEFFQF
FT                   HPTGIYRLGILITEGARGEGGILRNRYGERFMERYAPTIKDLAPRDVVSRSIYLEIREG
FT                   RGIDGKDYVHLDLTHLGRDVIETRLPDITDFVRTYLGIDPVEEPIPIQPTAHYEMGGIP
FT                   TDVDGRVIWDAQNTPVEGFYAAGECACVSVHGANRLGTNSLLDLVVFGRRAGRHMAQYA
FT                   READWPALPDDAADWARQQVERFRTREKGEKVGAIRARLQEEMMDKAGVFRTEEGLREM
FT                   EGILKELEAQYQEAAIDDRGSMYNTDLLEALELGNLLECAKATVVAARNRKESRGGHAR
FT                   EDYPKRDDANWLKHTLLFREKDGSIRIDYKPVVITRFQPQERKY"
FT   gene            122096..122794
FT                   /locus_tag="Tmar_0121"
FT   CDS_pept        122096..122794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0121"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterPro IPR004489:
FT                   IPR001041: IPR017896: IPR017900; KEGG: sti:Sthe_0996
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein; PRIAM: Succinate dehydrogenase; SPTR: Succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   TIGRFAM: succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50246"
FT                   /db_xref="GOA:E6SL44"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL44"
FT                   /protein_id="ADU50246.1"
FT                   /translation="MQVTLRIRRYNPEHDREPHWEEYRLQADPTDRVLDLLNRVKWEVD
FT                   GTLAYRRSCAHGVCGSDAMIINGKARLACKTLVKELSQPITVEPMRGFRVKKDLIVDFT
FT                   GFFAAYRSIKPYLINNDPEPERERLQSPHDRERFDDTTKCILCGCCTTSCPSFWANPDY
FT                   VGPAAIVNAHRFIFDSRDQAADERLRILNSRDGVWRCRTIFNCTEACPRGIEVTRAIQE
FT                   VKRAILLGQR"
FT   gene            123833..124390
FT                   /locus_tag="Tmar_0122"
FT   CDS_pept        123833..124390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0122"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COGs: COG2096 conserved hypothetical protein;
FT                   InterPro IPR002779: IPR017858; KEGG: rrs:RoseRS_1980
FT                   ATP--cobalamin adenosyltransferase; PFAM: cobalamin
FT                   adenosyltransferase; PRIAM: Cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; SPTR: ATP:cob(I)alamin
FT                   adenosyltransferase; TIGRFAM: ATP/cobalamin
FT                   adenosyltransferase; PFAM: Cobalamin adenosyltransferase;
FT                   TIGRFAM: ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50247"
FT                   /db_xref="GOA:E6SL45"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL45"
FT                   /protein_id="ADU50247.1"
FT                   /translation="MKIYTRTGDAGETGLLGGGRVPKSHPRVEAYGAVDELNAMLGLAA
FT                   AYLDGEEPAALLRELQQDCFLLGADLAAPPGPARRQETGLPQVTAQRVQALEAWIDRLD
FT                   AELPPLRQFILPGGTVAASALHVARTVARRAERRVAALAAQEEVNPVILQYLNRLSDLL
FT                   FVLARWVNHRAGVPDVPWQREP"
FT   gene            complement(124521..124596)
FT                   /locus_tag="Tmar_R0019"
FT   tRNA            complement(124521..124596)
FT                   /locus_tag="Tmar_R0019"
FT                   /product="tRNA-Lys"
FT   gene            complement(124742..124818)
FT                   /locus_tag="Tmar_R0020"
FT   tRNA            complement(124742..124818)
FT                   /locus_tag="Tmar_R0020"
FT                   /product="tRNA-Met"
FT   gene            125751..126299
FT                   /locus_tag="Tmar_0123"
FT   CDS_pept        125751..126299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mdo:100011127 hypothetical protein
FT                   LOC100011127; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50248"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL46"
FT                   /protein_id="ADU50248.1"
FT                   /translation="MRWVFLGRFGEASRRCAVFVLGRHDVLAAILEPKARSRTGWHEFC
FT                   FRAAVRDWVVHHLAGAGPLLGLQYALTPDGYETEWLVYCPACGAGPFHVPCQAGEAGTG
FT                   PRTWDDRQLIRYLAEAFRHVHQAPDPGGRPAGGPPERCPADPDEHGPPDGTATVPGPAE
FT                   RALAGPACARGWGRGPGGR"
FT   sig_peptide     125751..125834
FT                   /locus_tag="Tmar_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(126522..127856)
FT                   /locus_tag="Tmar_0124"
FT   CDS_pept        complement(126522..127856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0124"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: tth:TTC0899 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Hypothetical membrane spanning
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50249"
FT                   /db_xref="GOA:E6SL47"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL47"
FT                   /protein_id="ADU50249.1"
FT                   /translation="MDGRTLALAGLTLVFWSSAFTVIRAGLAYWSPGQLALVRFLVASV
FT                   ALAVGIGLQHAARRRGQRAGACRGRGLRPDRVRWAAPGKPAAAANGRPGPHGPHDARRR
FT                   LPLRDAGRFLVLGATGIFLYHTGLNWGETRVPAGTASLLVATAPALTALLSRLWLGERL
FT                   APRAWLGLALSFTGVAIISWAASTGPVSPAGMAGAVKPLSASGPAGLAAQTVPGDGAGG
FT                   GPMGSLQAGISAAAGFGSPGAPAGWAGPAAVGGAALATSAFFVLQRPLASRYGSLELTA
FT                   FYTWAGTLLLALAFGPGLVADLQAGRIPPAAWIPALYLGLFPSALAYWAWSAALARDSA
FT                   ARVASLLNLNPLLAVATAWIALGERPSWVELAGGAVALAGVLLVQGRPPTPQGQRPGSF
FT                   RRQDPPPVPVAAEPAPPTPPAAVPVEPGGSPAGPGDRPSPRPGGR"
FT   sig_peptide     complement(127773..127856)
FT                   /locus_tag="Tmar_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            128769..129887
FT                   /locus_tag="Tmar_0125"
FT   CDS_pept        128769..129887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0125"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="COGs: COG1260 Myo-inositol-1-phosphate synthase;
FT                   InterPro IPR002587: IPR013021; KEGG: mth:MTH1105
FT                   hypothetical protein; PFAM: Myo-inositol-1-phosphate
FT                   synthase; Myo-inositol-1-phosphate synthase GAPDH domain
FT                   protein; SPTR: Conserved protein; PFAM:
FT                   Myo-inositol-1-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50250"
FT                   /db_xref="GOA:E6SL48"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL48"
FT                   /protein_id="ADU50250.1"
FT                   /translation="MRKIRVAIAGVGNCASSLVQGIYYYRDPQRLREGTGLMHPELGGY
FT                   KPADIEIVAAFDVDRRKVGKPLREALFAKPNCTPVFCPDLPDIPVTVQMGPVLDGVSEH
FT                   MADYPEDRTFVPADEPPVDVARVLRETRADVLVNYLPVGSEQATRYYAEAALEAGVAFV
FT                   NAIPVFIASSPRWAERFRRKGLPVVGDDIKSQVGATIVHRVLTRLFEDRGVRVRRTYQL
FT                   NFGGNTDFLNMLNHSRLKSKKQSKTQAVQSQLGEPLPGEDIHIGPSDYVPWLNDNKICM
FT                   IRMEGIGFGDQPIELELRLSVQDSPNSAGVMIDAIRCTKLALDRGLAGPIEPVSAYFMK
FT                   SPPVQYTDDEARRLVEAFIRGDAVAARTQAGD"
FT   gene            129891..131372
FT                   /locus_tag="Tmar_0126"
FT   CDS_pept        129891..131372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0126"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG1213 sugar nucleotidyltransferase; InterPro
FT                   IPR000462; KEGG: rxy:Rxyl_1212
FT                   di-myo-inositol-1,3'-phosphate-1'-phosphate synthase /
FT                   CTP:L-myo-inositol-1-phosphate cytidylyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase; SPTR:
FT                   Glucose-1-phosphate thymidylyl transferase; PFAM:
FT                   Nucleotidyl transferase; CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50251"
FT                   /db_xref="GOA:E6SL49"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL49"
FT                   /protein_id="ADU50251.1"
FT                   /translation="MDAVVLAAGAGTRFRRTAAACPKPLYRLFGISLVERAIRVARQAG
FT                   CRRVLVVTGYQAEAVERAVRAAGRPWVEVVRAEGWARGNGASLLAVRGRVQGPFLLLVA
FT                   DHVMDPDLARQAVAAAQARRDELAAGGALLLVDPRLAQVFDLPEATKVRTAAGGTRVVA
FT                   IGKELDAFDAVDTGIFVGSPGLLDELAALADAAGLAAGAPGDPGVAGEAGDGAAPETVT
FT                   LTAGARRLAEKGRLGAVPVTGGWWVDVDDAAALAYARRRLLVHASASGGDGPVARWLNR
FT                   RLSRPISALLAGAGVGPNGATLLAFATVLAGAAAFAGGLPVLGGLLCQLGSVLDGCDGE
FT                   LARLRLEAQPRGAFLDTVLDRYADAAVVAGLAAGALAAGAGWAATGVAALAAMAGLPLS
FT                   ALMKDRLQLLRAGGAPGGGAGATAGRTRRFDPLRDDPPWLRWLPGNRDGRYFLVFLAGL
FT                   AGAPLAGLVLLAVVAHLLAVGRVVHAWYSLAPAGD"
FT   sig_peptide     129891..129947
FT                   /locus_tag="Tmar_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            131575..132273
FT                   /locus_tag="Tmar_0127"
FT   CDS_pept        131575..132273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0127"
FT                   /product="protein of unknown function DUF159"
FT                   /note="COGs: COG2135 conserved hypothetical protein;
FT                   InterPro IPR003738; KEGG: cyb:CYB_0679 hypothetical
FT                   protein; PFAM: protein of unknown function DUF159; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   ACR, COG2135"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50252"
FT                   /db_xref="GOA:E6SL50"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL50"
FT                   /protein_id="ADU50252.1"
FT                   /translation="MCGRFTLTTPAVELERRFLVDLQDRHVPRYNVAPGQEVLAVVEAG
FT                   GKRQPTRLRWGFVPSWAKDAKPGPINARAETAATRPMFRQALRRRRCLILADGFYEWMQ
FT                   RERGRQPVLFRLRDGAPFALAGLYERWDGPGGPLWTCCVLTTRPNALVAQVHDRMPVIL
FT                   RPGWEAAWLDPQVPPEQLAPAWEPYPATAMVAYPVSTRVNSPRYDDPACVAPVAPPLPL
FT                   PEAGGGDERA"
FT   gene            complement(132192..132926)
FT                   /locus_tag="Tmar_0128"
FT   CDS_pept        complement(132192..132926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0128"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1396 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: nml:Namu_2104 transcriptional
FT                   regulator, XRE family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50253"
FT                   /db_xref="GOA:E6SL51"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL51"
FT                   /protein_id="ADU50253.1"
FT                   /translation="MEPDPVAVGNRIRAARQAAGLSVKELARRAHISPSHLSDIERGVK
FT                   HPSLAVAATLAQILGRSLDWVVAGRDPLPDPVDLRTLLRDPARPLWYQGVPLTEAAREQ
FT                   LVDLLDAAWNLARLAGASVLQALGAPHAAGPAATGKPGLPPDTRVALTYPDEPAAREWI
FT                   QQTVADVLSRYWGIAPAPAASPPAPHGPSAPRSPAGSRPRAAPPNPAGPDGGNPVQARS
FT                   SPPPASGKGRGGATGATHAGSS"
FT   gene            133443..133928
FT                   /locus_tag="Tmar_0129"
FT   CDS_pept        133443..133928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5754 ROK family protein; SPTR: ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50254"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL52"
FT                   /protein_id="ADU50254.1"
FT                   /translation="MVGDGISAAMRDLAEFGWVDVPGRRLAEVIAAEARKLGVDARIVP
FT                   LSNEWYRVETYSRPHADRAWVAVRAVVTRPGGRRGRDGTGGSGGSSRGRGRWEDAETAG
FT                   VTEHLVIVDTGRVVHIFSFPPECLESARAFAETVEAEGIADPKRLDWLAGRMGGRRR"
FT   gene            134180..134935
FT                   /locus_tag="Tmar_0130"
FT   CDS_pept        134180..134935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0130"
FT                   /product="3'-5' exonuclease, PolB"
FT                   /note="InterPro IPR019288; KEGG: hoh:Hoch_5692 3'-5'
FT                   exonuclease, PolB-like protein; PFAM: 3'-5' exonuclease,
FT                   PolB-like; SPTR: Putative uncharacterized protein; PFAM:
FT                   Predicted 3'-5' exonuclease related to the exonuclease
FT                   domain of PolB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50255"
FT                   /db_xref="GOA:E6SL53"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL53"
FT                   /protein_id="ADU50255.1"
FT                   /translation="MSQPTPLAVDIETVGCEWDDLHPEVQDYLLRRARDDERDKVKDQL
FT                   ALHPGTGRVVAIALWRPYEDRGGVLVADPSATESRWTRFAGVDGDAQIYRGSERDILVE
FT                   FWRYVSQHAGTLITYNGRAFDGPFLMIRSAILGVTPTRNLVPYRYSFQDHCDLAEVLSF
FT                   HGARQRNSFLFWCHQFGIPSPKQEMDGAAVGAAYRAGRIDDIARYCLADARATAELYRR
FT                   LEPMIAVMDGRPPAVEPGTPGNPGGGRPA"
FT   gene            134968..136125
FT                   /locus_tag="Tmar_0131"
FT   CDS_pept        134968..136125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0131"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="COGs: COG2519 tRNA(1-methyladenosine)
FT                   methyltransferase and related methyltransferase; InterPro
FT                   IPR013216; KEGG: tbi:Tbis_1839 tRNA
FT                   (adenine-N(1)-)-methyltransferase; PFAM: Methyltransferase
FT                   type 11; PRIAM: tRNA (adenine-N(1)-)-methyltransferase;
FT                   SPTR: tRNA (Adenine-58-N(1)-) methyltransferase; PFAM: tRNA
FT                   methyltransferase complex GCD14 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50256"
FT                   /db_xref="GOA:E6SL54"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL54"
FT                   /protein_id="ADU50256.1"
FT                   /translation="MTERRDEWYERGEQNEVNEQDPRFDTPTSAPDRDGRGTLAEPGEP
FT                   AGDGPGGPGAPGDRHRAWPVPRGPLAMGELVVFVDAKLRRRLQRLRPGRVFQAPAGGIV
FT                   RHESVAGLPEGSSVTTSTGGRLWVLRPTLEEYVLAMPRRTQVIYPKDLGQIVVRSNLGP
FT                   GGRVLEAGVGSGATTLALLRAVGPAGRVISYERRPEFARLARENVERFFGSLPPWWQVE
FT                   IRDVYQGIDERDLDAVVLDVPEPFHCVDSAARALRPGGVLLCWLPTTNQVQELVTALRR
FT                   HPAWDLIETVELLLRPWHVTAASVRPEHRMVAHTGFLVTARRVVPASPGEAARDAGAER
FT                   EADVGEDEAVGEDATGDLQAERDGPCDPADGAAGEGVLPGGSPAD"
FT   gene            136665..139346
FT                   /locus_tag="Tmar_0132"
FT   CDS_pept        136665..139346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0132"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="COGs: COG2208 Serine phosphatase RsbU regulator of
FT                   sigma subunit; InterPro IPR001932: IPR010822; KEGG:
FT                   sth:STH3200 stage II sporulation protein E; PFAM: Stage II
FT                   sporulation protein E; PRIAM: Phosphoprotein phosphatase;
FT                   SMART: protein phosphatase 2C domain protein; SPTR: Stage
FT                   II sporulation protein E; PFAM: Stage II sporulation
FT                   protein E (SpoIIE); TIGRFAM: stage II sporulation protein
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50257"
FT                   /db_xref="GOA:E6SL55"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL55"
FT                   /protein_id="ADU50257.1"
FT                   /translation="MITEKNRPARHLRRVDPPSAPTTPRAGTTGAGRRTGRTGIPAAGS
FT                   PAGGPAGVPGRGAAAGRPAARRILGWVPPWGAAALLVWLAGRVQPGGLPSPLIVPLAVA
FT                   ALTMAPRLGWMVVAVGMAGAAGAGSLYGAAVLGTVALTVRAVQRLAARAAVRAATPRDA
FT                   GGDRPAHTGGPPYATGAATWRLLDGAAAGAVLLAGALWAWPRTALGWEVDRLVGLVVTA
FT                   GTVLLALPWMRQAVAVGVALLPPLPGGAAWLQSGPPVVSAVQGRRALGLLAVLATGGLD
FT                   GVRIAGADAALALRGLAVLLAAHVGGAPAGALAGTAAGLLGMLGGQGSLWGLAWLALAG
FT                   AAAGLLQRYGRTPAVAGFVLATAVVAGSLPAPAEVARLVSGAVAALAVYGGLVATGFPR
FT                   RLAERMETVWPAVGRGSGAGWELGAGWELVPGGSEGEPAPAAGPPASGAGWLGGIPERA
FT                   GPAGRCGGGLGAAGVTGRAAAAPGSAGGPSGGAGSTASAGGPRPEATGVAPASPSPWPS
FT                   LLADLARLVEPDPRAWDPREQVGELINDVARHHCLRCPMARTCWQAEFSATYQAFFDIL
FT                   ATHERGQGFRPEAVPVPLRARCPRLPAISQSLAEGLEVLRVETRWQRRLDRHHRLVARQ
FT                   LRELAELAACPAARPATPRRPGWRYGMRVGVARTPKDGRWISGDGYLCRAFGDGGRMVL
FT                   AISDGMGSGKRAAHESRLALQLLERMLDAGLAAGPAVRLLNTTLALRDRETYTTVDLAT
FT                   VDLERGRVEFVKIGAAPSFVRRAREVQVVAHAAPPAGYLEGGDVHAGGGVLEPGDLVVL
FT                   VSDGVLTAFGDVEAGTAWIRGYLAGLEEDEPRRVAAHIVKEALRRAGDRAPDDMTVVIG
FT                   KLLPRAQLAPVARAGTGAGGRR"
FT   gene            139740..141746
FT                   /locus_tag="Tmar_0133"
FT   CDS_pept        139740..141746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0133"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR011063: IPR012795; KEGG: adg:Adeg_2060
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein; SPTR: tRNA(Ile)-lysidine synthetase; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop family;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50258"
FT                   /db_xref="GOA:E6SL56"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6SL56"
FT                   /protein_id="ADU50258.1"
FT                   /translation="MDEPGNLEAEVEAFARQHRLLRPGHRVLVAVSGGRDSTVLLDLLH
FT                   RLQERLGLAALGVAHVDHGLRPGSADDARWVAEQAAARGLPFLLRRVCVERGRRSLEDA
FT                   ARAARYRALREMAGEFGAHRVALAHHAGDQAETVLMRLVAGAGVRGLAGMRPRRGPFVR
FT                   PLLAVTPARLAAYAAARGLTWRDDPTNRDLRILRNRVRHRLLPLLEAEFNLRTVETLAR
FT                   VATLLAAEADLLDRRTRRLEARLGTAVVPAVPVDGQAAGAGATTAGGGTVAAWACRVAD
FT                   LARLAVADQRRLLQAAFFRRAGRPLPWARCEAVRTLVRQAALGGTGGRVDLPGGWRARC
FT                   DGAWLWLEPAEGAAGRPRRLRRQAPVGATRRGTSPAGATAPGEPGTCREEPAPLVLPVP
FT                   GAVPLGCGLWLRARWLHGTAARQAAAALDEARTPSPVSPTRIPGRDDPRVGARFAFRAL
FT                   IGQRALDEAAAAEDCASVTGAGRDAAGGGAAPPRPGHPVGTGDGDGTGAAGRAAGETAG
FT                   APRPGTQWVLVVRPPRPGETLQALGSRGQRPVERLYRAAVRRGDLYVIDPRTGTGGVLP
FT                   PRAVAVAADAGGGAGPGSGGAGRERILWLAGVRTAAACRVLPDEEAVLCLEVTARPPRE
FT                   PGGDAAAAGSAGGAACRRGHEEGDRRSGPARHP"
FT   gene            141976..143823
FT                   /locus_tag="Tmar_0134"
FT   CDS_pept        141976..143823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0134"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /EC_number="3.6.4.3"
FT                   /note="COGs: COG0465 ATP-dependent Zn protease; InterPro
FT                   IPR003593: IPR003959: IPR000642: IPR005936: IPR 003960;
FT                   KEGG: adg:Adeg_2059 ATP-dependent metalloprotease FtsH;
FT                   PFAM: peptidase M41; AAA ATPase central domain protein;
FT                   PRIAM: Microtubule-severing ATPase; SMART: AAA ATPase;
FT                   SPTR: ATP-dependent metalloprotease FtsH; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: FtsH
FT                   Extracellular; Peptidase family M41; ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50259"
FT                   /db_xref="GOA:E6SLJ2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ2"
FT                   /protein_id="ADU50259.1"
FT                   /translation="MKPNRMLKNLLFYVILLFFVIAIVQRLSPETTEIKHLPTGEFLEK
FT                   IEQGQVESVVYDEDRRQVTGRLKDGTRFRANVPDLNLDTIRQWRAAGVQVDTHPVEEQP
FT                   WWTSLLTTLLPMVLVIAVFLFILQQTQGTGSRVMQFGKSRARLHQPDEKRRITFEDVAG
FT                   YEEVKEELKEIVDYLKNPRRYIELGARIPKGVLLYGPPGTGKTHMARAVAGEAGVPFYY
FT                   ISGSDFVEMFVGVGASRVRDLFEQAKRNAPAIVFIDEIDAVGRQRGAGYGGGHDEREQT
FT                   LNQLLVEMDGFGTNEGIIVMAATNRPDVLDPALLRPGRFDRQIVIDRPDLVAREAILKV
FT                   HTRSKPLAPDVDLGLLARRTPGFTGADLENLVNEAALLAARRRKKQIDMQDLEDAIDRI
FT                   VAGGPERKTRVMSEKEKQRVAYHEAGHALVAKLLPNTDPVHKISIIPRGGALGYVMQLP
FT                   TEDRYLITRQEILDRVTMALAGRAAEELVFGEVSTGAQDDLEKSTKMVRRMITEFGMSD
FT                   ELGPMTFGHKMDAPFLGRDLIRERNYSEEVAAAIDRGISEVINDCYERALRLLREHRDK
FT                   LERIAKTLLEKETIEADELDALLQQAGDEPAAEAGEKAS"
FT   sig_peptide     141976..142059
FT                   /locus_tag="Tmar_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            144207..146039
FT                   /locus_tag="Tmar_0135"
FT   CDS_pept        144207..146039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0135"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro IPR002646: IPR006674: IPR006675; KEGG:
FT                   sth:STH1054 putative RNA nucleotidyltransferase; PFAM:
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: Putative RNA
FT                   nucleotidyltransferase; TIGRFAM: metal dependent
FT                   phophohydrolase; PFAM: HD domain; Poly A polymerase head
FT                   domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50260"
FT                   /db_xref="GOA:E6SLJ3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ3"
FT                   /protein_id="ADU50260.1"
FT                   /translation="MGDGQATRQREEKLQRRQRERQQLEATRRTLSRLLAITRRCRTGE
FT                   EFARALTALWAQETRFGGEPDPGAPAEPAAVPAGNLPAGTRPEGPAGGPGDEPAGREGA
FT                   DGTPPGEERDPRRGGPGGGAAAVRALAALPPGQRPAELARRFDRLVPAPVREVLTRLGE
FT                   HGHAAYLVGGCVRDLLMARPPKDWDVATSARPEEVRRIFPRTIPTGIEHGTVTVRARGL
FT                   SVEVTTFRQESGYSDFRHPDRVEFTRDLRADLERRDLTINAMALDAEGRLHDPLGGLAD
FT                   LEAGVVRAVGDPDERFREDALRLLRVVRFAARFGYRVEPRTEAALARCAPLIRHVSWER
FT                   IREEMSGLLVSPRPAWGLELLRTSGLLEPIWPELLEGVGVAQNVHHAYTVWEHNLLACQ
FT                   YTPPVLRLRLAGLLHDVGKPRTVSVDARGQRHFYHHEVVGADMARQMLRRLKFDNDTVR
FT                   HVAHLVRHHLALHHYPGMTDAAIRRLIQRIGFDYLEDLIILRVADRAASGTKRAPISRG
FT                   AYRLLTRMEKILEQDAAFSLHDLAIDGHDVMAATGLGPGPAIGWILQKLLEDVLDEPGR
FT                   NRRQWLMERAAELRAEAEARFGGGRRAGTPAGGA"
FT   gene            146076..147572
FT                   /locus_tag="Tmar_0136"
FT   CDS_pept        146076..147572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0136"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587: IPR000994: IPR001131: IPR001714; KEGG:
FT                   rca:Rcas_4452 peptidase M24; PFAM: peptidase M24;
FT                   creatinase; SPTR: Peptidase M24; PFAM: Metallopeptidase
FT                   family M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50261"
FT                   /db_xref="GOA:E6SLJ4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ4"
FT                   /protein_id="ADU50261.1"
FT                   /translation="MAADIGSGDGGKQGFGKVEGPGGGGGEPGAGRPHARGALRRGDVA
FT                   RAEVAARAQDAGPAAAKRATGHSPGDDGPAPQGPQVPQAARLAALQERMADAGIDLVVL
FT                   TPGTSWFYLAGMNLLGSRLSLLLVPRRGEPAWVAPLLEAERVAEAPLARALGRSAGRVC
FT                   TYADGEDPAPAVARAVALATAGLGGPPRVAAMEERVARLFEWRAASAALPGVAWQPAEP
FT                   LLVALRARKDLAEVAAIRRAAELVETALGHAMAFVQPGYRESQIAREMEKALRELGTRS
FT                   PFGIHVASGPRSAVPHAETEDRVLQPGDLVWIDVGAEVDGYAADITRTFLLPGGDPGEA
FT                   ARKAAIYRVCYLAQAAARAAARPGVRAGDVDAAARRVIEEAGYGPYFTHRTGHGLGLDV
FT                   HEAPNIAPGDATLLEPGMVFTVEPGIYLPGLGGVRIEDDMLITEDGAVSLTRSRRWFAP
FT                   GPEPVLVAGPAGSPRPAGPGPAWQPGGTGAGPGGTGEGGR"
FT   gene            147569..149629
FT                   /locus_tag="Tmar_0137"
FT   CDS_pept        147569..149629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0137"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="COGs: COG2986 Histidine ammonia-lyase; InterPro
FT                   IPR001106: IPR005921; KEGG: aca:ACP_3026 histidine
FT                   ammonia-lyase; PFAM: phenylalanine/histidine ammonia-lyase;
FT                   PRIAM: Histidine ammonia-lyase; SPTR: Histidine
FT                   ammonia-lyase; TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   Phenylalanine and histidine ammonia-lyase; TIGRFAM:
FT                   phenylalanine ammonia-lyase; histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50262"
FT                   /db_xref="GOA:E6SLJ5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ5"
FT                   /protein_id="ADU50262.1"
FT                   /translation="MTGHPVPGAGRPVAGGTALPGGGNAPSALGGGSVPPAAGGDPAPP
FT                   AAGTGSWPPLVIDGRSLTLAAVAQVARYGRPVRLDPAARRRMEASRRRVEAAVARGEIL
FT                   YGITTGFGKLADVAIPPAEARRLQENLLRSHAAGVGEPLPVPVVRAMMLLRANALARGF
FT                   SGIRPEVVERLLDLLNHGIHPVVPSRGSLGASGDLAPLAHLALVLIGRGRAEVDGRVLP
FT                   GDQALARRGLEPLTLEAKEGLALINGTQAMTALGCLAVEEGLYLAAMADVAGALTLQAL
FT                   RGIPAAFDPRIHALRPHPGQQAAAAHLRALLEGSRLVAEPGPGRVQDAYSLRCMPQVHG
FT                   AVRDALAHAARVLEIEANSVTDNPLVFPEAGVPLDPGDPGPAVPGAEAVAGPAAVPGSE
FT                   AAAGPAAVRGFSGFSAAAGPGAPPGGAAGAGAADVLSGGNFHGEPVALVLDYATMALAE
FT                   LANIAERRIERLVNPQLSGLPAFLTRQGGLHSGLMLAQYTAAALVAENKTLAAPASVDS
FT                   IPSSANQEDHVSMGMTAALKLWRVVEHTRYVLAIELLCAAQALDLVGPEGLSPATAVAY
FT                   RAVRAAVPPLAGDRELAPDIGALAEGLARRELPLPLPGAAGLPPGVPAAGAPGGHGPGA
FT                   GPGDPDRHAHRSHDAHQDHDTGGGRNGFGGSAGFETNAGIDATDGEEVDPR"
FT   gene            149626..150963
FT                   /locus_tag="Tmar_0138"
FT   CDS_pept        149626..150963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0138"
FT                   /product="dihydropteroate synthase"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR000489: IPR006157: IPR006390: IPR006156; KEGG:
FT                   chy:CHY_2383 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS; dihydroneopterin aldolase;
FT                   SPTR: Dihydropteroate synthase; TIGRFAM: dihydropteroate
FT                   synthase; dihydroneopterin aldolase; PFAM: Pterin binding
FT                   enzyme; Dihydroneopterin aldolase; TIGRFAM:
FT                   dihydroneopterin aldolase; dihydropteroate synthase; FolB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50263"
FT                   /db_xref="GOA:E6SLJ6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ6"
FT                   /protein_id="ADU50263.1"
FT                   /translation="MSPTWQVIPGGLAWGERRFVWGTRTYVMGILNVTPDSFSDGGRYL
FT                   DPAAAEEHALAMAEAGADIIDVGAESTRPGAAPVPAEEELRRLLPVIRRLVPRLDVPIS
FT                   VDTYKAEVARAALEEGAAMINDVGGLHRDPAMAEVAAAHRVPVVAMHARPHGDTAYADF
FT                   WGEIVSFLRAAMDRATAAGLPPGMVIVDPGFGFGKTPEQNLDLVRQLPRLRGLGAPVLL
FT                   GTSRKSTIGRVLDLPVDQRLEGTAATVALAIARGVDVVRVHDVAPMVRLVRMADAIARH
FT                   PHWTEGDEPARRPGAAARPAAGTEGAVPAGPGPLPAPASRSVIQLRALRFEARHGVLPE
FT                   EHVKPQPFLVDVDLGLDVTAAAKTDDLALTVDYGEVHRRVARIVQGPHRQLIETLAHQV
FT                   ASDLLDAFPVDWVRVRVAKPEAPLPGPSAGAAVEVWRNRDGARPAG"
FT   gene            150938..151531
FT                   /locus_tag="Tmar_0139"
FT   CDS_pept        150938..151531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0139"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="COGs: COG0801 7
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase; InterPro
FT                   IPR000550; KEGG: smt:Smal_1516
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   PRIAM:2-amino-4-hydroxy-6-hydroxymethyldihydropteri
FT                   dinediphosphokinase;
FT                   SPTR:2-amino-4-hydroxy-6-hydroxymethyldihydropterid
FT                   inepyrophosphokinase;
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropte
FT                   ridinepyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK);
FT                   TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50264"
FT                   /db_xref="GOA:E6SLJ7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ7"
FT                   /protein_id="ADU50264.1"
FT                   /translation="MTAHDPRAEPAGPSPSYAQPPVRAFLGLGANLGDPRAQLRWSVAA
FT                   LDREPGIRVAGVASLYGSRPVGVTDQPDFLNTVVAVETVLSADELLDRLLELERRAGRV
FT                   RLRRWGPRTLDLDLLWYGGAVIRRPPRLVVPHPRAAERAFVLVPWAELAPETVIPGHGP
FT                   VADLLQTVDPSGVWLEEPAPQWWQQQEPPAPGGE"
FT   gene            151575..152753
FT                   /locus_tag="Tmar_0140"
FT   CDS_pept        151575..152753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0140"
FT                   /product="peptidase S58 DmpA"
FT                   /note="COGs: COG3191 L-aminopeptidase/D-esterase; InterPro
FT                   IPR005321; KEGG: rca:Rcas_3716 peptidase S58 DmpA; PFAM:
FT                   peptidase S58 DmpA; SPTR: Peptidase S58 DmpA; PFAM:
FT                   Peptidase family S58"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50265"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ8"
FT                   /protein_id="ADU50265.1"
FT                   /translation="MTPTDPRSRPGAGEGKPGGGPWQGAATPPAGSLTQVDGLLVGHAT
FT                   DREGLTGCTVVLCPEGATCAVDVRGGAPGTRETDLLGAGRLVQQVHAVCLAGGSAFGLA
FT                   AAHGVMTWLEERGYGFDTGVARVPIVPAAILFDLAVGDPRARPDAAMGYAACQAASREP
FT                   VVEGSVGAGTGAVIGTILGPAGARKGGVGSAARFLPNGWTVAALVVLNCYGGVRDPETG
FT                   RWLVGPPPALSATAWPGAQEGQRGAGPAEAGPAGGPSGAGRDAGTGTSGAGGPHGGGPG
FT                   SGEARPGYAGRHTTLAVVATDAPLPRDDLYRIAQVAQTGLARVIDPVHTWVDGDVVFAL
FT                   ATGRRPGTPTMDDRMAIAATAAHVTATAALRAALCAESLGGIPAVAGGDASR"
FT   gene            152887..153723
FT                   /locus_tag="Tmar_0141"
FT   CDS_pept        152887..153723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0141"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1521 Putative transcriptional regulator
FT                   protein; InterPro IPR004619; KEGG: hmo:HM1_0662
FT                   transcriptional activator, putative, baf family; PFAM: Bvg
FT                   accessory factor; PRIAM: Pantothenate kinase; SPTR:
FT                   Putative transcriptional acitvator, Baf family; TIGRFAM:
FT                   transcriptional activator, Baf family; PFAM: Bordetella
FT                   pertussis Bvg accessory factor family; TIGRFAM:
FT                   pantothenate kinase, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50266"
FT                   /db_xref="GOA:E6SLJ9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLJ9"
FT                   /protein_id="ADU50266.1"
FT                   /translation="MLLAIDIGNTHTKMSLYDGSRHVAGWRLSTNGERTADEFAVTLAA
FT                   LMQRRGLDPGQITAVAICSVVPPALVPVVAMVRRDLGLEPLILGPDTDTGMPVAYENPR
FT                   ELGADRIANAVAARAEYGAPVIVVDLGTATKWEVVSPEGVYLGGAIAPGVAISLDALVR
FT                   RAARLSRIELARPRQAIGRSTVEALRAGVLYGFAGQIDAVVERIEAELGQPAPVVATGG
FT                   LAALIAPESRRIQHVDPHLTLKGLWWIHQRLARAQDASGGQRRSPVRPSPGAEVPG"
FT   gene            153982..154410
FT                   /locus_tag="Tmar_0142"
FT   CDS_pept        153982..154410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0142"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729; KEGG: aca:ACP_0464 hypothetical
FT                   protein; PFAM: protein of unknown function DUF151; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50267"
FT                   /db_xref="GOA:E6SLK0"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK0"
FT                   /protein_id="ADU50267.1"
FT                   /translation="MVEMKVLSVGMVQGSDGNVVVLKEADGDRLLVIAVGLAEASAIAL
FT                   QLQGLQPPRPLTHDLLVNLVRRMQGEIVRVVVHDLRDETFIGQIDIQTEHGIMEIDARP
FT                   SDAIAIALRADAPIYVAEPVLEMAAVRSDILSGDSSEE"
FT   gene            154475..155389
FT                   /locus_tag="Tmar_0143"
FT   CDS_pept        154475..155389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2375 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50268"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK1"
FT                   /protein_id="ADU50268.1"
FT                   /translation="MKRIVSVSLGSSRRDHKVRLELLGETLEIERIGTDGDVRKAVELI
FT                   RQLDGKVDAFGMGGTDLYLVAGHRRYVLRASLPLARAARITPIVDGSGLKNTLERRVVR
FT                   QLAREGVVDFPRRRVLVTVAVDRFGMAEALAETGCELMLGDLIFALGIPIPLRSLATLE
FT                   RLARVIAPIATRLPLSLLYPTGEKQEQTVPKYGKFFAWADVIAGDWHYIRRHMPASLAG
FT                   KVILTNTVTADDVALLRQRGARLLITTTPELEGRSFGTNVMEAVLVALSGRRPDELGPA
FT                   DYEGLLDALGFRPRIEPLQGTGG"
FT   gene            155894..156373
FT                   /locus_tag="Tmar_0144"
FT   CDS_pept        155894..156373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0144"
FT                   /product="transcription elongation factor GreA"
FT                   /note="COGs: COG0782 Transcription elongation factor;
FT                   InterPro IPR001437: IPR006359: IPR018151; KEGG:
FT                   bts:Btus_0109 GreA/GreB family elongation factor; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein; SPTR: Transcription elongation factor; TIGRFAM:
FT                   transcription elongation factor GreA; PFAM: domain;
FT                   Transcription elongation factor, GreA/GreB, C-term;
FT                   TIGRFAM: transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50269"
FT                   /db_xref="GOA:E6SLK2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK2"
FT                   /protein_id="ADU50269.1"
FT                   /translation="MDKELLLSAEGLRKLEEELQYLKSVKRREVAQRIKQAREFGDISE
FT                   NSEYEEAKNEQAFVEGRIIELEKMLRNARIVNDEEIDPTKVNIGSTVHLKDVDTGEEVQ
FT                   YTIVGSNEADPAALRISYQSPVGKALFGRSVGEVVEVKVPAGTLRYEIVRIERAG"
FT   gene            156615..158273
FT                   /locus_tag="Tmar_0145"
FT   CDS_pept        156615..158273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0145"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COGs: COG1190 Lysyl-tRNA synthetase (class II);
FT                   InterPro IPR004365: IPR004364: IPR002313: IPR006195: IPR
FT                   018149; KEGG: mta:Moth_0152 lysyl-tRNA synthetase; PFAM:
FT                   tRNA synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; SPTR: Lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetases
FT                   class II (D, K and N); OB-fold nucleic acid binding domain;
FT                   TIGRFAM: lysyl-tRNA synthetase, eukaryotic and
FT                   non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50270"
FT                   /db_xref="GOA:E6SLK3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK3"
FT                   /protein_id="ADU50270.1"
FT                   /translation="MGEDGVMGRDDGAPGAGGAGTAFPQDAPDACDNGPRPVSGTGPEG
FT                   DTGGVTRGDSAEDEAVPEAAEGARLQEVLKARRAKLDFWRRRGVDPFGRRYDTTHHARD
FT                   VVEQFGQLEGQVVRVAGRVMGLRRHGRAAFADLQDVSGRLQLLARVGPLPEDEYRAFLE
FT                   LDRGDWIGAEGTVIRTRRGEISVEVTGFVLLGKSLYPLPEKWHGLRDVDLRYRQRYVDL
FT                   VVNPQVLETFKIRSKVIREIRAFLDRRGFYEVETPVLHLIYGGAAARPFITHHNALDLD
FT                   LYLRIALELHLKRLIVGGMERVYEIGRVFRNEGISTRHNPEFTMLELYQAFSDYEGMME
FT                   LTEQLVSHVAQAVHGTPVVRYQGQEIDFTPPWRRLSFAQALEEMAGVRLDDVLTEDGAR
FT                   RVAQERALELTKDPTPAAVLDELVDVYVQPRLVQPTFLYDYPVVLSPLARRIPDRPHLT
FT                   YRFEALVAGMEIANAFSELNDPDDQRQRFEEQLAARARGDEEAHQMDEDYIHALEIGLP
FT                   ATGGLGIGIDRLVMLMTDSPSIRDVILFPLMRPRD"
FT   gene            158785..160331
FT                   /locus_tag="Tmar_R0021"
FT   rRNA            158785..160331
FT                   /locus_tag="Tmar_R0021"
FT                   /product="16S ribosomal RNA"
FT   gene            160499..160575
FT                   /locus_tag="Tmar_R0022"
FT   tRNA            160499..160575
FT                   /locus_tag="Tmar_R0022"
FT                   /product="tRNA-Ile"
FT   gene            160596..160668
FT                   /locus_tag="Tmar_R0023"
FT   tRNA            160596..160668
FT                   /locus_tag="Tmar_R0023"
FT                   /product="tRNA-Ala"
FT   gene            160838..163821
FT                   /locus_tag="Tmar_R0024"
FT   rRNA            160838..163821
FT                   /locus_tag="Tmar_R0024"
FT                   /product="23S ribosomal RNA"
FT   gene            163916..164032
FT                   /locus_tag="Tmar_R0025"
FT   rRNA            163916..164032
FT                   /locus_tag="Tmar_R0025"
FT                   /product="5S ribosomal RNA"
FT   gene            164109..164942
FT                   /locus_tag="Tmar_0146"
FT   CDS_pept        164109..164942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0146"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="COGs: COG0572 Uridine kinase; InterPro IPR000764:
FT                   IPR017975; KEGG: gwc:GWCH70_2482 uridine kinase; SPTR:
FT                   Uridine kinase; TIGRFAM: uridine kinase; PFAM:
FT                   Phosphoribulokinase / Uridine kinase family; TIGRFAM:
FT                   uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50271"
FT                   /db_xref="GOA:E6SLK4"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK4"
FT                   /protein_id="ADU50271.1"
FT                   /translation="MAPVVIGIAGGTGSGKSTLVRRIVEHLPGRVAVLPQDAYYLDRRD
FT                   LPFEERARLNYDHPLAFDTPLLIRHLQALKQGKPVRRPVYDFTQHLRDRRTVWVEPRDV
FT                   IVVEGILVLAEEALRPLLDIKIFVDTDADVRILRRLVRDIEKRGRTLESVISQYLETVK
FT                   PMHEQFVEPSKRYADLIIPEGGFNRVAVDVLLARIRAALQNEATLRPATSPTSAADPGA
FT                   AAGSPGAVNGASASPSGGGTGAPSDGGTGGRRQRRRQRRKNRKVRPAVNQAAAEP"
FT   gene            164988..166343
FT                   /locus_tag="Tmar_0147"
FT   CDS_pept        164988..166343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK18511 GK18511 gene product from
FT                   transcript GK18511-RA; SPTR: Major ampullate spidroin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50272"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK5"
FT                   /protein_id="ADU50272.1"
FT                   /translation="MQWTPGRRDPGSGNPTPPAPASGRATPRAESTVHHGTAAVCGQAR
FT                   SGTGMGWAISKTAPQRQGVRAAVAATAAVTVAITAIAWGGAAFPRAAKAGPVGPLDGGS
FT                   RGLAQIAATDAGDPPGMGVPLGVSAALRDLLEALDRSDGARDGGQDRPQDGDRGQGGLA
FT                   RSARTPGPAGDPATGGSPTPAGARAAANPAAAGSRVAILAAVWRPEPGSGSVPGWDAVQ
FT                   RLWRACGWNVPQGRADRPVTRGELAQWLVAGLLRPAPPDLPQATALAMAAGMGWIPGTW
FT                   TVAGTEEAAGGSAEPAGEPVTRRDLAAVAAAVLRNDAAPEQPGPGPSTQAPAAPPAPEG
FT                   RFAPGLGPENALGREAATPAPLVETMAWFLRLLEATGRLFHGEGVVTAVDPAGGRVWVT
FT                   QGQLRWVLAIAGDAAFYLNGRRAPLEALQPGDEVRWCAGEGGNTAVPGGAGV"
FT   gene            166422..167153
FT                   /locus_tag="Tmar_0148"
FT   CDS_pept        166422..167153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2669 hypothetical protein; SPTR: Major
FT                   ampullate gland dragline silk protein-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50273"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK6"
FT                   /protein_id="ADU50273.1"
FT                   /translation="MVPGVTVAYLEGFRWVLEGTLVDAGREDGRLSVRLDPGALTGPGG
FT                   VGAGNVAPGGAGADAGTGAPARSDRPGPGGRQAPGPDAGRGGRAVVPRPASPWEPAGTG
FT                   GATQASGPAGIAITADGVVTLGVEPGAPVTINGRDAAAGALRAGDRVTIFLRRSSGTVR
FT                   RVEATRAAVTGRVESVDALRGVLEVRAGFGRGRWVVDGAALVRRNGRDARLADLRPGDA
FT                   IRLGLRGPGVASYVEAESVLP"
FT   gene            167362..171468
FT                   /locus_tag="Tmar_0149"
FT   CDS_pept        167362..171468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0149"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="InterPro IPR000209; KEGG: sth:STH62 putative serine
FT                   protease; PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; SPTR: Putative serine protease; PFAM: Subtilase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50274"
FT                   /db_xref="GOA:E6SLK7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK7"
FT                   /protein_id="ADU50274.1"
FT                   /translation="MTERRGPGRDSRDLTRGKAFHAVLAGLLIVATMAGAVAAVAAPAA
FT                   GGPTGAALAGLVLAGMAGTGCPDPPGLALPGAGGASRDESASSQGRSSAVVPADVAGQA
FT                   LGAVPPHDTDAAPGPGIPREDVRDPGGEGDGTAPAGWTGAARAAWIAALHRGDELQLAL
FT                   WPQPVQRARLEWCIRWAGGSVLWQGQATGSLVARVPAASLPALLPLVDAIEVDGTAAVA
FT                   APDTSLAAPDAASPSLPFELALHRANQDALGAVRLRTTHGVDGSGVTVAVIDTGVDPGL
FT                   PALQPVGAGGKIAAYVDFTSPVPFAQRVQRAREAGAAVVQDGRNPDWAAEGDVFLTATA
FT                   RAGGAVAGPAGTAIARVRWQGLDLQLPAAAAGQEVRLGWLDEANVGPGGTDLDGNGTVR
FT                   DRWLVVAFTAQEQAGATATGEGADGGMLRADGPATSLPPGPPLSGTVPPSRGAAAPPAG
FT                   DAATSLVVLVDADRDLDLAEEPALRPVGQGGGVTWLPRAEAGAPRRPGGPGGAGAGMAL
FT                   VVTAADPQGLLVNFGFDAHGHGTRMAAILAAAGSTYEGVAPGVQLLVLKALGSRGQGDW
FT                   SQILAAVDYAVAHGADIVSLSAESPSPAEQLPVTERVLRQAMARGVLPVLAAGNGGPGL
FT                   HTALPLPADAGLVVGAYLPEDAAQLLGDPAGARILPYSAVGPAVDGTPAPSLIGPGVTY
FT                   TLVPAWQADRWPGGLAPDEGTSVAVPYVAGLAALLLEHGRRQAPALPAAALLPVLHATA
FT                   RPLAGAPATAQGYGTPDGLRAAGELAAWRVGTSGPAGAGGNAAAAAAGSSGGWRGTRWQ
FT                   VLWLHRGRPYKGIFWDGAPPGILNLVVRHGTGEPVTARWAGVPAWARFPGPMPYPAGDG
FT                   LYLPVAYRLPDRPGLYDALVRLEGDAGPPVGFLQAFVRPYGLDTGYLRVQGSVGRGRVE
FT                   RVFVDVPPGTTQLVLSVERPAPAGAGDGGPSGRVTAGSLSAWVFAPGGRLVRDSAGDAG
FT                   RLIGGSDLPVWTVEVPSPAPGVWEIDLFFSSLAPAAFDQAEAPYRVTVTARGIRWQPAE
FT                   LELDAPGAAGGRIWQPVTLVPFGRAVRGRVAGIGWAAPGAASGDAATATAAGAEVQPEE
FT                   RVQVNVLAGEPQPYRLDVPEGTTLLAVEVGPPPRSGWRPHLYLYRVEGGAAEPVGDGGG
FT                   GSAVTVVGPAPGRYYAVVELERVGVPPAWEGGQVDGTDPGPVAIPLLVRRFQGDGAIRV
FT                   PAGAVDLAAGQAARVVASVDVPAGTGEPRGYLVLLEDEGRVAALLPVRVRRGPPRLVVT
FT                   AVVPPVGPGERAQITLQVRDRTDGMWRDASLIAGGRLYTTAGGQVTVPWDGRTGTLTVR
FT                   VLGAAEESVQQVPLPAPLPGSASAQ"
FT   sig_peptide     167362..167493
FT                   /locus_tag="Tmar_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            171530..172216
FT                   /locus_tag="Tmar_0150"
FT   CDS_pept        171530..172216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0150"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="COGs: COG0176 Transaldolase; InterPro IPR001585:
FT                   IPR004731: IPR018225; KEGG: bts:Btus_3268 transaldolase;
FT                   PFAM: Transaldolase; SPTR: Transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase; TIGRFAM:
FT                   fructose-6-phosphate aldolase, TalC/MipB family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50275"
FT                   /db_xref="GOA:E6SLK8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK8"
FT                   /protein_id="ADU50275.1"
FT                   /translation="MELFLDTAQVDEVRRATAWGVVTGVTTNPTLMARAGGDPEEILKA
FT                   IASLVPGPISAEVIATDAEGMVREGRHLASLANNIVVKVPMTPAGLEATYRLSREGIRV
FT                   NVTLVFQPGQALLAARAGATFVSPFVGRLDDVGEDGIGLVADIVEIFRAQGLSTRVLAA
FT                   SIRHPRHVIEAARVGADIATMPMGVLEQLMRHPLTDAGLARFLADWEAARKARAGAGAA
FT                   GAGGGR"
FT   gene            172714..175311
FT                   /locus_tag="Tmar_0151"
FT   CDS_pept        172714..175311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0151"
FT                   /product="transcription termination factor Rho"
FT                   /note="COGs: COG1158 Transcription termination factor;
FT                   InterPro IPR011129: IPR003593: IPR011112: IPR011113: IPR
FT                   000194: IPR004665; KEGG: aac:Aaci_2782 transcription
FT                   termination factor Rho; PFAM: H+transporting two-sector
FT                   ATPase alpha/beta subunit central region; Rho termination
FT                   factor RNA-binding; Rho termination factor domain protein;
FT                   SMART: Cold shock protein; AAA ATPase; SPTR: Transcription
FT                   termination factor Rho; TIGRFAM: transcription termination
FT                   factor Rho; PFAM: Rho termination factor, N-terminal
FT                   domain; ATP synthase alpha/beta family, nucleotide-binding
FT                   domain; Rho termination factor, RNA-binding domain;
FT                   TIGRFAM: transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50276"
FT                   /db_xref="GOA:E6SLK9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLK9"
FT                   /protein_id="ADU50276.1"
FT                   /translation="MAAESTVQGTAGEADGAPAGKGHGSEVEPVSGAADAAPAAAVAAP
FT                   PAPASEPGTAAGDTVTASGEEAAPATRRGRRRTGTSGTRSTRRRTAKAAGPAPEPAQGP
FT                   TSEQADDPAPTTVPSGGTGEGDVVLSGAAETPGDGKGAGDGTDRATPAAGAAEGRAPED
FT                   RGMEGPAAEGRRPDDPSAEDPHPEGRVPAPADEAARPGSARTPEGTANAEAAAGAGLRR
FT                   TAAAATGGGVQRPAGNRGGAQHAAAGGDAPAGVATPAAAGTGVRERAEVRDLRDGRRNG
FT                   GNVAVQPGPRQGYGWRRGTPAGPGGEGAGAGARTPAAGGAAPAGAPVRGSRRPAVPGAG
FT                   GADARLPRDAREGGVQVSPAGGAPEPAVPDERYAGPGAGAGGPGSELPVEAPAVPGTAV
FT                   GEGGAVPPEPADAPEAGSSVAEAPVAGWEPAVRSRGSQGAPGRGRHGNGRPDIREMEQM
FT                   TLKELYALARDLDIPYYSSMRKQELIFEIAKARTEKDGLLWAEGLLDIMPEGFGFLRPI
FT                   NYLPSKEDIYVSPSQIRRFDLRPGDMVSGQARPPKDNERYFALLRVEAVNGVDAELARD
FT                   RLHFEGLTPIFPNERLTLETPGGSIAQRLIDLVAPIGKGQRGLIVAPPKAGKTILLKQI
FT                   ANGIAHNYPDVALMVVLIDERPEEVTDMERSVRGEVLSSTFDQTPENHVKLADMVLERA
FT                   KRLVEHGRDVVILLDSLTRLTRAHNLVTPPSGRTLSGGLDPAAFYKPKRFFGAARNIEE
FT                   GGSLTIIATALIDTGSKMDDVIYEEFKGTGNMELHLDRRLAERRIFPAIDIKRSGTRRE
FT                   EMLLNKDEQEIMWALRRSMGDRDPADILEKLIDRLRKTRSNAEFIAQVKEHRA"
FT   gene            175594..176433
FT                   /locus_tag="Tmar_0152"
FT   CDS_pept        175594..176433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0152"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   ade:Adeh_1347 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50277"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL0"
FT                   /protein_id="ADU50277.1"
FT                   /translation="MATGDRWLQRVNALLLAAWLGMVAAHVSGRDGDPAARPAPGKGGW
FT                   FAPVPGFTRLFATERPGPASPQVEPAAAGAGAAPAARGEGEEAASGKPGGADRAGAVRQ
FT                   DGAAPGSSPWSIPPAVSWARPLDAVATVTSLFGPRDGRWHHGVDLAVPAGTAVRSVWQG
FT                   TVRQAGWRGAYGLAVEVAHPGGWSTLYGHLASVAVEPGQRVARGQLLGRVGATGRATGP
FT                   HLHLEVRVPEGFFDPLAWLDRRWYRWAVGAGDGDAVGTAAVAAPGGAATGSGAAGGE"
FT   gene            176556..176795
FT                   /locus_tag="Tmar_0153"
FT   CDS_pept        176556..176795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0153"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="COGs: COG0254 Ribosomal protein L31; InterPro
FT                   IPR002150; KEGG: aac:Aaci_2781 ribosomal protein L31; PFAM:
FT                   ribosomal protein L31; SPTR: 50S ribosomal protein L31;
FT                   TIGRFAM: ribosomal protein L31; PFAM: Ribosomal protein
FT                   L31; TIGRFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50278"
FT                   /db_xref="GOA:E6SLL1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL1"
FT                   /protein_id="ADU50278.1"
FT                   /translation="MKPGIHPEYKRTTITCACGAVYEVGSTKENLRVDVCARCHPFYTG
FT                   TQRIVDTGGRVDRFRQKYERYRQGQEQAASGAGR"
FT   gene            176901..178028
FT                   /locus_tag="Tmar_0154"
FT   CDS_pept        176901..178028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0154"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="COGs: COG3872 metal-dependent protein; InterPro
FT                   IPR010787; KEGG: mta:Moth_2398 hypothetical protein; PFAM:
FT                   protein of unknown function DUF1385; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1385)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50279"
FT                   /db_xref="GOA:E6SLL2"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL2"
FT                   /protein_id="ADU50279.1"
FT                   /translation="MDLRNRFGGQAVIEGVMMRGAGRIALAVRRPDGSIHVTVRPHTAY
FT                   TARRRWLGWPVVRGVAALAEALVVGIQALNESARLAEEPARSPGTPAQERAAVPSGQAA
FT                   APAARPRPNAGGDDWWVTAINVVAVAAALVFFILLPTWAATALARGELARNVVEGGVRL
FT                   ALLLGYMAAIGRIPDIRRVYEYHGAEHKAIHALEAGAPLEPAAAQGFSRFHPRCGTAFL
FT                   LFVAVVAVVVHALFGWPGFWQRTLLRLATVPVVAGLAYEWILLAGGSPRRWVRWMSAPG
FT                   LWLQRLTTAEPSLDQLEVALAALKACLAEDAGRPRAGMVTAAVRAAGGGGEPVPAAARA
FT                   TAGTAPAPVAAGGAPATLATAPAGTPVSPSGAATR"
FT   gene            178036..179181
FT                   /locus_tag="Tmar_0155"
FT   CDS_pept        178036..179181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0155"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR005139: IPR000352: IPR004373; KEGG:
FT                   ate:Athe_1071 peptide chain release factor 1; PFAM: Class I
FT                   peptide chain release factor; PCRF domain protein; SPTR:
FT                   Peptide chain release factor 1; TIGRFAM: peptide chain
FT                   release factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM:
FT                   peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50280"
FT                   /db_xref="GOA:E6SLL3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL3"
FT                   /protein_id="ADU50280.1"
FT                   /translation="MAAHDATERDHSTATGLPLPELPGALREALAARIGRFDQLERELA
FT                   DPAVAADPRRWQPLAQERAELEPLVDAYRRWREAGADLEAARALLRETDDADEHAYLTA
FT                   EVERLEAERQRLERTLRSLLLPRDPRDQRDVIMEIRAGTGGEEAALFAGDLFRMYQRYA
FT                   ERQGWRTEVMAATESDLGGFKEVVFAVSGRGAFSRLKHESGVHRVQRVPVTEAAGRIHT
FT                   STATVAVLPEAEEVEVQIDPDDLEIDTFAASGPGGQHVNKTESAVRITHKPTGIVVTCQ
FT                   DERSQHKNRARAMKILRARLLDYYTRRQQEELSQQRRSQVGTGERSEKIRTYNFRENRV
FT                   TDHRIGLTLYRLQEIMDGDLDELLDALAAHDEQVRLGEAVS"
FT   gene            179183..180070
FT                   /locus_tag="Tmar_0156"
FT   CDS_pept        179183..180070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0156"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR007848: IPR004556: IPR019874:
FT                   IPR002052; KEGG: dar:Daro_3684 modification methylase HemK;
FT                   PFAM: methyltransferase small; SPTR: Modification methylase
FT                   HemK; TIGRFAM: protein-(glutamine-N5) methyltransferase,
FT                   release factor-specific; modification methylase, HemK
FT                   family; PFAM: Methyltransferase small domain; TIGRFAM: HemK
FT                   family putative methylases; protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50281"
FT                   /db_xref="GOA:E6SLL4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL4"
FT                   /protein_id="ADU50281.1"
FT                   /translation="MTLPTQRPQSAGAALAWARTFLEGAGLDPDEARASARVLLGAALD
FT                   LPGARVVAEPDLPLPPAAWARFVQWILRRARREPVAYILQQAEFYGRPFRVTPATLIPR
FT                   PETEVLVEVVLRTVPAGPAVVADLGTGTGIVAVTLAAERPAWTVLASDCSAAALKVARE
FT                   NAARHGVDGRMRFYVGDWAEPLLAAGWAGKLAAVASNPPYVAAADLPRLQAEIHRYEPH
FT                   LALTPGATGLEAYRRLIPGAVRLLAPGGWIFLEVGAGQAPAVQHLLGAVGCRCVSCWPD
FT                   LAGIPRVVGGQWPA"
FT   sig_peptide     179183..179263
FT                   /locus_tag="Tmar_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            180058..181218
FT                   /locus_tag="Tmar_0157"
FT   CDS_pept        180058..181218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0157"
FT                   /product="translation factor SUA5"
FT                   /note="COGs: COG0009 Putative translation factor (SUA5);
FT                   InterPro IPR006070: IPR005145: IPR004388: IPR010923; KEGG:
FT                   ape:APE_2397 putative translation factor; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain-containing protein;
FT                   SPTR: Putative translation factor; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein; PFAM: yrdC domain; SUA5
FT                   domain; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50282"
FT                   /db_xref="GOA:E6SLL5"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL5"
FT                   /protein_id="ADU50282.1"
FT                   /translation="MAGMTPAPAAWVRLGADPERDAAAIRHAGAVLRRGGLVAFPTETV
FT                   YGLGADALNAQAVVRIFAAKGRPADNPLIVHVTGPEMAGPAVVAAWPDAARRLVDRFWP
FT                   GPLTLVLPAGPAVPAAVRAGLPTVAVRCPAHPVAQALIAAAGTPVAAPSANRSGRPSPT
FT                   RAGDVWADLGPHLDVLLDAGPVPVGVESTVVDVTTWPPRLLRPGGLPVEDLERALGVAL
FT                   APPPRLEAASAAPAPGMKYRHYAPEAPVMLVDEPAAGVEPVRRWLAAGQRVALVGCRED
FT                   LEALLDRAGLAAAWPDPWDERAGAGGADDPSPVVALDLGPRARPDEQARRLFRALRAAD
FT                   AAGATRILALAVPEVGLGRAVMNRLRKAAAGGEVPDGDHSHGAGRL"
FT   gene            181187..182305
FT                   /locus_tag="Tmar_0158"
FT   CDS_pept        181187..182305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0158"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /note="COGs: COG0698 Ribose 5-phosphate isomerase RpiB;
FT                   InterPro IPR017867: IPR003500: IPR004785: IPR000106; KEGG:
FT                   hor:Hore_17930 ribose-5-phosphate isomerase; PFAM:
FT                   Ribose/galactose isomerase; Protein-tyrosine phosphatase,
FT                   low molecular weight; SMART: Protein-tyrosine phosphatase,
FT                   low molecular weight; SPTR: Ribose-5-phosphate isomerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase B; sugar-phosphate
FT                   isomerase, RpiB/LacA/LacB family; PFAM: Low molecular
FT                   weight phosphotyrosine protein phosphatase;
FT                   Ribose/Galactose Isomerase; TIGRFAM: ribose 5-phosphate
FT                   isomerase B; sugar-phosphate isomerases, RpiB/LacA/LacB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50283"
FT                   /db_xref="GOA:E6SLL6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL6"
FT                   /protein_id="ADU50283.1"
FT                   /translation="MTIRTVLVVCSGNTCRSPMAAAYLQQALAEAGAPGVRVESAGLHA
FT                   VPGVPAAAEAREAVARDGLSLAAHRSRALDEATATGADLILAMTRAQAEELRRRFPAVA
FT                   DRVALWREWAAGTPLADPDVADPFGQGLGDYQILARQLRREAAMAARRIAAAGGTPYED
FT                   GGAAPPAVAGGTPAPDSGTDTKTKEERPMDRADAAGAAVPAAGRPLRVAIGSDHAGFDL
FT                   KRDLIAFMEERGIQVIDVGTHSRESCDYPDYARAACAKVVEGEADRAVLICGTGIGMAI
FT                   AANKMPGIRAACCTEPYSARLTRQDNDSNVLTLGARVVGAGMAREILATWLETPFAGGR
FT                   HQRRIDKITHMEHEFMQQRPARNRAAAGQGQG"
FT   sig_peptide     181187..181246
FT                   /locus_tag="Tmar_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            182477..183556
FT                   /locus_tag="Tmar_0159"
FT   CDS_pept        182477..183556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0159"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR018481: IPR018480; KEGG:
FT                   slp:Slip_0158 glycosyl transferase, family 4, conserved
FT                   region; PFAM: Glycosyl transferase, family 4, conserved
FT                   region; SPTR: Glycosyl transferase, family 4; PFAM:
FT                   Glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50284"
FT                   /db_xref="GOA:E6SLL7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL7"
FT                   /protein_id="ADU50284.1"
FT                   /translation="MPTWVHPQSYWFVLAVATLVALAGTPVVRAVAARLGLVARPTARS
FT                   MHRVPVPHLGGLAIFAGFVTAVGVSLGWGDRDVLAVLLGGVVMLAVGLADDLWDLPPLA
FT                   KLAGQVAAALVAVGGGIRIQVLTNPLGWLTPAGGDDLLVLGAWGIPLTVLWIVAVSNVI
FT                   NLIDGLDGLAAGIASIAALTVLVVAMQTGQPLEVVLLMAALAGSTMGFLPYNFNPAKIF
FT                   MGDTGALFIGYTLAAVSVVGLLKTAAVVALAVPIIVLALPIADTALAILRRLQAGRPVM
FT                   AADRDHLHHRLIRLGFSHRDAVLVMYLITTWLALGALAVAEGNLLQGLLIVVTLGASVH
FT                   FVARKLVEWNRQRPRRLGH"
FT   sig_peptide     182477..182572
FT                   /locus_tag="Tmar_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            183656..184963
FT                   /locus_tag="Tmar_0160"
FT   CDS_pept        183656..184963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0160"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="COGs: COG0381 UDP-N-acetylglucosamine 2-epimerase;
FT                   InterPro IPR003331; KEGG: adg:Adeg_0074
FT                   UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; PRIAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; SPTR:
FT                   UDP-N-acetylglucosamine 2-epimerase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50285"
FT                   /db_xref="GOA:E6SLL8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL8"
FT                   /protein_id="ADU50285.1"
FT                   /translation="MDPIHRSSEVPASLAGPGAAGRRDGVGGGEGRGGGGRAALRARLA
FT                   GTRRQGEPLVVLTIFGTRPEATKMAPVILELARRPGVRVQVAVTAQHRQLLDQVLDLFA
FT                   IRPDFDLDIMQPRQSLTDITTRALRGLEDVLGQTRPHLVLVHGDTTTTLAGALAAFYQQ
FT                   VAIGHVEAGLRTYDKYQPFPEEINRRLTDALCDLHFAPTPTARDNLLREGIDPAGIFVT
FT                   GNTAIDALLAVVKPDYRFRRDELARFPAPGRRLVLCEAHRRENWGKPLEAVARALRRLV
FT                   ERNPDVELVYSVHPNPVVAETVRRHLEGLERVALLDPPEYADWANLMARATLLLTDSGG
FT                   LQEEAPALGIPVLLLRDKTERPEAVAAGTVLQVGPHEEPIVREAERLLHDPEAYRQVAQ
FT                   ARNPFGDGQAARRTADAIEYAFGLREEPPEPWDPGA"
FT   gene            185388..185825
FT                   /locus_tag="Tmar_0161"
FT   CDS_pept        185388..185825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_2386 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50286"
FT                   /db_xref="GOA:E6SLL9"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLL9"
FT                   /protein_id="ADU50286.1"
FT                   /translation="MADHPRSRPPRRPAGGGDRDGPDGGGGGIRGAGTLFELAFTFAGT
FT                   LLAGMAIGYYGGRWLDRWLGTDPWLQLAGLMLGVVAAFRVLWRTLQRLAEDEPGRPGGR
FT                   PPASGRAPGAGAGGRGGDGPRPAGRGVPRDRDRDRKDGPAS"
FT   gene            185822..186148
FT                   /locus_tag="Tmar_0162"
FT   CDS_pept        185822..186148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cse:Cseg_3010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50287"
FT                   /db_xref="GOA:E6SLM0"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM0"
FT                   /protein_id="ADU50287.1"
FT                   /translation="MNHFTTWPDTTLGLVAGLWGLIWGAVNYRLIAGPVQRMATTDDGE
FT                   QIATLQQQVVARYLLRMALSFVSLLVVFWVTGRPVAILAALAGLLLAGDVPLFFLRRAR
FT                   RERA"
FT   sig_peptide     185822..185893
FT                   /locus_tag="Tmar_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            186145..186903
FT                   /locus_tag="Tmar_0163"
FT   CDS_pept        186145..186903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0163"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: tjr:TherJR_2893 ATP synthase F0,
FT                   A subunit; PFAM: H+transporting two-sector ATPase A
FT                   subunit; SPTR: ATP synthase subunit a; TIGRFAM: ATP
FT                   synthase F0, A subunit; PFAM: ATP synthase A chain;
FT                   TIGRFAM: ATP synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50288"
FT                   /db_xref="GOA:E6SLM1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM1"
FT                   /protein_id="ADU50288.1"
FT                   /translation="MTPWLQLAAVGGEAAEGGQGAEEGAHVVFHLFGLPVHESIVTMWI
FT                   LMGLIILLGVLVARNLHQVPRTRFQTAVEWVVDSLYGFVTDIMGRERARRFTPLLGSFF
FT                   VLILFSNYSGLLPVLPHENWFQPPTSRWGVTGGLAVFSFVAVQAYGLARHGLGYFRRFL
FT                   EGPVFLWPLTVPLAVIEELIKPFSLSLRLFANIFGGEAVLAGLLAALPWFLPMGVMFIE
FT                   IIAGFVQALIFTMLSALYIEAATADFHHEH"
FT   gene            187006..187251
FT                   /locus_tag="Tmar_0164"
FT   CDS_pept        187006..187251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0164"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="InterPro IPR002379: IPR000454; KEGG: scl:sce7980
FT                   H(+)-transporting two-sector ATPase; PFAM: H+transporting
FT                   two-sector ATPase C subunit; SPTR: ATP synthase subunit c;
FT                   PFAM: ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50289"
FT                   /db_xref="GOA:E6SLM2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM2"
FT                   /protein_id="ADU50289.1"
FT                   /translation="MEGITGIAFFAGLAVIGLAIAAFGSATGQARAAAAALDAIWRQPE
FT                   AAGRIQTVLILSLAFLESLTLFTFALAFLFAGRVAG"
FT   sig_peptide     187006..187101
FT                   /locus_tag="Tmar_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            187459..187941
FT                   /locus_tag="Tmar_0165"
FT   CDS_pept        187459..187941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0165"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="COGs: COG0711 F0F1-type ATP synthase subunit b;
FT                   InterPro IPR002146: IPR005864; KEGG: mta:Moth_2382 ATP
FT                   synthase F0, B subunit; PFAM: H+transporting two-sector
FT                   ATPase B/B' subunit; SPTR: ATP synthase subunit b; TIGRFAM:
FT                   ATP synthase F0, B subunit; PFAM: ATP synthase B/B' CF(0);
FT                   TIGRFAM: ATP synthase, F0 subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50290"
FT                   /db_xref="GOA:E6SLM3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM3"
FT                   /protein_id="ADU50290.1"
FT                   /translation="MQISPELIWAFINFFVFVILMTVFFWRPMLELLDRRREEIEANLA
FT                   AAERAREEAARSEAEYRQRLAAAQREAQSILERATQLAEEERQQRLEAARREAEQLLER
FT                   ARATIEREKEQAIAALRREVADLTLLATERVLGRALDADDQRRLVAEAVEEVANLR"
FT   gene            187938..188489
FT                   /locus_tag="Tmar_0166"
FT   CDS_pept        187938..188489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0166"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="COGs: COG0712 F0F1-type ATP synthase delta subunit
FT                   (mitochondrial oligomycin sensitivity protein); InterPro
FT                   IPR000711; KEGG: rmr:Rmar_0314 ATP synthase F1, delta
FT                   subunit; PFAM: H+transporting two-sector ATPase delta
FT                   (OSCP) subunit; SPTR: ATP synthase subunit delta; TIGRFAM:
FT                   ATP synthase F1, delta subunit; PFAM: ATP synthase delta
FT                   (OSCP) subunit; TIGRFAM: ATP synthase, F1 delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50291"
FT                   /db_xref="GOA:E6SLM4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM4"
FT                   /protein_id="ADU50291.1"
FT                   /translation="MKRRPLAQRYARVLYDLGRESSELDRLAADLARVLDVFSEHPELR
FT                   QRFESLAVPAREKHELIESVFGDRVHRWVGNLLRLLVRRRREALLPDIVAEFAALRDRE
FT                   AGVLEAEVEAAAELDAATRQRLEEELARTLGARQVRLAVRVRPELLGGLVVKIGDRRLD
FT                   ASLRRRLVQLHRQLATGGRG"
FT   gene            188503..190068
FT                   /locus_tag="Tmar_0167"
FT   CDS_pept        188503..190068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0167"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /note="COGs: COG0056 F0F1-type ATP synthase alpha subunit;
FT                   InterPro IPR004100: IPR000194: IPR000793: IPR005294: IPR
FT                   020003; KEGG: mta:Moth_2380 ATP synthase F1, alpha subunit;
FT                   PFAM: H+transporting two-sector ATPase alpha/beta subunit
FT                   central region; H+transporting two-sector ATPase alpha/beta
FT                   subunit domain protein; SPTR: ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM: ATP synthase
FT                   alpha/beta family, beta-barrel domain; ATP synthase
FT                   alpha/beta chain, C terminal domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain; TIGRFAM:
FT                   proton translocating ATP synthase, F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50292"
FT                   /db_xref="GOA:E6SLM5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM5"
FT                   /protein_id="ADU50292.1"
FT                   /translation="MSIRPEEITAIIRQQIENFEGRAELEDVGTVIQIADGVATVYGLE
FT                   KVMASELVEFPKSGVYGMALNLAEDSVGVVVLGPYTDIKEGDEVRRTGRIIEVPVGPEL
FT                   LGRVVNPLGQPIDGGPAINATRTRPIESPAPGVIMRQSVNQPLQTGWKAIDSMIPIGRG
FT                   QRELIIGDRQTGKTALAVDTIINQKDQNVICVYVAIGQKASTVAGVVETLKKYGAMDYT
FT                   IVVSATASQPAPLLYIAPYAGCAMGEYFMYEEHRDVLVIYDDLTKQAWAYRELALLLRR
FT                   PPGREAYPGDVFYLHSRLLERAARLSDEVGGGSLTALPIIETQAGDISAYIPTNVISIT
FT                   DGQIFLESDLFYSGIRPAIDVGRSVSRVGSAAQIKAMKQVAGRLRLDLAQYRELAAFAQ
FT                   FGSDLDKATQARLARGQRVTEILKQGEHEPMPVEEQVVAIYCGVNGYLDDVPVERVREF
FT                   EREFLQYLKRFNPEVLESIRTEKEITKENEQRLQSAIQQFKAGFLAEGQEGAGQPARQA
FT                   QRAS"
FT   gene            190103..190990
FT                   /locus_tag="Tmar_0168"
FT   CDS_pept        190103..190990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0168"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /note="COGs: COG0224 F0F1-type ATP synthase gamma subunit;
FT                   InterPro IPR000131: IPR013838; KEGG: mta:Moth_2379 F0F1 ATP
FT                   synthase subunit gamma; PFAM: H+transporting two-sector
FT                   ATPase gamma subunit; SPTR: ATP synthase gamma chain;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM: ATP
FT                   synthase; TIGRFAM: ATP synthase, F1 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50293"
FT                   /db_xref="GOA:E6SLM6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM6"
FT                   /protein_id="ADU50293.1"
FT                   /translation="MRDIRRRIRAVRSTQQITRAMYMVAAAKLKKAEEAARSGRPYAAA
FT                   LRAMLARLAGSEQARQHPLVAPRPVERVGLVIITGDRGLAGSYNANLIRRAEQELRQLP
FT                   DGVEPVLVAVGRKGRDHFRRRGYRLAHELTGIGEDVDFATARDLARWLVDRYLAGEVDE
FT                   VRLVYTEYRSAISQRPVVTRLLPVAGLDEPAGGAAAGADAAGPRGVREYIYEPSERAIL
FT                   EALLPKYVQILVFRALQEAKASEHGARMTAMKNATDNAGELIETLTLEYNRARQAAITK
FT                   ELAEIVSGAEALKS"
FT   gene            191195..192604
FT                   /locus_tag="Tmar_0169"
FT   CDS_pept        191195..192604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0169"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /note="COGs: COG0055 F0F1-type ATP synthase beta subunit;
FT                   InterPro IPR003593: IPR004100: IPR000194: IPR000793: IPR
FT                   005722: IPR020003; KEGG: chy:CHY_2545 F0F1 ATP synthase
FT                   subunit beta; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SMART:
FT                   AAA ATPase; SPTR: ATP synthase subunit beta; TIGRFAM: ATP
FT                   synthase F1, beta subunit; PFAM: ATP synthase alpha/beta
FT                   family, beta-barrel domain; ATP synthase alpha/beta chain,
FT                   C terminal domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain; TIGRFAM: ATP synthase, F1 beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50294"
FT                   /db_xref="GOA:E6SLM7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM7"
FT                   /protein_id="ADU50294.1"
FT                   /translation="MAEQNVGRVVQVIGPVVDIEFPEGKLPDIYNAIKIQAKTEEVEID
FT                   LTVEAAQHLGNNVVRCVAMASTDGLQRGMPAVDTGGPISVPVGREVLGRMFNVLGEPID
FT                   GKEPPQAKKRYPIHRPAPDVADVNPATEILETGIKVIDLICPFARGGKVGLFGGAGVGK
FT                   TVIIMELIHNIAYKHGGFSVFAGVGERTREGNDLYHELKESGVLDKTALVFGQMNEPPG
FT                   ARLRVGLTGLAMAEYFRDEEGQDLLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLA
FT                   TEMGNLQERITTTRKGSITSVQAVYVPADDYTDPAPVTTFAHLDSTVRLERAIAERGIY
FT                   PAVDPLASTSRILDPNIVGQEHYEVARGVQQVLQRYKDLQDIIAILGMDELTEEDKLIV
FT                   QRARKLERFLSQPFFVAEVFTGTPGKYVSREETVRGFKEILEGKHDDLPEAAFYMVGTI
FT                   DEAVEKAKSLV"
FT   gene            192629..193051
FT                   /locus_tag="Tmar_0170"
FT   CDS_pept        192629..193051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0170"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="COGs: COG0355 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit); InterPro IPR020546:
FT                   IPR020547: IPR001469; KEGG: slp:Slip_2281 ATP synthase F1,
FT                   epsilon subunit; PFAM: ATPase, F1 complex, delta/epsilon
FT                   subunit-like; SPTR: ATP synthase F1, epsilon subunit;
FT                   TIGRFAM: ATP synthase F1, epsilon subunit; PFAM: ATP
FT                   synthase, Delta/Epsilon chain, beta-sandwich domain; ATP
FT                   synthase, Delta/Epsilon chain, long alpha-helix domain;
FT                   TIGRFAM: ATP synthase, F1 epsilon subunit (delta in
FT                   mitochondria)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50295"
FT                   /db_xref="GOA:E6SLM8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM8"
FT                   /protein_id="ADU50295.1"
FT                   /translation="MAERAITLEVITPERVVFREEVDSLIVPGAEGLLGVLPDHAPMVA
FT                   ALKIGILTYRKNGEKRRVAVAGGFFEVADNHAVVLSDAAERAEEIDVVRARAAAERARR
FT                   RLAERDANWDFERARAALNRALNRLRAAGADTGDLV"
FT   gene            193467..194762
FT                   /locus_tag="Tmar_0171"
FT   CDS_pept        193467..194762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0171"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="COGs: COG0766 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase; InterPro IPR001986: IPR005750; KEGG:
FT                   amt:Amet_0358 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); SPTR:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50296"
FT                   /db_xref="GOA:E6SLM9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLM9"
FT                   /protein_id="ADU50296.1"
FT                   /translation="MERIVVRGGRPLKGQVRISGAKNAALPILAATLLAEEPCLLYDIP
FT                   ALDDVDTMIRLLTELGVTVGPGADGALAVHPADELAFAAPYDLVRRMRASILVLGPLVA
FT                   RLGRARAALPGGCAIGQRPIDLHLKGFAALGAEVEVTGGEVEVRAPRGLRGTSIYLDVP
FT                   SVGATENIMMAAVLAEGTTTIENAAEEPEIVDLANFLNTLGADVRGAGTRVIQIHGVPA
FT                   LGGGTYTVIPDRIEAGTFLLAPLIAGGQVTATGVVPEHLKSLLAKVREMGADVVVDGDQ
FT                   VTVAMDGRPRAVDVKTLPYPGFPTDLQAPMMAALATAEGTATVTETLFENRFTHVPELR
FT                   RMGARIQIQGQTAIVTGVERLQGAPVTATDLRSGAALVLAGLGAEGVTEVSGVHHIDRG
FT                   YVTIEQKLRGLGADVARLSTEDDPVVPELLLR"
FT   gene            194828..195838
FT                   /locus_tag="Tmar_0172"
FT   CDS_pept        194828..195838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0172"
FT                   /product="stage II sporulation protein D"
FT                   /note="COGs: COG2385 Sporulation protein and related
FT                   protein; InterPro IPR013693: IPR014225: IPR013486; KEGG:
FT                   mta:Moth_2374 sporulation protein and related proteins;
FT                   PFAM: Stage II sporulation protein D; SPTR: Sporulation
FT                   protein and related proteins; TIGRFAM: stage II sporulation
FT                   protein D; SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation protein; TIGRFAM: SpoIID/LytB domain; stage II
FT                   sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50297"
FT                   /db_xref="GOA:E6SLN0"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN0"
FT                   /protein_id="ADU50297.1"
FT                   /translation="MPVLPAWRRPVAGWVLLALVLTVLLPFLVVVTRGWRLEVPEAPPV
FT                   PLDPGQLPVRVWVPGADAVQVLPLEVYLTGVVAAEMPASFHPEALKAQAVAARTYTVRH
FT                   MQVFGGPGCPEHPDADVCGDPQSGQAWRPLEARRREWGLFNGWRLTRKIQQAVADTAGL
FT                   ILVYQGAPIDAVYHSTSGGRTEAAAAVWGNEVPYLRPVDSPWETSSPHWRTTWEIPLAE
FT                   FARRLEVDPKAVRDLPGDQCFARIEPSPGGRVGRAVLGEKSYTGPQLRQRLDLPSTWWT
FT                   CRRQGDQVVFEVRGWGHGVGMSQYGADGMARQGRTFQEILQHYYPGTSLRPIFSE"
FT   sig_peptide     194828..194929
FT                   /locus_tag="Tmar_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            195960..196724
FT                   /locus_tag="Tmar_0173"
FT   CDS_pept        195960..196724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0173"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   dvl:Dvul_2424 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase, M23/M37 family; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50298"
FT                   /db_xref="GOA:E6SLN1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN1"
FT                   /protein_id="ADU50298.1"
FT                   /translation="MQETPQSGQRRITGRLAGLMAKLRGRPALRSLVGFAVLLAVFVGS
FT                   YLYFQGWPGLSGPEPSSLEEPTTPVGAGADQGVTGTATLQPVPGQAGTGPGSGTGTGTG
FT                   TPAEPRDNVPTREVTGETTPAFAWPVDNGRTVMGFGWQYSETMGDWRWHPGVDLAVQQG
FT                   AQVLAAAGGRVLSVDRDPDRGLTVIIEHDGGYRTVYASLAEATVEAGQPVRRGQAIGEA
FT                   GQTARVESAAGVHVHFEVWRGDEAVDPQTVIG"
FT   gene            197117..197416
FT                   /locus_tag="Tmar_0174"
FT   CDS_pept        197117..197416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0174"
FT                   /product="sporulation transcriptional regulator SpoIIID"
FT                   /note="InterPro IPR014208: IPR018356; KEGG: sth:STH103
FT                   stage III sporulation protein D; SPTR: Stage III
FT                   sporulation protein D; TIGRFAM: sporulation transcriptional
FT                   regulator SpoIIID; PFAM: Stage III sporulation protein D;
FT                   TIGRFAM: sporulation transcriptional regulator SpoIIID"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50299"
FT                   /db_xref="GOA:E6SLN2"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN2"
FT                   /protein_id="ADU50299.1"
FT                   /translation="MKDYIWKRVVEVSTYIARTRSTVREAAKVFGVSKSTVHKDVTERL
FT                   PKIDSQLAAKVQQVLETNKAERHLRGGEATRLKYLQEQRGQVQEQAHSEPPVGA"
FT   sig_peptide     197117..197194
FT                   /locus_tag="Tmar_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            197831..198844
FT                   /locus_tag="Tmar_0175"
FT   CDS_pept        197831..198844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0175"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="COGs: COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis; InterPro IPR004753; KEGG: adg:Adeg_1540 rod
FT                   shape-determining protein MreB; PFAM: cell shape
FT                   determining protein MreB/Mrl; SPTR: Cell shape determining
FT                   protein, MreB/Mrl family; TIGRFAM: cell shape determining
FT                   protein, MreB/Mrl family; PFAM: MreB/Mbl protein; TIGRFAM:
FT                   cell shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50300"
FT                   /db_xref="GOA:E6SLN3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN3"
FT                   /protein_id="ADU50300.1"
FT                   /translation="MLGFVRDLGVDLGTVNTVVYVEGRGIVLNEPSVVAVDRETGHVLA
FT                   VGSEAHRMLGRTPGNIVAARPLRGGVIADFTATATLLKMLLKRAVPQRLGLRPRMVVCV
FT                   PSGVTTVERRAVIEAGYEAGARKVYLLEEPVAAALGAGLAIHEPGGHMVVDVGGGTTDI
FT                   AVLSLGGVVVATSTRTGGDTFDEAIVRYVKRQYNVLIGERTAEQAKIAIGTAVPPEGDG
FT                   ERFEVRGRDLVTGLPRTLHLSAAEVQQALEEPLAALLAALRGALERVPPELAADILHRG
FT                   LVLTGGGSLLRGLDRRIADATGLPVVRPEQPLLTVALGTGVALSRLDRLDGVLIAG"
FT   gene            199228..199977
FT                   /locus_tag="Tmar_0176"
FT   CDS_pept        199228..199977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0176"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="COGs: COG4786 Flagellar basal body rod protein;
FT                   InterPro IPR001444: IPR010930: IPR020013: IPR012836; KEGG:
FT                   mta:Moth_0797 hypothetical protein; PFAM: flagellar basal
FT                   body rod protein; protein of unknown function DUF1078
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: flagellar basal-body rod protein FlgF; fagellar
FT                   hook-basal body protein; PFAM: Domain of unknown function
FT                   (DUF1078); Flagella basal body rod protein; TIGRFAM:
FT                   flagellar basal-body rod protein FlgF; fagellar hook-basal
FT                   body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50301"
FT                   /db_xref="GOA:E6SLN4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN4"
FT                   /protein_id="ADU50301.1"
FT                   /translation="MLRGLYTAASGMLARVLQQERLANDLANVNTPGYKASRNVTEAFP
FT                   ELFVARLERAGAAPVGPVGTGAVVAEPGLDLTAGPWLETGRPQDLALAGDGFFVVMGPA
FT                   GPAYTRAGNFTVGPEGYLQTPDGWPVLGTDGQPLLVGTADFTVTPDGQVQAGGVVVGTV
FT                   ARVTFANPAALRKAGDNLLVDPGGAGPAVPVDTPVRQGVLEQSNVDPVRTVVEMLANFR
FT                   AFEASQRAVQAQDQTLGLAIQEVGRVT"
FT   sig_peptide     199228..199296
FT                   /locus_tag="Tmar_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            199974..200843
FT                   /locus_tag="Tmar_0177"
FT   CDS_pept        199974..200843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0177"
FT                   /product="flagellar hook-basal body protein"
FT                   /note="COGs: COG4786 Flagellar basal body rod protein;
FT                   InterPro IPR001444: IPR010930: IPR020013: IPR019776; KEGG:
FT                   nth:Nther_2833 flagellar basal-body rod protein FlgG; PFAM:
FT                   flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; SPTR: Flagellar basal-body
FT                   rod protein FlgG; TIGRFAM: fagellar hook-basal body
FT                   protein; PFAM: Flagella basal body rod protein; Domain of
FT                   unknown function (DUF1078); TIGRFAM: fagellar hook-basal
FT                   body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50302"
FT                   /db_xref="GOA:E6SLN5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN5"
FT                   /protein_id="ADU50302.1"
FT                   /translation="MIGRALWTSAAGMAAAARQVDVTANNLANVNTPGFKASRADFADL
FT                   VYAALAVPASPATAAAGGVQAGHGVRLAATPRSWRQGPLQSTGSPWDLAIDGAGFFQVV
FT                   EPGTGEVLLTRGGAFVLSPLPGGAPGAGPGEDPGQGPGGGPGGAGEALLVTDGAGRPLL
FT                   RDDGRPLVLPAGARSWVVTPEGEVRAVLAGGREVPAGRLALVVPAAPDALESRGEGLYA
FT                   PGPGAVAALPPGQGGAGRVRQGMLEQANVDLAVEMTRLLAAQRAYQLNARAVLTGDEMM
FT                   GLINRLRP"
FT   sig_peptide     199974..200045
FT                   /locus_tag="Tmar_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            201492..202106
FT                   /locus_tag="Tmar_0178"
FT   CDS_pept        201492..202106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0178"
FT                   /product="Manganese/iron superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="COGs: COG0605 Superoxide dismutase; InterPro
FT                   IPR019831: IPR019832: IPR001189: IPR019833; KEGG:
FT                   bts:Btus_2414 superoxide dismutase; PFAM: Manganese/iron
FT                   superoxide dismutase-like; SPTR: Superoxide dismutase;
FT                   PFAM: Iron/manganese superoxide dismutases, alpha-hairpin
FT                   domain; Iron/manganese superoxide dismutases, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50303"
FT                   /db_xref="GOA:E6SLN6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN6"
FT                   /protein_id="ADU50303.1"
FT                   /translation="MAYQLPPLPYDYNALEPHIDEQTMRIHHDRHHATYVNNVNAALEK
FT                   YPALQNKPIEELLRQIDQVPEDIRTAVRNNGGGHANHSLFWEIMSPRGGGQPSGALAEA
FT                   INRSFGSFDAFKDQFTKTATTHFGSGWAWLVVDEKGELQVYSLPNQDSPYMKGHTPILG
FT                   LDVWEHAYYLKYQNKRPDYIAAWWNVVNWDEVARRYQQARG"
FT   gene            202316..202771
FT                   /locus_tag="Tmar_0179"
FT   CDS_pept        202316..202771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0179"
FT                   /product="3-hydroxyacyl-(acyl-carrier-protein) dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COGs: COG0764
FT                   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein)
FT                   dehydratase; InterPro IPR013114: IPR010084; KEGG:
FT                   chl:Chy400_1555 (3R)-hydroxymyristoyl-ACP dehydratase;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; SPTR:
FT                   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;
FT                   TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM: FabA-like domain; TIGRFAM:
FT                   beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50304"
FT                   /db_xref="GOA:E6SLN7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN7"
FT                   /protein_id="ADU50304.1"
FT                   /translation="MTAQDRPQGAMDVQDILSVLPHRYPFLLVDRILELEPGRRAVGRK
FT                   CVSANEPYFQGHFPGRPIMPGVLILEAMAQVGAAAVLSMPENRGRLALFAGADRVRWRR
FT                   PVIPGDCLEIEVEIIAMRGPIGKGRARATVDGELAAEAELSFALRPA"
FT   gene            203208..204464
FT                   /locus_tag="Tmar_0180"
FT   CDS_pept        203208..204464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0180"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="COGs: COG1098 RNA binding protein (contains
FT                   ribosomal protein S1 domain); InterPro IPR003029; KEGG:
FT                   rba:RB10524 putative RNA-binding protein; PFAM: RNA binding
FT                   S1 domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: S1 RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50305"
FT                   /db_xref="GOA:E6SLN8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN8"
FT                   /protein_id="ADU50305.1"
FT                   /translation="MSDGLKDSLLPGEDSPAPAPGGPSPVVEPVLPATTAADEPAGGRP
FT                   ARPAAEGRAGGSPPVPARRGVGPAEGTTAGTPYGYRSGLHRPASAFPRRTGGSGNESGT
FT                   RTGAGAGTGAGAAPGAGSGSAAGAAAGSGAEVRDLAGLVPLSPGTRVHGTITGIVGYGA
FT                   FLVTDDGRRGLIHISEISDWYVERAEDYFYKGERVQVEVVHFDPNSGKYAFSTRRLGGK
FT                   QPLANRYADRLLELHRHGIIRSGYKGWAREPGRWPWRGERRGGTGTASTPGPSGTAATG
FT                   SPGRTNRPAGRNKPGSRPAAGALAGTGQGAGPVGPGSRPGGSRDGTGQPAAGASQTPGA
FT                   RTAGPAAVQDDTDLLQLLRRHVGQVSPAARAELDRLVQAYGIARVGLVLAQVLEGMDRS
FT                   LQVVEAAGKRLAAGAGASA"
FT   gene            complement(204519..205070)
FT                   /locus_tag="Tmar_0181"
FT   CDS_pept        complement(204519..205070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0181"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="COGs: COG3339 conserved hypothetical protein;
FT                   InterPro IPR010652; KEGG: rxy:Rxyl_0592 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1232; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1232)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50306"
FT                   /db_xref="GOA:E6SLN9"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLN9"
FT                   /protein_id="ADU50306.1"
FT                   /translation="MECKNRAPHRRVARMLKPVAQERRNAASPSEDPAAPRQGPENAAR
FT                   TGGTGRPGGTAARIGRWKVEARALYLALRHPRVPWYVKAGLCLLVAYVFSPVDPLPDFV
FT                   PVLGHLDELLLVPLGVALARRLIAPDVLAECRQQAAALEHKPRMAAGAVAVVLGWLILA
FT                   ALTGWLAWHAGVAGRLGGVP"
FT   gene            205196..206068
FT                   /locus_tag="Tmar_0182"
FT   CDS_pept        205196..206068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0182"
FT                   /product="Cof-like hydrolase"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200: IPR000150: IPR006379; KEGG:
FT                   hor:Hore_16120 Cof-like hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3; SPTR:
FT                   Cof-like hydrolase; TIGRFAM: Cof-like hydrolase;
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: Cof subfamily of IIB
FT                   subfamily of haloacid dehalogenase superfamily;
FT                   HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50307"
FT                   /db_xref="GOA:E6SLP0"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP0"
FT                   /protein_id="ADU50307.1"
FT                   /translation="MLPYLIALDVDGTLLDSGGRLRPRVKNAVRAAVDAGHYVVLATGR
FT                   RWVATRPFAQELGLKAPCIVHNGAVAVDPLTDQPVWRQPLPTEFARQAILKARELGVSL
FT                   FFHDLDHPHGDRMLYEPGARLPKASWFFEAGRLTQEVPDLMEWLQVGAVRVLVRDRQEG
FT                   ADAFRRWITAEWGDAVRVLAGTDLEPGIYAVEVSDAPVCKGWALERLAAHLQIPVERVV
FT                   AVGDWDNDIEMLQFAGLGVAMANGSPAARAAARRVTASNDEDGVAVVLEELLGGGVRGG
FT                   VGGSAGLGR"
FT   gene            206277..207734
FT                   /locus_tag="Tmar_0183"
FT   CDS_pept        206277..207734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0183"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR001029; KEGG: cbk:CLL_A3427
FT                   flagellin; PFAM: flagellin domain protein; SPTR: Flagellin;
FT                   PFAM: Bacterial flagellin N-terminal helical region;
FT                   Bacterial flagellin C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50308"
FT                   /db_xref="GOA:E6SLP1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP1"
FT                   /protein_id="ADU50308.1"
FT                   /translation="MFMRINHNVAALNAWRNLSQTNSLLNKSLERLSSGLRINRAADDA
FT                   AGLAISEKMRAQIAGLQTAQRNAQDAISLIQTAEGALNETHSILQRMRELAVQASNDSM
FT                   TDADRANLQKEVEQLIAELDRIGNTTEFNTKKLLDGSAGVSTAIASGKALNVSATGDTQ
FT                   AGSYTIDIKAAATRGEVWLAQADDATSTFWTTFSDVNATLVKDLDITVNGRRYFFAAGT
FT                   KVQDVIDTVNADSALTGVEADFNANAIRFRTTDVGSARQVSVTINSNTTFFNVANASTG
FT                   ATSDVNAATVAGTDAELGSLGVNGTPVNYEAVGNRITILSGPAKGLSFTVDASGTYTGG
FT                   SNADDDPTITVGTNGALTFQIGANTGQSLSVAIDDMRSQALGVKTVDVSTRSGASNAIS
FT                   AIDSAINTVSVQRARLGAVQNRLEHTIANLGVAVENLQAAESRIRDVDMALEMANFTRN
FT                   QILLQSGTAMLAQANAMPQAVLQLLGR"
FT   gene            208123..208524
FT                   /locus_tag="Tmar_0184"
FT   CDS_pept        208123..208524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0184"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="COGs: COG1334 Uncharacterized flagellar protein
FT                   FlaG; InterPro IPR005186; KEGG: cti:RALTA_B2129 FlaG:
FT                   flagellar protein; PFAM: flagellar protein FlaG protein;
FT                   SPTR: Flagellar protein; PFAM: FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50309"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP2"
FT                   /protein_id="ADU50309.1"
FT                   /translation="MRTLTIPPQNPVAGGGFTAAGAGFAATNRTSSGRQVRDAGAMGGT
FT                   GAAGTVPGSAPAAAPAGSDTRTGPLQDLAPDPFGYRLQFHVDDATGRVVAQVVDRETGE
FT                   IVRQVPPEYVLRIAMYIEALLGQWLDRRG"
FT   sig_peptide     208123..208197
FT                   /locus_tag="Tmar_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            208591..210009
FT                   /locus_tag="Tmar_0185"
FT   CDS_pept        208591..210009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0185"
FT                   /product="flagellar hook-associated 2 domain-containing
FT                   protein"
FT                   /note="COGs: COG1345 Flagellar capping protein; InterPro
FT                   IPR003481: IPR010810: IPR010809; KEGG: tjr:TherJR_2791
FT                   flagellar hook-associated 2 domain protein; PFAM: flagellar
FT                   hook-associated 2 domain-containing protein; flagellar
FT                   hook-associated protein 2 domain-containing protein;
FT                   flagellin hook IN repeat protein; SPTR: Flagellar
FT                   hook-associated 2 domain protein; PFAM: Flagellar
FT                   hook-associated protein 2 C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50310"
FT                   /db_xref="GOA:E6SLP3"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP3"
FT                   /protein_id="ADU50310.1"
FT                   /translation="MRISGLASNLDWEQLVEQLMQIERRPLLLLERRKLEIETQRNAWS
FT                   DVRSRIANLRDRVDGVLAQDLFDRVEVKSSDAARVSAEAGSGAAPGTYRVEVQQLATAH
FT                   AIATYSEVTTPANSQNLSGTFTISVTVGAATMASFDVTVDPADSLYAIRDKINAAVQAA
FT                   IKANPNLEPYAVRADVIGGYLVITRTETGAGGIEVSGAVAEDLKLIDNTGAERVVSEGK
FT                   DAQFKVNDVSFTRSSNTVSGVIQGVTLELHQAAPGQPVDITVAWDDDAVVDAVKKFIEQ
FT                   YNSTLSFMAQQQDYQAAGGGKLGGDVLLITLSNDLRRMVSAPVKALEGSTALDRLAAVG
FT                   ITTQDKSGTLQLDEAKLRQALAADRAGVQRLLAGDPDSASSTDDGVFVRLRKALDGWLQ
FT                   ANTGLLDQRIDSLDERARDYADQMDRMQYRLQLREQNLTRQFEALETLLSTLRSQEQWL
FT                   IQQVNQLASLRPQR"
FT   gene            210337..211128
FT                   /locus_tag="Tmar_0186"
FT   CDS_pept        210337..211128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0186"
FT                   /product="flagellar protein FliS"
FT                   /note="COGs: COG1516 Flagellin-specific chaperone FliS;
FT                   InterPro IPR003713: IPR005479; KEGG: cwo:Cwoe_0033
FT                   flagellar protein FliS; PFAM: flagellar protein FliS; SPTR:
FT                   Flagellar protein FliS; TIGRFAM: flagellar protein FliS;
FT                   PFAM: Flagellar protein FliS; TIGRFAM: flagellar
FT                   biosynthetic protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50311"
FT                   /db_xref="GOA:E6SLP4"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP4"
FT                   /protein_id="ADU50311.1"
FT                   /translation="MQPGDRSAGDAPSGAQTAEAPGGPDPNRQAPAGEVVPPHAPLRPA
FT                   LSGQVPTGQVPSGKDGPGGYAGGPSTAGWPSNRSSKGGFPLGMPRRAVAHPTRSYLATR
FT                   VLTAPPQVLVLMLMDGVLREVARALQVDLKAPGGRERLHRALTRAQDFLRELMLALDHE
FT                   RGGELAARLSAIYLFCQERLIEANVKANPRLAADAVRVLVPIRDAWATLCSGGTGPAAV
FT                   AGGGADVAAGAGARGGAMGPGSSGTGGETRDAPGDGLGVRP"
FT   gene            211125..211568
FT                   /locus_tag="Tmar_0187"
FT   CDS_pept        211125..211568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0187"
FT                   /product="kinetoplast-associated protein-like protein"
FT                   /note="KEGG: lma:LmjF27.0240 kinetoplast-associated
FT                   protein-like protein; SPTR: Kinetoplast-associated
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50312"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP5"
FT                   /protein_id="ADU50312.1"
FT                   /translation="MSEADLWELILETRKDLDRWIERGRRAQAAAGRGDWEAARAELEA
FT                   RRFLQEQVSARLQRLQAGAGEGGRGLPGGPAARQWLAQLEEHLRQALEADRQLRLALAV
FT                   RHEALGERARFLEQARRAVAAYARHGHPHRPASSASNESARGE"
FT   gene            212089..213336
FT                   /locus_tag="Tmar_0188"
FT   CDS_pept        212089..213336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0188"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: chy:CHY_0138 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: S-adenosylmethionine
FT                   synthase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   TIGRFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50313"
FT                   /db_xref="GOA:E6SLP6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP6"
FT                   /protein_id="ADU50313.1"
FT                   /translation="MTRAKGRHLFTSESVTEGHPDKIADQISDAVLDAILEQDPQARVA
FT                   CETAVTTGMVLVMGEISTTCYVHIPALVRDVLREIGYTRAKYGFDADTCSVLTAIDEQS
FT                   PDIAQGVLDAWEVRHGQAPADEFSRIGAGDQGMMFGFACRETRELMPLPITLAHRLTRR
FT                   LAEVRKSGLLPYLRPDGKAQVTVEYEGTRPVRVDAIVVSTQHRDDIARAQLEEDIRRHV
FT                   IGAVVPAHMLDEKTRIFINPTGRFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGK
FT                   DPTKVDRSGAYAARWVAKNIVAAGLAERCEIQVAYAIGVAQPVSIRVDTFGTGLIPDDR
FT                   IEELVRQHFDLRPGAIIHTLNLRRPIYRQVAAYGHFGRPELDLPWERIDRAAELRAAAD
FT                   LGPMPADPLAEVAVTL"
FT   gene            213813..214313
FT                   /locus_tag="Tmar_0189"
FT   CDS_pept        213813..214313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH119 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50314"
FT                   /db_xref="GOA:E6SLP7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP7"
FT                   /protein_id="ADU50314.1"
FT                   /translation="MGHDALWWALALLAAAGAAGIVGEMRASWRRRRRSRRSRRGEPSW
FT                   GPWPLVVLVRDAASFIEGFVDDLAALAPGSPIVVVDCGSADETASILQRLRQRVPTLQV
FT                   LRWPAARPGAPGPLEAALFVTGAPLALTIDLTNPAGWRWQDLRPPLLHLLEAFGSCRKS
FT                   MTG"
FT   sig_peptide     213813..213869
FT                   /locus_tag="Tmar_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            214358..216028
FT                   /locus_tag="Tmar_0190"
FT   CDS_pept        214358..216028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0190"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR003018:
FT                   IPR000160; KEGG: tjr:TherJR_2805 diguanylate cyclase with
FT                   GAF sensor; PFAM: GGDEF domain containing protein; GAF
FT                   domain protein; SMART: GGDEF domain containing protein; GAF
FT                   domain protein; SPTR: Diguanylate cyclase with GAF sensor;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GAF domain; GGDEF
FT                   domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50315"
FT                   /db_xref="GOA:E6SLP8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP8"
FT                   /protein_id="ADU50315.1"
FT                   /translation="MKSWCSPQRLYILLVGVGGIVALGMALPQWEPVPVLPMALMLGAA
FT                   ILMDAYPLPMPGGGAMSLTFGVTLTAQLLYGTLPAALVNVLGNVIGYGLLNRRPWDRTL
FT                   FNAGQFALTILTAGAVATRMGLRPLPASTGISVPPLDLVFIYVGVYWVMNNALVGVALY
FT                   FHQAHSIREFLRVFFRWLPVDGLSTAIAVAAHAVVMIAYQSYGVTGMAAGLTLFLMVNY
FT                   LLRLHMRLVEAHHDLQSLYEITKGLAGVLELADAFRWIARAVHQLAPADAFAVYLAEDE
FT                   DVLRVQYAAHPDAAAIRGRVAGDGAVRLAASSRQVVEQVEELSLVTESFRPTRVLAVPL
FT                   SADERLVGCLCLARRGRGFGDRERRLLSILSSPMALAIQTGLIYGRTQTMAHTDPMTGL
FT                   YNYRYFSMRLREAVRRASASGQPLALILIDLDEFSDINNQFGHPAGDEVLRQFAQVLRS
FT                   SVRQQDIVARYAGDEFVAILPGARREEAEAVAERIREAVLRHRFTDPTGQIVFPLRCSL
FT                   GVAVYPFDGVSDEDLIAAADRNMFRQKRHHFERYRRERA"
FT   sig_peptide     214358..214489
FT                   /locus_tag="Tmar_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            216384..217331
FT                   /locus_tag="Tmar_0191"
FT   CDS_pept        216384..217331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0191"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG1040 amidophosphoribosyltransferase;
FT                   InterPro IPR000836; KEGG: dds:Ddes_1733 ComF family
FT                   protein; PFAM: phosphoribosyltransferase; SPTR: ComF family
FT                   protein; PFAM: Phosphoribosyl transferase domain; TIGRFAM:
FT                   comF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50316"
FT                   /db_xref="GOA:E6SLP9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLP9"
FT                   /protein_id="ADU50316.1"
FT                   /translation="MAERGWRALIGGASIGGMGGRPDRRLARLRRAGAAVWAALRDELL
FT                   AWVYPWPPYCLGCGRYLPGWPPAAPALCEECAARLGHGPGSRCPVCDRPAWLARPGDAC
FT                   SQCRNLGPPWVAVRSVGVYGGLLRRLILRMKYGDEPYLAELLGRAMAGRAAAWPPALLV
FT                   VPVPMHPERLRQRGYNQAALLARAVARASRRALAEGLLVRREPGGAQAALGAAGRRANV
FT                   AGAFVPAPRVRPGALSGQPVLLVDDVLTTGRTLAAACAALRQAGAGAIYGLTAAVTPLD
FT                   PGRLAGPEPGLLGTGLPPAATEPRMPFTIGGHGL"
FT   sig_peptide     216384..216521
FT                   /locus_tag="Tmar_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            217503..218030
FT                   /locus_tag="Tmar_0192"
FT   CDS_pept        217503..218030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0192"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="InterPro IPR007412; KEGG: dre:562496 collagen type
FT                   II, alpha-1a; PFAM: Anti-sigma-28 factor FlgM family
FT                   protein; SPTR: Collagen type II, alpha 1; TIGRFAM:
FT                   Anti-sigma-28 factor FlgM family protein; PFAM:
FT                   Anti-sigma-28 factor, FlgM; TIGRFAM: flagellar biosynthesis
FT                   anti-sigma factor FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50317"
FT                   /db_xref="GOA:E6SLQ0"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ0"
FT                   /protein_id="ADU50317.1"
FT                   /translation="MIISRQQVVNALKAYGMLPGPGVPGNAPGPVPPAGPTVPPGPGAA
FT                   GGERGEPHTPGPVATSVGSGSPSGRPGAVAGTSPAGGAAGAAGVAGSSGAGGAGGLQGP
FT                   VTAPRDRVDLSPEAAAIRRLVEEARRLPDVRPERVAALRQQIARGEYAVDPEQVAERML
FT                   YRLLADRAQEGR"
FT   gene            218034..218603
FT                   /locus_tag="Tmar_0193"
FT   CDS_pept        218034..218603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0193"
FT                   /product="FlgN family protein"
FT                   /note="InterPro IPR007809; KEGG: slp:Slip_1911 FlgN family
FT                   protein; PFAM: FlgN family protein; SPTR: FlgN family
FT                   protein; PFAM: FlgN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50318"
FT                   /db_xref="GOA:E6SLQ1"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ1"
FT                   /protein_id="ADU50318.1"
FT                   /translation="MATGEHGQAPGTEPAAATTNGTAATATVARDLVALLSAQVEPWAR
FT                   LLEAARTKGRALVAGDVAAVESALVEENRWLEQIQRLEERRYQLQRDLATRWGLDARDL
FT                   TWDELARRCPELGPQLGRLRQALRALVEGVDAVNRENRSLAQQGLAWARFALKTLVAGS
FT                   GAAAPAYGRDGQRQWRPAGLSINRAY"
FT   gene            218696..220258
FT                   /locus_tag="Tmar_0194"
FT   CDS_pept        218696..220258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0194"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="COGs: COG1256 Flagellar hook-associated protein;
FT                   InterPro IPR001444: IPR010930: IPR002371: IPR017975; KEGG:
FT                   tjr:TherJR_2798 flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; SPTR: Flagellar
FT                   hook-associated protein FlgK; TIGRFAM: flagellar
FT                   hook-associated protein FlgK; PFAM: Flagella basal body rod
FT                   protein; Domain of unknown function (DUF1078); TIGRFAM:
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50319"
FT                   /db_xref="GOA:E6SLQ2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ2"
FT                   /protein_id="ADU50319.1"
FT                   /translation="MRSTFFGLELARLGLWAQQRALDVTGHNIANANTEGYSRQVARLS
FT                   PTPAYAPPSLAMAAEAGQVGTGVQVAEIQRVRDLFLDRQARDLKAHLGRWQVRSQTLAE
FT                   LETILGEPSDAGLARALADFWDALATVANRPDSLPARTAAIQQAHTLLERFQTADRQLA
FT                   DLADNLDASLVARVDRVNQILVQMADLHRRIRVATAAGQTPNDLLDERDRLLEELGTLL
FT                   PVRVTERPDGTVRVEVAGLPLVDGQVVHRLAVQEEPAGGAGGGGTGSGTSGGLVVRIYW
FT                   DGTATVPASATPQAVSGPGASGGAAAAFIPLDDTVLDGGEIDGLLEARDRLVAGLRQDL
FT                   KALFFALADAVNAVHRQGYGLNDGPPAGSGQQGAGRDLFVVGSGSDLQQVVVNPELDDP
FT                   ANLAAAQMPGAPGDGRNALAMVQLRHAPLNLPGSPSAQDYLESVVAGLGIAGRQAEEGQ
FT                   RTAQLLLDQVAAQRESVRGVSLDEEMTQLIRYQHAYAAAARLVTAVDTMLGILIERTGV
FT                   VGR"
FT   sig_peptide     218696..218791
FT                   /locus_tag="Tmar_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            220519..221406
FT                   /locus_tag="Tmar_0195"
FT   CDS_pept        220519..221406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0195"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR013384; KEGG:
FT                   tjr:TherJR_2797 flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; SPTR: Flagellar hook-associated
FT                   protein 3; TIGRFAM: flagellar hook-associated protein 3;
FT                   PFAM: Bacterial flagellin N-terminal helical region;
FT                   Bacterial flagellin C-terminal helical region; TIGRFAM:
FT                   flagellar hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50320"
FT                   /db_xref="GOA:E6SLQ3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ3"
FT                   /protein_id="ADU50320.1"
FT                   /translation="MRITGGMMITTLLADLRRAQERLSTYQNRLASGKQVQRPSDDPVA
FT                   TVDSLRLRARLAEVDRLRANAEDARDWLEITDSALDRATQILQRARELAIRAASGTLPD
FT                   SSLDAIAAEVQQLRDHLLEVANTTLGDAYIFGGLATQQPPYVADPASATGVAYQGINGP
FT                   VEREVAPGTTVAVNVPGDAAFDPAFDALGQMAAALAARDLPTVGGAVVAALDDAIDGLL
FT                   RFRAEVGAKVNRIELGLYRLDEIRIDTERLLSGVEDADIAETAMRLSVSEAAYRAALMA
FT                   GARIVQPTLMDFLR"
FT   sig_peptide     220519..220575
FT                   /locus_tag="Tmar_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            221548..223134
FT                   /locus_tag="Tmar_0196"
FT   CDS_pept        221548..223134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0196"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterPro
FT                   IPR005844: IPR005845: IPR005846: IPR005843: IPR 016066:
FT                   IPR005841; KEGG: hau:Haur_2567 phosphoglucosamine mutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphoglucomutase/phosphomannomutase family protein; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50321"
FT                   /db_xref="GOA:E6SLQ4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ4"
FT                   /protein_id="ADU50321.1"
FT                   /translation="MSDAPKIPHEAQQTAHPHHPPRTEPARDRATGEGTPAGTGDAGPA
FT                   PIRFGTDGWRAVIAEAFTFANVRRVAWALAEHLQATGRASQGVAVGYDCRFLSDRFAAT
FT                   VASVLAAAGIPVVLSRTACPTPALSWAVVSRKLGAGVMITASHNPPEYNGFKLKGWFGG
FT                   PALPDETRQLEAVLARQDATRPPGQEPPRGMDLDEARRRGRIEEADLIAPYTEQLRRLV
FT                   DWDRLRAARLRLVVDPMHGAARGVLAQMLREAGAEVTEIRGDWNPGFGGLAPEPIAPNL
FT                   GPAVEAVKSLGAQAVLVTDGDGDRVGAVDATGEVLDAQRIFALLLQHLVEVRGWTGSVV
FT                   KTFAGTRMVDKLAARYGLPFRETPIGFKHVCEYALKEDVLIGGEESGGIGIKNHMPERD
FT                   GLLCNLLLAEIMATRGCTLGQQVATLMAEIGPHYFQRRDLHLTPDGKNRLLRHLEEDPP
FT                   ARLAGWTVEKVDPLDGCKLIFGPSRWILFRASGTEPVVRVYAEAESPAEVETLLADGLR
FT                   LVESVTGGTGR"
FT   gene            223839..224402
FT                   /locus_tag="Tmar_0197"
FT   CDS_pept        223839..224402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0197"
FT                   /product="SSU ribosomal protein S30P;sigma 54 modulation
FT                   protein"
FT                   /note="COGs: COG1544 Ribosome-associated protein Y
FT                   (PSrp-1); InterPro IPR003489; KEGG: hor:Hore_16460 sigma 54
FT                   modulation protein/ribosomal protein S30EA; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA; SPTR: Sigma 54
FT                   modulation protein/ribosomal protein S30EA; TIGRFAM:
FT                   ribosomal subunit interface protein; PFAM: Sigma 54
FT                   modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50322"
FT                   /db_xref="GOA:E6SLQ5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ5"
FT                   /protein_id="ADU50322.1"
FT                   /translation="MNISIYGKNVDVTEALKEYARRKVGKVARYFTGTPLQAQVTLSIE
FT                   RDRHIVEVTIPVPNSGLLIRAEEESDDMYASIDLVVDKLERQIRKFKTRLNRKARRLEA
FT                   TTGQAVPEADAPVDEPDWTEGEEEGRVVRTKRFAVKPMTVDEAILQMNLLGHDFFVFAN
FT                   ATTGEINVLYRRRDGQYGLIEPEF"
FT   gene            224625..225314
FT                   /locus_tag="Tmar_0198"
FT   CDS_pept        224625..225314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1761 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50323"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ6"
FT                   /protein_id="ADU50323.1"
FT                   /translation="MSQPSSWSDQTAKTMEAALLGLPGVLSSHVEVDAGGRVQEIHLLA
FT                   GPGRAEHQLLRDVQSLMAISFGQDVETGVVHLTRVGGGDEYGESRLRLLRHRLETEGTQ
FT                   IAVLVELGNGDRVFRGEARGTRGPAALLRLAAVATARAVIAALYRMVEVQVFSVQRVRL
FT                   GHRTVALVGITAGGGILPPQEYVGAVLVKLDETEATCRAVLDGVNRFFALAGQLAPEGI
FT                   GGTASNA"
FT   gene            225583..227007
FT                   /locus_tag="Tmar_0199"
FT   CDS_pept        225583..227007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0199"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro IPR003607:
FT                   IPR006674: IPR006675; KEGG: nth:Nther_2059 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: Metal dependent phosphohydrolase; TIGRFAM:
FT                   metal dependent phophohydrolase; manually curated; PFAM: HD
FT                   domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50324"
FT                   /db_xref="GOA:E6SLQ7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLQ7"
FT                   /protein_id="ADU50324.1"
FT                   /translation="MEVRRGQKSRYYYGAYLLYVLLSTAFISFISRNVLHADLPTSLLL
FT                   FAFTLLAEAFPIPIVPISGSVSLSFVTIFSAILSEGPVVGTLIAALGTVRPMDFGGVPI
FT                   RGVLFNRIQLAVAAYLSGWVFQSVAGGKSITDGITVLAFFLASVVYCITNITLAGVYIY
FT                   RFSAHKMTVSKLVRQFSRTVVLNYIALMPLAYLIAAIHQKVSTYAVLLFFLPLVVARFS
FT                   FQRYLDVYHMFVGTIRSLALAMEAKDRYTYGHADRVARLSVEIGKELKLGDAELEQLQY
FT                   AGILHDIGKIGVRDEILNKPGRYTPDEYEEMKKHPVIGARIVGGIQSLETVARWIRHHH
FT                   ERYDGTGYPDGLCGDHIPLGARIIAVADAFDAMLYDRPYKAGRPLPEVIEELRRCSGTH
FT                   FDPKIVNVLLRLIEDPVRLAELTRPPEWRFVEYLAALYGLRPASPYRAAVYTREADELA
FT                   DAVAEAAAAEERCPTD"
FT   sig_peptide     225583..225693
FT                   /locus_tag="Tmar_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            227023..227652
FT                   /locus_tag="Tmar_0200"
FT   CDS_pept        227023..227652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_2058 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50325"
FT                   /db_xref="GOA:E6SLZ5"
FT                   /db_xref="InterPro:IPR035168"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLZ5"
FT                   /protein_id="ADU50325.1"
FT                   /translation="MFLLALALGVLIGWLRGGSLSGVARLPVRWVVLLPIPFLIRSALR
FT                   HPLAANVELLSEWAFLWQGVAYGLLVVLAVVNRHLPGSTYLMAGTAANALVIMLNGGQM
FT                   PVSEWAIRVAAGGAEQVVAVTLLRTGNSLTHEVLGPETRLPWLADIIPLPRPFPFPSVA
FT                   SAGDVVIALGLLWLIITAMGARPRHAAPEGAVAHQPDEEPRVAHHE"
FT   sig_peptide     227023..227085
FT                   /locus_tag="Tmar_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            227921..230779
FT                   /locus_tag="Tmar_0201"
FT   CDS_pept        227921..230779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0201"
FT                   /product="protein translocase subunit secA"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase); InterPro IPR011115: IPR011130:
FT                   IPR011116: IPR004027: IPR 000185: IPR014018: IPR020937;
FT                   KEGG: chy:CHY_0162 preprotein translocase subunit SecA;
FT                   PFAM: SecA DEAD domain protein; SecA preprotein
FT                   cross-linking region; SecA Wing and Scaffold; SEC-C motif
FT                   domain protein; SPTR: Protein translocase subunit secA;
FT                   TIGRFAM: preprotein translocase, SecA subunit; PFAM: SecA
FT                   DEAD-like domain; SecA preprotein cross-linking domain;
FT                   SEC-C motif; SecA Wing and Scaffold domain; TIGRFAM:
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50326"
FT                   /db_xref="GOA:E6SLZ6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLZ6"
FT                   /protein_id="ADU50326.1"
FT                   /translation="MLGLLRNLFNYNEREIRRLSREVERINALEPEMVRLTDAELRAKT
FT                   DEFRRRLAGGESLDDLLPEAFAVVREAAKRTLGMRPFDVQLMGGIVLHEGKVAEMKTGE
FT                   GKTLVATLPAYLNALTGRGVHVVTVNDYLAKRDAEWMGRIYRFLGLTVGVIVHGLTFEE
FT                   RRRAYAADITYGTNNEFGFDYLRDNMALYPDQVVQRELYYAIVDEVDSILIDEARTPLI
FT                   ISGMADKPTELYYQFAQIARKLERDRDYTVDEKARTVAPTEEGVHRVEQMLGVENLYAP
FT                   DNPVDYAHYLINALKAKELMRRDVDYVVKDGQVIIVDEFTGRLMFGRRYSDGLHQAIEA
FT                   KEGLKIERESQTLATITFQNYFRMYEKLAGMTGTAATEEEEFSKIYGLDVVVIPTNKPM
FT                   IRRDYPDVIYKTEAAKFRAVVEEIVECHRRGQPVLVGTISIEKSERLSEMLKRRGIPHQ
FT                   VLNAKYHEREAEIIAQAGRVGAVTIATNMAGRGTDILLGGNPEFLARQRMRKLGYDPEV
FT                   ISAVSGQLDPDDPELAQARRDYLRLLEEAKKETEAEHKRVVELGGLHIIGTERHEARRI
FT                   DNQLRGRAGRQGDPGSSRFYLSLEDDLLRLFGSDNIRGIMDRLGVEEDEPIEHPLITRA
FT                   IENAQRKVEHRNFTLRKQVLEYDDVMNKQREVIYAERRRVLNGEDVHEHVLGMMDDIIK
FT                   NALDNYCNEHAHPEEWNLEGLVEYLEGNYLPAGTLKADELADMGRDALAQEIKAAFLRV
FT                   YEEKEKAVGSAMMRELERVVLLRVVDQKWVDHLAAMDNLRDGIGLRAYGQRDPLLEYKF
FT                   EAFEMFQQMIESIKEDVVRTLMHLEVRPGQAEPQRRRVAVGAREESGRVPVFALAAAGA
FT                   VGAGDAGETGGTAPGSGGVRPGAAGRAAAGRGGPAAMASAGAGTAPDSGPREPIRVQKV
FT                   GRNDPCPCGSGKKYKKCCGRTA"
FT   gene            230956..232207
FT                   /locus_tag="Tmar_0202"
FT   CDS_pept        join(230956..231024,231026..232207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Tmar_0202"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="KEGG: ade:Adeh_0244 LigA; SPTR: Peptide chain
FT                   release factor 2; manually curated; PFAM: PCRF domain; RF-1
FT                   domain; TIGRFAM: peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50327"
FT                   /db_xref="GOA:E6SLZ7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLZ7"
FT                   /protein_id="ADU50327.1"
FT                   /translation="MWDELLRRIRALRPRLEELRDDLDLAGKRREIERIEQAMTDPSFW
FT                   DEPDRAQQQVRQLKVLKGPVEHYEALERQLDDLQVLAELAAEEADVSVIPELEEGIAKA
FT                   EEGLRQLELDLLLNGPYDGYDAIVSLHPGAGGTESQDWAQMLWRMYTRWAEDHGYQVEV
FT                   LDLLEGEEAGIKSVTFAVRGPNAYGYLRSEHGVHRLVRISPFDAAGRRHTSFASVDVLP
FT                   DLGDSPEIEIRPEDLRIDVFRAGGHGGQHVNKTESAVRIVHLPTGIVATCQNERSQHAN
FT                   RETAMKILKARLARYYEEQRLKEIAALRGDVGEIAWGNQIRSYVFQPYTLVKDHRTGVE
FT                   VGNVQAVMDGHLDPFINAYLRWEAARTGKLGRGTEAGEGAAAATGTAPGTGAGGNGAQG
FT                   APAGTAGADAGARAGRR"
FT   gene            232415..233101
FT                   /locus_tag="Tmar_0203"
FT   CDS_pept        232415..233101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0203"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="COGs: COG2884 ATPase involved in cell division;
FT                   InterPro IPR003593: IPR003439: IPR005286: IPR017871; KEGG:
FT                   pth:PTH_2747 ATPase; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: cell division ATP-binding protein FtsE; PFAM: ABC
FT                   transporter; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; Type II (General) Secretory Pathway (IISP) Family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50328"
FT                   /db_xref="GOA:E6SLZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLZ8"
FT                   /protein_id="ADU50328.1"
FT                   /translation="MIEFINVSKVYPNGVTALQDVSLHIDRGEFVFLVGPSGAGKSTLV
FT                   RLIYREETPTRGIVLVDGLNVGRLRRRDVPFLRRQIGVVFQDFKLLPNRTAYENVAFAM
FT                   FVTGHTQRQIRRRVPEVLELVGLLDKAGALPSELSGGEQQRVAVARAVVNHPKILLADE
FT                   PTGNLDPETAWGIMELLVEINRRGTTVVVATHAHNIVNALKRRVVRIEAGRVAADQSPG
FT                   VQERAI"
FT   gene            233091..233978
FT                   /locus_tag="Tmar_0204"
FT   CDS_pept        233091..233978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0204"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG2177 Cell division protein; InterPro
FT                   IPR003838; KEGG: afn:Acfer_0658 protein of unknown function
FT                   DUF214; PFAM: protein of unknown function DUF214; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50329"
FT                   /db_xref="GOA:E6SLZ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E6SLZ9"
FT                   /protein_id="ADU50329.1"
FT                   /translation="MRFETLGYFLREALTGIRRNGFMSFASASTVFVSLVVLSLLLVVA
FT                   ANVRYLASYVESQVAVVAFLSPDMPREEGRALERRIAAMEGVAETRFVTREQALADLKA
FT                   MFGDRADLLEGVEQENPLRDSIEVRLADPRYGDQVSAALRQAQGVQDVKYRRDLADRIR
FT                   RMGDAVRAGSALLVGLLAVTTLFLISNTIRLTVYARRREIQIMKLVGATDWFIRWPLVI
FT                   EGVLLGLVGAGAAAALAWWGYDRLVVEVTRAVPFVPLVPKEPLLNQVAQVLVAGGALLG
FT                   ALGSAMSLRRHLRV"
FT   sig_peptide     233091..233228
FT                   /locus_tag="Tmar_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            234281..235663
FT                   /locus_tag="Tmar_0205"
FT   CDS_pept        234281..235663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0205"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG4942 Membrane-bound metallopeptidase;
FT                   InterPro IPR007060: IPR016047; KEGG: slp:Slip_1870
FT                   peptidase M23; PFAM: Peptidase M23; Septum formation
FT                   initiator; SPTR: Peptidase M23; PFAM: Septum formation
FT                   initiator; Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50330"
FT                   /db_xref="GOA:E6SM00"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM00"
FT                   /protein_id="ADU50330.1"
FT                   /translation="MVWHGMGPLGRKEPGPGGEAAGPGVRRTLAAATGSSDGAGAERRS
FT                   RARRRWARAAAGLAAVALVVAGLIAGVAGPAPVSAGSASSISELRQKINEANETLRQLE
FT                   QEQAEAQRRLKALKEDEASIAERVRILEEQIRATRIKLAELTEQVREAEARVAAKQQEI
FT                   DEATRQLEQREDYVARRIRAIQENGTVGVLEVLFEANSFSDFLTRLDLLSQILRHDLDV
FT                   MAQVKAERERLVAEKQQLEAERQRLVALKAQVERQQQQLNATVASHRDELAKLAEQRRK
FT                   IEEQLAALEADSKEVERLLKNLQADLKRRLAELNRTPRQGGGRFLWPLPGEYTITSGFS
FT                   PARRHPIYGTVRPHTGIDIDGQGPPDPDPSTWDEVVAADDGIVVASQYMSGYGNAIIIA
FT                   HDETFSTLYAHLSRRYVGPGDVVRRGQVIGMVGTTGASTGTHLHFEVRINGQPVDPMPY
FT                   LR"
FT   gene            235929..237305
FT                   /locus_tag="Tmar_0206"
FT   CDS_pept        235929..237305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0206"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR001478: IPR005151: IPR004447; KEGG: pth:PTH_2744
FT                   periplasmic protease; PFAM: peptidase S41; PDZ/DHR/GLGF
FT                   domain protein; SMART: peptidase S41; PDZ/DHR/GLGF domain
FT                   protein; SPTR: Periplasmic protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: Peptidase family S41; PDZ
FT                   domain (Also known as DHR or GLGF); TIGRFAM: C-terminal
FT                   peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50331"
FT                   /db_xref="GOA:E6SM01"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM01"
FT                   /protein_id="ADU50331.1"
FT                   /translation="MTAFGQSFDTGPAGREGDRPVLTWRQAVAGALVLVILTAAITLVV
FT                   SERVEGFWLRLFPQSVALGDAEKQQLLDELVRSPNFDRFLRVVQLVRTQYVDPLPVDQL
FT                   LEGAARGVVEATGDPFSTYFNPEEFREFQIDVSGHYTGIGVVVSEREQGGVVVQTPFEG
FT                   SPGATTPFEGAGPGDPVGLRPGDLIIAVDGKDVTQESVEAVARMIRGPEGTQVTVEVLR
FT                   EGYDKPLKFVLTRRNIEVPSVQAHMLEGGIGYIQLTQFLSDTPQDFDAALEELQRQGMR
FT                   GLILDLRNNPGGELQAVVRVADRLLPRGPIVHIEYRNRGRETYSSDAQALGLPLAVLVN
FT                   QGSASASEILAGAIQDYGVGVLVGEHTFGKGTVQTVWPLDDRGLPGLGGQQRDRAGVKL
FT                   TVARYLTPRERPIVMGKGITPDVQVPFELNTLEGMGDLRRDPQLRAAYQRVQQMVAGGK
FT                   "
FT   sig_peptide     235929..236066
FT                   /locus_tag="Tmar_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            237302..238570
FT                   /locus_tag="Tmar_0207"
FT   CDS_pept        237302..238570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0207"
FT                   /product="serine protease"
FT                   /note="InterPro IPR001478; KEGG: pth:PTH_2743 serine
FT                   protease; SPTR: Trypsin-like serine protease, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50332"
FT                   /db_xref="GOA:E6SM02"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM02"
FT                   /protein_id="ADU50332.1"
FT                   /translation="MNGPWGLPLGELARLLVFDTLPATVLSPSTAPLFVLVLGLVAFQY
FT                   ARIGRMELEMYGRTLVPTWHRVLTAVAAGLLGGFVGGLIMTAAGVVLEPRDVTPLWPVA
FT                   LVLALIRPRFICFAYATGIIGASTLLWGWPQVHVPGLVALVGVLHLAEAILVYIDGAEG
FT                   ATPVLARNGRGEVVGGYLMQRFWPVPAAILVLINFTSPGGGIEMPPWWPLVGPADPERL
FT                   QAAGWIVAALPLVAGLGYTDVALTATPGARSRRMALIMVAYGAALVGLAALAERDAAWL
FT                   WPATLASPLLHEGMIQLGLARERWGRPLFGPAEQGARVFWVWPGSQAEALGLQAGDIIL
FT                   AANGRPVQREGDLVSVAMDLWEGRPRIYDLRLEVQRGGRRVTLELARFDPMRPFGAVLV
FT                   PPPGDPAPRPVVDLGRGKHLFGT"
FT   gene            238716..240797
FT                   /locus_tag="Tmar_0208"
FT   CDS_pept        238716..240797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0208"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="COGs: COG0556 Helicase subunit of the DNA excision
FT                   repair complex; InterPro IPR014001: IPR001650: IPR006935:
FT                   IPR001943: IPR 004807: IPR014021; KEGG: mta:Moth_0251
FT                   excinuclease ABC subunit B; PFAM: helicase domain protein;
FT                   type III restriction protein res subunit; UvrB/UvrC
FT                   protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: UvrABC system protein B; TIGRFAM:
FT                   excinuclease ABC, B subunit; PFAM: Helicase conserved
FT                   C-terminal domain; UvrB/uvrC motif; Type III restriction
FT                   enzyme, res subunit; Ultra-violet resistance protein B;
FT                   TIGRFAM: excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50333"
FT                   /db_xref="GOA:E6SM03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM03"
FT                   /protein_id="ADU50333.1"
FT                   /translation="MPAFKVVSEFEPRGDQPKAIAEITRAFREGARVVTLLGATGTGKT
FT                   ATMAWVIEQLQLPTLVIAHNKTLAGQLAAEFKQFFPHNAVEYFVSYYDYYQPEAYVPQT
FT                   DTYIEKDALINDEIDKLRHSATSSLFERKDVIVVASVSCIYGLGAPEDYRDLVLSLRVG
FT                   NEMPREQILRKLVDIQYTRNDVDFQRGTFRVRGDVIEIFPASMAERAIRVELFGDEIDR
FT                   LTEIDALTGEVLAYRDHVAIYPASHYVTHEWKLKRAIESIERELEERLAELRAQDKLLE
FT                   AQRLEQRTRYDLEMLREVGYCSGIENYSRHLTGRAPGEPPYTLLDYFPRPFLCIIDESH
FT                   VTIPQLRAMYEGEMSRKDSLIDYGFRLPSARDNRPLKFDEFWEKVGQVLFVSATPGPFE
FT                   REVSDVIVEQIVRPTGLLDPEIEVRPTRGQIEDLLGEIRQRVERGHRVLVTTLTKRMAE
FT                   DLTDYLREMGIKVRYLHSEIDTLERMEIIRDLRLGVFDVLVGINLLREGLDLPEVSLVA
FT                   ILDADKEGYLRSATALIQTIGRAARNVEGKVIMYADTITDSMRQAIEETYRRRKIQEDY
FT                   NRRHGITPQTVRKAVRDVIEATHAAERPPEYLAGKRLSELPRHQIPDLVKRLRKEMEQA
FT                   ARDLEFERAALLRDMILELEARRLGQPVSREGLRAAAPAGAGSGTAGRRRARSGRAGR"
FT   gene            240807..243677
FT                   /locus_tag="Tmar_0209"
FT   CDS_pept        240807..243677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0209"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="COGs: COG0178 Excinuclease ATPase subunit; InterPro
FT                   IPR003439: IPR004602: IPR017871; KEGG: bts:Btus_2178
FT                   excinuclease ABC, A subunit; PFAM: ABC transporter related;
FT                   SPTR: Excinuclease ABC, A subunit; TIGRFAM: excinuclease
FT                   ABC, A subunit; PFAM: ABC transporter; TIGRFAM:
FT                   excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50334"
FT                   /db_xref="GOA:E6SM04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM04"
FT                   /protein_id="ADU50334.1"
FT                   /translation="MGQDRIVIRGARQHNLKNIDLELPRDKLIVITGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSAYARQFLGQMDKPDVDLIEGLSPAISIDQKTTTRNPRSTVGTVT
FT                   EIYDYLRLLFARVGHPHCPNCGRPISQQTVEQMVDRVLELPEGTRVQVLAPLVRGRKGE
FT                   HEKVFDEARRAGFVRVRIDGEIRELAELPPGFKLEKNKKHTVEVVVDRIVVRPGARPRL
FT                   ADSIETALGLADGLVVIDVLDGEPMLFSQHFACPECGTSLEELSPRMFSFNSPYGACPV
FT                   CSGLGSRLEIDPELVIPDRRKSLADGAVVPWSRGSSNYYPQLLAAVARHFGVDWEAPLE
FT                   EAGEEFVRVLLYGTPEPIRFRYENRYGRVRDRYVAFEGVVANLERRYREATTDAQREEI
FT                   EQYMSAHPCPACRGARLRPESLAVTVGGKNIAEITAMSVRQLLGFLDGLELTEREATIA
FT                   REVIKEIRARLHFLVDVGLDYLTLDRPAGTLSGGEAQRIRLATQIGSGLVGVLYILDEP
FT                   SIGLHQRDNARLIATLQRLRDLGNTLVVVEHDQDMIEAADYIVDIGPGAGEHGGRVVVA
FT                   GTLDDVLNCPESVTGQYLSGRREIPVPERRREPNGRWLVVRGAREHNLKNVDVRFPLNV
FT                   LVCVTGVSGSGKSTLVNDILYRRLAQHVYGTKTRPGEHDAIEGLEYVRKVVNVDQSPIG
FT                   RTPRSNPATYTGVFDFIRELFAATPEARMRGYTKGRFSFNVRGGRCEACKGDGIIKIEM
FT                   HFLPDVYVPCEVCKGRRYNRETLEIKYKGKSIADVLDMTVEEALEFFAAVPRVQRKLQT
FT                   LYDVGLGYIRLGQPATELSGGEAQRVKLATELSRRSDGGTVYILDEPTTGLHFADIHRL
FT                   VDVLQRLVDNGDTVIVIEHNLDVVKVADWVIDLGPEGGDAGGRVVAEGPPEAIMAEPAS
FT                   YTGQFLRQHLERQRLRVSTGLKPAAV"
FT   gene            complement(243658..245190)
FT                   /locus_tag="Tmar_0210"
FT   CDS_pept        complement(243658..245190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0210"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   cag:Cagg_0749 protein of unknown function UPF0118; PFAM:
FT                   protein of unknown function UPF0118; SPTR: Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50335"
FT                   /db_xref="GOA:E6SM05"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM05"
FT                   /protein_id="ADU50335.1"
FT                   /translation="MTTEPAVEPVRQSGEPPGEARGTGGAGSTGGTGGPPPPPAGPAWT
FT                   TLVTLLNVLAAAGVAWLAWWVLSHFARTLTLLGLAGVLAFLLEPAVSFLERGMRSRALA
FT                   ALLLYLAFVALLALGVVYLAGPIKEQAQELFWAVPQYRQQVEQAVPLLQTYMEALQAYL
FT                   SRYGVSLEPRDLASQFLERVAGNTNRILAGVTAVVTGVGTTLANALLVLVISIYLVVDG
FT                   GGLNRQMLGYLPRRYRGPVRRAQAVALRVFGGYLRGQLLLGLIIGVAVGIGMSALGMPY
FT                   PALLGVIAGVMELVPIVGAVLGAIPAILVALFQPWPAVLYVTLFFVVVQQVEGNVLVPR
FT                   ITGQAVGLHPLATLLALLAGYEIAGILGAILAVPVVAFVQALLREFNPPDPDDPADRAG
FT                   SRRRGTRARRQHRRQGGPPASTPPAPPAGTGTPGTRPGNAPPAEPEGAAGPEETGRAPG
FT                   GPSPGPGPGSSAGSGPAPRSGSEAGSGSAAGAAGSAPAAGSGPRIVITRRPA"
FT   gene            complement(245517..246836)
FT                   /locus_tag="Tmar_0211"
FT   CDS_pept        complement(245517..246836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0211"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; InterPro
FT                   IPR006638: IPR007197; KEGG: ace:Acel_1220 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR:
FT                   Radical SAM domain protein; manually curated; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50336"
FT                   /db_xref="GOA:E6SM06"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM06"
FT                   /protein_id="ADU50336.1"
FT                   /translation="MFGTRPRSGGGPVRPRARRIQYRWLACKTLINKVPPGMPFRWSIN
FT                   PYRGCTHGCVYCYARATHPYLGLDGGLDFESVIFVKADAVKALRRDLGRPGWNRELVAI
FT                   GTATDPYQPIEGKYRLMRGILRELIDAGTPFSITTKSTLVLRDLDLLVEATRRAGCTVN
FT                   LSVPTVDPALWRQLEPGTPHPYQRLRVLQRLREAGVRAGVFLAPILPGITDDRRHLEAV
FT                   VREAARHGAAFLWPGVLHLGPGVREWVFPALARIRPDLMPMYRALYRGRDAAPFYRESV
FT                   LRRVEELKTKWGLPTGRHAVEPPRGAEADGGVAGGAGRNGAGNSTPLAAGPLAAGPVRG
FT                   SGPIGPRDRDPTPGQPVPVLPVAAMAGVTPILPGSWGTNRPLGTSPGSGPRARPAASAG
FT                   ERGRGPSRRPLWPGHGDGRRYGSRDGGGGSQQLALPLPGA"
FT   gene            246899..249175
FT                   /locus_tag="Tmar_0212"
FT   CDS_pept        246899..249175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0212"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="COGs: COG0322 Nuclease subunit of the excinuclease
FT                   complex; InterPro IPR000305: IPR003583: IPR001943:
FT                   IPR001162: IPR 004791; KEGG: pth:PTH_2736 excinuclease ABC
FT                   subunit C; PFAM: excinuclease ABC C subunit domain protein;
FT                   Excinuclease ABC C subunit domain protein; UvrB/UvrC
FT                   protein; SMART: Excinuclease ABC C subunit domain protein;
FT                   Helix-hairpin-helix DNA-binding class 1; SPTR: UvrABC
FT                   system protein C; TIGRFAM: excinuclease ABC, C subunit;
FT                   PFAM: UvrB/uvrC motif; UvrC Helix-hairpin-helix N-terminal;
FT                   GIY-YIG catalytic domain; TIGRFAM: excinuclease ABC, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50337"
FT                   /db_xref="GOA:E6SM07"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM07"
FT                   /protein_id="ADU50337.1"
FT                   /translation="MINPDTGAGPARRPARRQSRPKAMLGPAGQGKGGAPVETRDRRRP
FT                   GRTADGGITTGTGAGTPAGTSAATRAPEDEPADGSAAGGTSSLRQKAAELPEQPGVYLF
FT                   KDREGQVLYVGKARSLRQRVRSYFQSSRHLPARILRMVERAADLEFIVTRNEVEALVLE
FT                   NTLIKRYRPRYNVRLRDDKTYPYLKIHVHEEWPRVSIARQVQDDGARYFGPYTYSASLQ
FT                   EALRLIRRVFPYRSCSDHRLRRGGRPCLHYYIGRCLAPCAALCDRDQYDAMIRDLIAFL
FT                   EGRSRAVLERVEAEMQAAAERWEFERAAELRDQLRALHQVLEQQQVDSPRRGEEDAVGI
FT                   ARQGDRAHAQVFFVREGRIIGREHLSMTGVEGLDDGELLAAFLSQYYGRATFVPREILL
FT                   PVDLPPGEAELIGRWLSQRRGIQVRLHRPQRGTKRRWVELAEHNARLLLAQAQTDEQVR
FT                   QDRARRALDELARYLELDEPPRRIECYDISNLQGAQPVGSMVVMIDGEPAKAEYRRFRI
FT                   RTVEAPNDFASMQEVLYRRLRRGLEAQGVPVEGPVGGPGAAAGADEPAEARGDAGTDAA
FT                   PGHGAAGAAAAAVPSATVRATREESDGGGAPHGFADLPDLILIDGGKGQLSAAQEVLDR
FT                   LGLVDIPVFALAKRFELVFAPDRADPIVIPRDSPALHLLQRIRDEAHRFALTYHRQLRQ
FT                   RAGLHSVLEEIPGIGPRRRKALLEAFGSLEAIARASEDELAAVPGMNRAAARAVYRAFH
FT                   RLPST"
FT   gene            249273..251057
FT                   /locus_tag="Tmar_0213"
FT   CDS_pept        249273..251057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0213"
FT                   /product="thiamine pyrophosphate central domain-containing
FT                   protein"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein; InterPro IPR012001: IPR012000; KEGG: tbi:Tbis_1583
FT                   thiamine pyrophosphate protein domain-containing protein;
FT                   PFAM: thiamine pyrophosphate central domain-containing
FT                   protein; thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; SPTR: Thiamine pyrophosphate
FT                   protein TPP binding domain protein; PFAM: Thiamine
FT                   pyrophosphate enzyme, central domain; Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50338"
FT                   /db_xref="GOA:E6SM08"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM08"
FT                   /protein_id="ADU50338.1"
FT                   /translation="MPMNRQWQHVTASLVRPYRPAAVLAAGVPLPAAQAAAAADGAARA
FT                   TGRPAVLLAGSGAELNAMLPVLVMADADSVPLVVLVRGGTAADLEAGRERAGALPDTLR
FT                   LTEPFTGWNTRVDRPEDVQPVLEAAFTDLARRRPRPLLIELADEALPRWAADPPAGTGA
FT                   GDAPLPGDTAFPHLLGDGDEPGAAGRTAADTAAEAAAGIPGAATAAAGRGRRPAAEEEG
FT                   EDGFRPAGGPTGNGAVIPFPGRRDEHGRPGEPAVDRRWLDQVAAALVRCRQPAIVAGGG
FT                   AAGAGESLRRLAEHLGAPVFLTLAGRGLLPAGHPLAVNGLAAAPARRWLEEADVVLVVG
FT                   TSLSPAEHGDLDLKGRVIQVDRDAERLGRNVPVWMALPGDAAPALAALVRRVEVEMARP
FT                   VGPEAYLGATGPEQRRRAVARLQDELAAETAQAGAAGGDGAWLATLEPRLTAADPDALS
FT                   VAEAAILPVTGARSLLLPVRLGVAGYAIPAAWGAARATGRPARAVTTAAGLWNAGAVLP
FT                   WIAPLAVDLEILVRLDRGDEGGAGEEAQGAGHPGDRPGPASVAEFFRRAAPALNLHWDE
FT                   PGWGAGVPAARLRPAGAR"
FT   sig_peptide     249273..249386
FT                   /locus_tag="Tmar_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            251283..252830
FT                   /locus_tag="Tmar_0214"
FT   CDS_pept        251283..252830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0214"
FT                   /product="Spermine synthase"
FT                   /note="COGs: COG0421 Spermidine synthase; InterPro
FT                   IPR001045; KEGG: nmr:Nmar_1135 spermine synthase; PFAM:
FT                   Spermine synthase; SPTR: Spermine synthase; PFAM:
FT                   Spermine/spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50339"
FT                   /db_xref="GOA:E6SM09"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM09"
FT                   /protein_id="ADU50339.1"
FT                   /translation="MVSLTAFFAGAVLMALELLGSRILAPTLGSSIFVWGSLIGVVLAA
FT                   LSAGYALGGAAADRWPSRAGPALVLVASALWILLLAARGEAWVAALAARVPGPRLAPLA
FT                   ASAALFLLPGLLLGSISPWVVRLAAPEAHRLGRVAGHLYAVSTAGSIAGTWATSFWLIP
FT                   WLDTTTILKALAAVLAGTALLLAGRRHLAVALPAAAVLGLAVVPPPAPVTVTPDGARVL
FT                   FQRNTLYHHLRVEDRGDSRFLRFDNSWQSGMYLDDPVRARFEYTDVMHAGWALNPQARR
FT                   VLLVGLGGGSIPKRILASYPDATVDVVELDPVVVDVARRYFFLPSDPRLRVYVDDGRRF
FT                   VRQAPGRYDLVMLDAYYADAIPFHLTTVEFLEEVRSRLAPGGVVVANVIGSLEGPRSAL
FT                   LRAFYRTYREVFPEVYLLPVLPVGAEELQNVILLARDDRDAPGPLPAEELARAIAAWTA
FT                   RHPELEALAAAAGWIYDRPVPVDDVPVLRDAYAPVDALLHFERENPLPQVPLPEGGN"
FT   sig_peptide     251283..251357
FT                   /locus_tag="Tmar_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            253121..253471
FT                   /locus_tag="Tmar_0215"
FT   CDS_pept        253121..253471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0215"
FT                   /product="membrane protein of unknown function"
FT                   /note="COGs: COG1950 membrane protein; InterPro IPR007165;
FT                   KEGG: tjr:TherJR_2728 membrane protein of unknown function;
FT                   PFAM: membrane protein of unknown function; SPTR: Putative
FT                   uncharacterized protein; PFAM: Membrane protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50340"
FT                   /db_xref="GOA:E6SM10"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM10"
FT                   /protein_id="ADU50340.1"
FT                   /translation="MNLLIRWLINAGAILLVAWLLEGIDVTGPGAALVAALVLGLVNAV
FT                   IRPVVLFLTMPIGCLTLGLFTFVVNALMFWLVASVVPGFEVDGFIPALVGSLLVSIVST
FT                   VATRLWADRGDR"
FT   sig_peptide     253121..253189
FT                   /locus_tag="Tmar_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(253635..254117)
FT                   /locus_tag="Tmar_0216"
FT   CDS_pept        complement(253635..254117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0216"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COGs: COG0757 3-dehydroquinate dehydratase II;
FT                   InterPro IPR001874: IPR018509; KEGG: hoh:Hoch_0255
FT                   3-dehydroquinate dehydratase, type II; PFAM: dehydroquinase
FT                   class II; PRIAM: 3-dehydroquinate dehydratase; SPTR:
FT                   3-dehydroquinate dehydratase, type II; TIGRFAM:
FT                   3-dehydroquinate dehydratase, type II; PFAM: Dehydroquinase
FT                   class II; TIGRFAM: 3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50341"
FT                   /db_xref="GOA:E6SM11"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM11"
FT                   /protein_id="ADU50341.1"
FT                   /translation="MTATTSPAGGNAPGGRILVLHGPNLNLLGRREPEVYGTVTLEAVD
FT                   AALRERAARHGVEVDTFQSNHEGTLIDRLHGAPGRYRGVILNPGGYAHTSVALRDAVAA
FT                   VTGLGVPVIEVHLTNVHARESFRHRMVTAGACRGVISGLGIWSYLLALDALLHGGA"
FT   gene            complement(254307..256289)
FT                   /locus_tag="Tmar_0217"
FT   CDS_pept        complement(254307..256289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0217"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="2.7.1.71"
FT                   /EC_number="4.2.3.4"
FT                   /note="COGs: COG0337 3-dehydroquinate synthetase; InterPro
FT                   IPR000623: IPR002658: IPR016037; KEGG: sti:Sthe_1116
FT                   3-dehydroquinate synthase; PFAM: 3-dehydroquinate synthase;
FT                   shikimate kinase; PRIAM: Shikimate kinase.,
FT                   3-dehydroquinate synthase; SPTR: 3-dehydroquinate synthase;
FT                   TIGRFAM: 3-dehydroquinate synthase; PFAM: 3-dehydroquinate
FT                   synthase; Shikimate kinase; TIGRFAM: 3-dehydroquinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50342"
FT                   /db_xref="GOA:E6SM12"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM12"
FT                   /protein_id="ADU50342.1"
FT                   /translation="MRIVLVGLMGAGKTTVGRALAARLGWAFLDLDDLIEQEAGQTVAD
FT                   LFAREGEAGFRTREEQALATALTLERVVLATGGGAVLSARNRQRLAAEPWVFWLEAPPD
FT                   ELARRLAGPGAAARPLLAGATGRPATPPPAGSGAGFPAGSVGADVPNSGRSGEPGAHPA
FT                   RAGGAGGAGGPDAEALVARLAGLLQQRQAAYAAVARHRIPTAGRSVDQVVTGLLETLQA
FT                   SGWARPVQGPSTRPYPAPVPDPDLVIEAGPDRYPLWVRPGTVGPVEAAGLEVLVAAVAG
FT                   LQSGGGGAGPAGSSGMVARSRGGGQPPASGLAPPEPGERAPVALLVSDPVVAALYGHGV
FT                   AAALDQAGFHVVRAVVPAGEEAKSLHWASALYDRLLEAGAGRDAWVFALGGGVVGDLAG
FT                   FVAATYMRGIAFAQLPTTLLAQVDASAGGKVAVNHPRAKNLIGAFHQPRLVVADPATLV
FT                   TQPWPAYRGGLAEMVKHALLDGEDHLASLEAAVPRLRERDPHQLAPLIARSVAVKARIV
FT                   AVDPEERGPRAFLNLGHTFAHALEAATGYRVPHGDAVAAGLALALALSERLGMIPAGLA
FT                   ARVQHLLARLGLPVTLAEACRAWDVPPPEAAAVLGRLLYDKKNRRGRVRFVLLGAPGQV
FT                   TLRDDVPPALVEELVRRSLAGGPPA"
FT   sig_peptide     complement(256227..256289)
FT                   /locus_tag="Tmar_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(256304..258019)
FT                   /locus_tag="Tmar_0218"
FT   CDS_pept        complement(256304..258019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0218"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COGs: COG0082 Chorismate synthase; InterPro
FT                   IPR000453: IPR020541; KEGG: tfu:Tfu_1090 chorismate
FT                   synthase; PFAM: chorismate synthase; PRIAM: Chorismate
FT                   synthase; SPTR: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase; PFAM: Chorismate synthase; TIGRFAM: chorismate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50343"
FT                   /db_xref="GOA:E6SM13"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM13"
FT                   /protein_id="ADU50343.1"
FT                   /translation="MTLRLLTAGESHGPGLVAVLEGIPYGLPLTTADIDRDLARRQLGY
FT                   GRGGRMKIERDRVRFLGGVRHGRTLGGPIALWIPNRDWANWTLAMAAEPLDAVLAGAGT
FT                   PPLPPGPPGTEVEGAGASAEGPGPKDGAAEKGTPAGLGRTDEAHGAGGTGRASAARQGA
FT                   AATGDWRMEPVTRPRPGHADLAGALKYGARDIRDILERASARETAARVAAGAVARKLLS
FT                   LFGVRIQSYVLRIGQVAIPSPVLAYGEGGRPPVDPARLEAATEASPVRCPDPEASQRMV
FT                   EAIRAAGQAGDTLGGVFEILVTGVPVGLGSHVTGDRRLEGRLAGALMALNAIKGVEVGL
FT                   GFAAAALPGSQVHDPIGYRPPGATPPPPGVPAEAARAGADGWRGPAAGFFRYRNGAGGI
FT                   EGGITNGEPLVLRAAMKPIATLRRRLPSADLLTGEPFEAHHERSDVCAVPAAAVVAEAI
FT                   VALELASAWLEKFGGDSVDEIRRNYAAYCQRLATWVRPAAGDDKAGGARGIGGIGGTGG
FT                   AGEAGGAGARGAAGQGGAAGRRAGASPGGTPPAGTGGSADGGDPAGGGTGREAR"
FT   gene            complement(258016..259197)
FT                   /locus_tag="Tmar_0219"
FT   CDS_pept        complement(258016..259197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0219"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR013708: IPR006151: IPR011342: IPR006650; KEGG:
FT                   mta:Moth_1558 shikimate dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; SPTR: Shikimate
FT                   dehydrogenase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain; Shikimate
FT                   / quinate 5-dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50344"
FT                   /db_xref="GOA:E6SM14"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM14"
FT                   /protein_id="ADU50344.1"
FT                   /translation="MRSRQERGGTPAAPAATARGDWGTASGAPAGGEQPRRLAVLGHPI
FT                   GHSLSPVLHNAAFRAVGLPWTYERRDVPPAELPAALAALRADPTWAGVNLTIPHKEAAL
FT                   ALLDRVDPAARRVGAVNTVVREDGGILVGYNTDGVGFLRDLEEHGLPPSQLAGHRALVL
FT                   GAGGAARAVAFALAEAGMTLVIANRTVRRAEELAAAVAAALAAGSLRGGPSGPIGPAGA
FT                   TRPGGPEPPGDPAAAAGRGVTAGEAGGGRVPPVLALSADDPRLPGLARGCLLVVNATSA
FT                   GMAPQEGVDPLPPACRPQPGQVFYDLVYRPAVTPFLARAAAAGARAIGGLGMLLHQGAA
FT                   AFELWTNRPAPVEAMRAALQAALEGAVGAVGAVRDGEPGATPGQRLVEERDRH"
FT   gene            complement(259194..260720)
FT                   /locus_tag="Tmar_0220"
FT   CDS_pept        complement(259194..260720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0220"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COGs: COG0128 5-enolpyruvylshikimate-3-phosphate
FT                   synthase; InterPro IPR001986: IPR006264: IPR016228; KEGG:
FT                   adg:Adeg_1149 3-phosphoshikimate 1-carboxyvinyltransferase;
FT                   PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); SPTR: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50345"
FT                   /db_xref="GOA:E6SM15"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM15"
FT                   /protein_id="ADU50345.1"
FT                   /translation="MSGAIPTPTPDTTRSPAPGSGGAARVRPGRRLQGTLQVPGDKSIS
FT                   HRAAMLAAAAGGRTVLESYAPGRDAASTLACLAALGVTVQRPDPGRVVIDGPGIAGWRA
FT                   PAAPLDAGNSGTTMRLLLGLLATRPFRSTLTGDASLRRRPMGRVVEPLRRMGARIEGQD
FT                   GGRLAPLHVQGGDLQGIHHDSPVASAQVKSAVLLAGLFAAGRTSVREPALSRDHTERML
FT                   PLFGVPVERDGLTVAVEGGRPLRAPARLVIPGDPSAAAFYLAAAILCPDSRIVLPGVGV
FT                   NPTRTGFLEVLENMGARVGMARQAGDGSAGDGSPAGEPVADLTAETSALRAVTIGGDLI
FT                   PRLIDEIPILAVLATQARGTTRIRDAAELRVKETDRLRALAEELRRLGARVDEHPDGLD
FT                   VHGPTPLRGAVCSARGDHRMAMALAVAGLVATGETVILDASSAAVSDPDFFANLRRLGA
FT                   PVDGPDRPDADEPSRITARAPSGAGSRPHPAGTASGQGPSGAPSRGDERA"
FT   gene            complement(260689..261735)
FT                   /locus_tag="Tmar_0221"
FT   CDS_pept        complement(260689..261735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0221"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="COGs: COG0287 Prephenate dehydrogenase; InterPro
FT                   IPR003099; KEGG: dau:Daud_1182 prephenate dehydrogenase;
FT                   PFAM: Prephenate dehydrogenase; SPTR: Prephenate
FT                   dehydrogenase; PFAM: Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50346"
FT                   /db_xref="GOA:E6SM16"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM16"
FT                   /protein_id="ADU50346.1"
FT                   /translation="MARRDAQDGEDGFGPAGLDGWRHRTLAVIGLGQIGGSLAAAARPL
FT                   VARVIGIDRDPEAVEHALQAGRIDTGSADGFELLVEADAVAVAVPVGAIPDVLEAARPH
FT                   LRPGVLVTDTGSVKEPVVDAARRLLPPGVAFAGGHPMAGTERWGPAAADPGLFRGRTWT
FT                   LTPAPPWGEAAARPWIPLLEAVGARILVMDPEEHDRHVALTSHLPLLVAAALAGTARRG
FT                   AAELPYLAQLVAGGFRDTTRVAGGHPALGRDMLRANWPRVAPWLDALREALDQLARAAA
FT                   RGDGEALYRYLDETRRFREAVLGAAGVTGAGGSTGGGANPVNDTSTAGHDIDGNGETHV
FT                   RRHTHPHP"
FT   gene            complement(261739..262962)
FT                   /locus_tag="Tmar_0222"
FT   CDS_pept        complement(261739..262962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0222"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="COGs: COG2876 3-deoxy-D-arabino-heptulosonate
FT                   7-phosphate (DAHP) synthase; InterPro IPR006218: IPR006268;
FT                   KEGG: mta:Moth_1335 3-deoxy-7-phosphoheptulonate synthase;
FT                   PFAM: DAHP synthetase I/KDSA; PRIAM:
FT                   3-deoxy-7-phosphoheptulonate synthase; SPTR:
FT                   3-deoxy-D-arabinoheptulosonate-7-phosphate synthase;
FT                   TIGRFAM: phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM:
FT                   DAHP synthetase I family; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50347"
FT                   /db_xref="GOA:E6SM17"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM17"
FT                   /protein_id="ADU50347.1"
FT                   /translation="MIVIMHPHATPDDIDQVQERLRQAGLRPFVARGDERVVIHGHGDP
FT                   RSLDGQQVETLRGVERVVTVSRPYKLASREFRPEPTVVSAGGVPFGGPAIPIIAGPCSV
FT                   ESEAGLLEIAGFLRQAGAAALRGGAFKPRTSPYSFQGLGEEGLRLLALARERTGLPVVT
FT                   EVMAPEQVELVAEYADVLQIGARNMQNFPLLQAVGRTRKPVLLKRGFMATIEEWLLAAE
FT                   YVLAAGNPHVILCERGIRTFETATRNTLDLNAVAVAKTLTHLPVIVDPSHGTGHREYVI
FT                   PLARAAIAAGADGLIVEVHPRPDRALSDGTQSLDFAQFEQMVREVEAVARAVGRHLYRH
FT                   GDERGRGEAAGAGAADGVAPQASPSGDAPRAREERAGTGGRARPAAVTAPAPPPAAAGR
FT                   RAAAGGGQ"
FT   gene            complement(262959..263381)
FT                   /locus_tag="Tmar_0223"
FT   CDS_pept        complement(262959..263381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0223"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="COGs: COG4401 Chorismate mutase; InterPro IPR008243;
FT                   KEGG: adg:Adeg_1290 chorismate mutase; PFAM: Chorismate
FT                   mutase of the AroH class; SPTR: Chorismate mutase; TIGRFAM:
FT                   chorismate mutase; PFAM: Chorismate mutase type I; TIGRFAM:
FT                   monofunctional chorismate mutase, gram positive type, clade
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50348"
FT                   /db_xref="GOA:E6SM18"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM18"
FT                   /protein_id="ADU50348.1"
FT                   /translation="MRGIRGAVVAEDNSPEAIRRATRELLQAMVALNEASVDDIVAVFF
FT                   TVTGDLDRAFPASAVRELGWTHVPLLDAVAPPVEDDLPRCIRALMLVNTDRSPAEIRHV
FT                   YLGQARCLRPDLAGWEPDGTMAGMAVAQALAGGNRG"
FT   gene            complement(263804..264247)
FT                   /locus_tag="Tmar_0224"
FT   CDS_pept        complement(263804..264247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slp:Slip_1767 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: HutP"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50349"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM19"
FT                   /protein_id="ADU50349.1"
FT                   /translation="MTHGTEAPNLAVARAALRLATSAGRAEEARVKEELLRQGIRGVAV
FT                   DFGGPYAESIGSMVQRAIVAARREGVIAPIHPHEGAVAGAAREALSQLAGRALGFNVGG
FT                   KVAIARFGEHLACAVFVGVGLVHLDDVAVGLAHRAVPDVDAGA"
FT   gene            complement(266029..267378)
FT                   /locus_tag="Tmar_0225"
FT   CDS_pept        complement(266029..267378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0225"
FT                   /product="magnesium transporter"
FT                   /note="COGs: COG2239 Mg/Co/Ni transporter MgtE (contains
FT                   CBS domain); InterPro IPR000644: IPR006668: IPR006667:
FT                   IPR006669; KEGG: bcb:BCB4264_A2496 magnesium transporter;
FT                   PFAM: MgtE integral membrane region; MgtE intracellular
FT                   region; CBS domain containing protein; SMART: CBS domain
FT                   containing protein; SPTR: Mg2+ transporter mgtE; TIGRFAM:
FT                   magnesium transporter; PFAM: MgtE intracellular N domain;
FT                   Divalent cation transporter; CBS domain; TIGRFAM: Mg2+
FT                   transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50350"
FT                   /db_xref="GOA:E6SM20"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM20"
FT                   /protein_id="ADU50350.1"
FT                   /translation="MQAAEWARDITDTLRGEDEQGALERLARLQPFDRAEVLAHLEPAD
FT                   RLRLVRAMPTSLAAETLEYLEPETQYRILDHLDEPLAAALLQAMSSDTVVDLLLALHPL
FT                   QAAKLKAWLPSAYRERIDTLMTFPENTAGSLATIEYIAAREGWTVQQALDHVRKVGHDA
FT                   EVVSYVYVVDARGRLVRVASLRELILADPRAPLTAVGRPDVIAVRATADREEAARLLTR
FT                   YDFVALPVVDDQNRLLGIITIDDIVDVIHREATEDIQRLGGSVPLAESYFKTPVPVLFR
FT                   KRVGWLLTLFVAEAYTGTVLRHFEDILSRVVGLAFFIPLLIGTGGNTGSQTVSTLVRAL
FT                   AVGEVTFRDWLRVLARELATGTLLGTVMAAAALVRAYTLGVGPQLGPVVAVTALFIVLW
FT                   ASMVSAVLPLLLHRLRVDPAVVSGPFISTLVDGTGLFLYFTVAQVMLRLT"
FT   gene            267482..267625
FT                   /locus_tag="Tmar_0226"
FT   CDS_pept        267482..267625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_13251 putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50351"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM21"
FT                   /protein_id="ADU50351.1"
FT                   /translation="MGRARPAVARRPIIVRAGELAEAVERRARNPAAGTVADTVDPVSG
FT                   TE"
FT   sig_peptide     267482..267550
FT                   /locus_tag="Tmar_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            267639..268616
FT                   /locus_tag="Tmar_0227"
FT   CDS_pept        267639..268616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0227"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR006139: IPR006140; KEGG:
FT                   hmo:HM1_0770 glyoxylate reductase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; PRIAM:
FT                   Glyoxylate reductase; SPTR: Glyoxylate reductase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50352"
FT                   /db_xref="GOA:E6SM22"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM22"
FT                   /protein_id="ADU50352.1"
FT                   /translation="MAGDRPRVFVTRQVPEGALAPLEGWAHVEVWPEFLPPPREELARR
FT                   LAEADGVITMITDRIDDDLLAAAPRLRVVSNCAVGYDNVDVAAARRRGVMVTHTPGVLT
FT                   EATADLAFALILACARRLPQAEADLRAGRWTTWHPLQWLGLELDGATLGIVGLGRIGRA
FT                   VARRARAFGMRILYYSRRRDPAAEAELGVEYRDLDDLLAEADVVSLHVPLNAETRHLID
FT                   GRRLRRMKPGAILVNTARGDVVDEQALVEALRSGHLGAAGLDVYGREPVPPDHPLLQVP
FT                   NVVALPHIGSATARTRWRMARLAAENCAAVLQGRRPPHPVREML"
FT   gene            complement(268611..268997)
FT                   /locus_tag="Tmar_0228"
FT   CDS_pept        complement(268611..268997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0228"
FT                   /product="death-on-curing family protein"
FT                   /note="COGs: COG3654 Prophage maintenance system killer
FT                   protein; InterPro IPR003812: IPR006440; KEGG:
FT                   hna:Hneap_1982 death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; SPTR:
FT                   Death-on-curing family protein; TIGRFAM: death-on-curing
FT                   family protein; PFAM: Fic/DOC family; TIGRFAM:
FT                   death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50353"
FT                   /db_xref="GOA:E6SM23"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM23"
FT                   /protein_id="ADU50353.1"
FT                   /translation="MNLTPAQILYLHELALEFGGGTPGILDPGRIEAAIARALQTAAGQ
FT                   PAYPSPFQRAAACAHSLARSHPFADANKRTAFLVLGLWLAAEGYLLDPPPHEAVQAMER
FT                   VATGRWNEHELAHWAERWARRRPS"
FT   gene            complement(268994..269236)
FT                   /locus_tag="Tmar_0229"
FT   CDS_pept        complement(268994..269236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0229"
FT                   /product="SpoVT/AbrB domain-containing protein"
FT                   /note="InterPro IPR007159; KEGG: geo:Geob_2522
FT                   transcriptional regulator/antitoxin, MazE; PFAM: SpoVT/AbrB
FT                   domain-containing protein; SPTR: Transcriptional
FT                   regulator/antitoxin, MazE; PFAM: SpoVT / AbrB like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50354"
FT                   /db_xref="GOA:E6SM24"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM24"
FT                   /protein_id="ADU50354.1"
FT                   /translation="MSVRRILRIGRSLGVTLPAQEVRELGLEEGTPVEVQVDRVHQRVI
FT                   IRPLGPAGTVDPAFIEEARRFAERHRSTLEELARR"
FT   gene            269473..269751
FT                   /locus_tag="Tmar_0230"
FT   CDS_pept        269473..269751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA2917 phosphatidate
FT                   cytidylyltransferase; SPTR: Phosphatidate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50355"
FT                   /db_xref="GOA:E6SM25"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM25"
FT                   /protein_id="ADU50355.1"
FT                   /translation="MGGVLDVLILIGKVLISIAAIALGISWGVRGQMRTALAVCAVLLA
FT                   MGIFWTNLAGLLIPTILLAYMAGVLMERGWHRAGRQREENGGHATGG"
FT   sig_peptide     269473..269586
FT                   /locus_tag="Tmar_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            270298..271386
FT                   /locus_tag="Tmar_0231"
FT   CDS_pept        270298..271386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0231"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1660 P-loop-containing kinase; InterPro
FT                   IPR005337; KEGG: bts:Btus_2152 hypothetical protein; SPTR:
FT                   UPF0042 nucleotide-binding protein Btus_2152; PFAM: P-loop
FT                   ATPase protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50356"
FT                   /db_xref="GOA:E6SM26"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM26"
FT                   /protein_id="ADU50356.1"
FT                   /translation="MEGTEAGPPVAGAAGTDGDPGRPAASGGPHGDLPAAGTGAAVPAG
FT                   ASCGEGLGAGHEGGHHRPAGERDLQLVVVTGLSGAGKTQAIHALEDLGFFCVDNLPPAL
FT                   LAPFAALCRQADSPVRRVAVVMDVRGGDWFDQAVEALQDLDRAGVFYRIVFLEASEETL
FT                   VKRFKETRRRHPLAPQGRLLEGIRAERQRLGALRGRAHVILDTSELSPRQLRERIAQLW
FT                   GGPETPRLIAHLVSFGFRYGLPADADLVFDVRFLPNPHYVPDLQPLTGTDDRVREYVLR
FT                   WPSARRLLDKLQDLLDFLLPQYINEGKTQLTVAVGCTGGQHRSVVITEALAAHLRNQGH
FT                   RVLVEHRDVERSVAERARGKRG"
FT   gene            271390..272778
FT                   /locus_tag="Tmar_0232"
FT   CDS_pept        271390..272778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0232"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="COGs: COG0391 conserved hypothetical protein;
FT                   InterPro IPR002882: IPR010119; KEGG: sth:STH187
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   UPF0052 and CofD; SPTR: Putative uncharacterized protein;
FT                   PFAM: Uncharacterised protein family UPF0052; TIGRFAM:
FT                   conserved hypothetical protein, cofD-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50357"
FT                   /db_xref="GOA:E6SM27"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM27"
FT                   /protein_id="ADU50357.1"
FT                   /translation="MKLADWLLPGLRIKRWLVVFAAGLYLVALGGAMAAGADLWAAAAG
FT                   WLRRPWLAVTGRFVPEPWPGVAVMALGGFLALGATYRLLRVVAELLTPAGGSNGGAVDR
FT                   LVLRRRLDRGPRVVAIGGGTGLSVLLRGLKEYTGNVTAVVTVTDDGGSSGRLRGELGIL
FT                   PPGDIRNCLVALADAEPLMARLFQHRFTQGTLAGHSLGNLVIGALAELLGDFEQAVYES
FT                   SKVLAVRGRVLPSTLTPVTLVARMADGRVVRGETAIASDAAPIERIWLDPPGVEPPPAA
FT                   IEAIEAADLIVLGPGSLYTSILPNLLIPGICDAVRRSRAVKVLVVNAMTQPGETTGYTA
FT                   ADHARALIDAVGPGVFHHVLVNVQQPPAALLQRYRQQGQEPVRLDRERLRQMGLQVHTA
FT                   RLLAGDDFVRHDPQRLARALLRVLLAARPRVNPRRRLDFFLLGERLWREEAGSAEPARA
FT                   ARDA"
FT   sig_peptide     271390..271497
FT                   /locus_tag="Tmar_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            272962..274110
FT                   /locus_tag="Tmar_0233"
FT   CDS_pept        272962..274110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0233"
FT                   /product="protein of unknown function DUF199"
FT                   /note="COGs: COG1481 conserved hypothetical protein;
FT                   InterPro IPR003802; KEGG: hmo:HM1_1308 hypothetical
FT                   protein; PFAM: protein of unknown function DUF199; SPTR:
FT                   Putative sporulation transcription regulator whiA; PFAM:
FT                   Sporulation Regulator WhiA N terminal; Sporulation
FT                   Regulator WhiA C terminal domain; TIGRFAM: conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50358"
FT                   /db_xref="GOA:E6SM28"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM28"
FT                   /protein_id="ADU50358.1"
FT                   /translation="MIRDTFSGQVKDELARLWPADAGALAWELAGLCLGCGSPRPGGGW
FT                   RWRTESAATARLLVRLVRARYGVVPRLVVDRRGRLGRGNVYELWLDALPDSLDEPGPAA
FT                   GAAGESLAAGGSGGLGSTPATGPGGAGPGEDRRPSAHGETAHDEAGRGGRPPRAADRDA
FT                   AAAGRNAARAGSSYHVLPGLPDPAAGQRPLRRRDREAFLRGLFLGSGSVTGPGHGYHAE
FT                   LVLPETAAAARVARELRRWGLRPGRARRRGRIGVYLKEADQIAEFLGRLGAHQAVLALE
FT                   NHRVVKGVRNRVNRLVNAETANLRKAVDAGLRQVEAIRRLVEAVGWDGLPPSLREVARM
FT                   RLEHPSASLRDLGQMLDPPLSKSAVGHRIRRLQALAARHGER"
FT   gene            274193..275188
FT                   /locus_tag="Tmar_0234"
FT   CDS_pept        274193..275188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0234"
FT                   /product="Polyprenyl synthetase"
FT                   /note="COGs: COG0142 Geranylgeranyl pyrophosphate synthase;
FT                   InterPro IPR000092; KEGG: sth:STH190 polyprenyl synthetase;
FT                   PFAM: Polyprenyl synthetase; SPTR: Polyprenyl synthetase;
FT                   PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50359"
FT                   /db_xref="GOA:E6SM29"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM29"
FT                   /protein_id="ADU50359.1"
FT                   /translation="MAGEGQTSVTVSAGAVFEPIRDDLAGVEVAIRRALDGPDPHIVEL
FT                   ATYLQRGGGKRLRPALLLLTARNFHYDRERLLPVAAAVELIHMATLVHDDIVDGATSRR
FT                   GLPTVNVRWGTGTAVLTGDFLFARAFSLLAADGDNRVVRVMAEAVYEMSTGEIEQQAQL
FT                   FDPAAGEEGYYRRIYKKTAHFISHCCLMGGLMGGAPERQVEALRRYGYGIGMGFQVIDD
FT                   ILDLTGNPEQLGKPRGTDLRSGVLTLPVLFALAKDPQPWLLERLAARQVDDATVERVTE
FT                   WVEAVGGIAYARRRAEQFISDALEALDELAEAPMAPHLRALARFILERNN"
FT   gene            275202..276149
FT                   /locus_tag="Tmar_0235"
FT   CDS_pept        275202..276149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0235"
FT                   /product="CoA-binding domain protein"
FT                   /note="COGs: COG2344 AT-rich DNA-binding protein; InterPro
FT                   IPR009718: IPR003781; KEGG: sth:STH191 redox-sensing
FT                   transcriptional repressor REX; PFAM: CoA-binding domain
FT                   protein; Rex DNA-binding domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: CoA binding domain; Putative
FT                   DNA-binding protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50360"
FT                   /db_xref="GOA:E6SM30"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM30"
FT                   /protein_id="ADU50360.1"
FT                   /translation="MAARAEKQRQSRPAGPAPQPGQGAAPDPGRAAGFAGSVDGGGAGM
FT                   PGTAGDPGEAGPAARPAADDPGAAGGGPHGDAGETPARASGPGAAGTPGGDAGSPAGPP
FT                   EPARVPDVAIRRLPVYLRALEELRAEDHEIVSSADLAARTGYSSEQIRKDLAYFGAFGT
FT                   RGVGYRIDVLVDRLRHILGLDREVPIALVGAGHLGTALARYNRTRHRDVRIVAIFDSDP
FT                   RRIGDEIEGLAIQPADAMEATIRQAGIKLAVIAVPAAAAQQVARRLVAAGVEAILNFAP
FT                   VTLQVPPGVVVQNIDLTLELQSLAYYIRPEPATG"
FT   gene            276344..277168
FT                   /locus_tag="Tmar_0236"
FT   CDS_pept        276344..277168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0236"
FT                   /product="protein of unknown function DUF147"
FT                   /note="COGs: COG1624 conserved hypothetical protein;
FT                   InterPro IPR003390: IPR014046; KEGG: mta:Moth_2248
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF147; SPTR: Putative uncharacterized protein; PFAM: DisA
FT                   bacterial checkpoint controller nucleotide-binding;
FT                   TIGRFAM: conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50361"
FT                   /db_xref="GOA:E6SM31"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM31"
FT                   /protein_id="ADU50361.1"
FT                   /translation="MPLPAFLFTMTWVDWLISLVDIALVAYLFYRFFLLIRGTRAVPIL
FT                   SGILVLVVFTSVSGWLRLDTIHWLLRQAQLALIVALPIVFQPELRRALEQLGRGRFFAR
FT                   PLFALPQQDVARMIDEVVRAVEQLSRNKVGAIIVIERETGLNEIIETGIIIDGIVSAPF
FT                   LVNVFIPNTPLHDGAVIIRGNRVMAAGTFLPLTEEAGPGPELGSRHRAALGISEHSDAV
FT                   AVVVSEETGRVSLAQGGKLIRNLDDTTLKELLMSLLAAEETPALLPWMRGSS"
FT   sig_peptide     276344..276466
FT                   /locus_tag="Tmar_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            277168..278217
FT                   /locus_tag="Tmar_0237"
FT   CDS_pept        277168..278217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0237"
FT                   /product="YbbR family protein"
FT                   /note="COGs: COG4856 conserved hypothetical protein;
FT                   InterPro IPR012505; KEGG: mta:Moth_2247 YbbR-like; PFAM:
FT                   YbbR family protein; SPTR: YbbR family protein; PFAM:
FT                   YbbR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50362"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM32"
FT                   /protein_id="ADU50362.1"
FT                   /translation="MERLFENENRLKILSVILAIILWFGVMSSQNPDQARTVYDVEVVP
FT                   EGLDPGLAVLSLEPHAVDVTFGGPPEFLQDLAPRDARVTVDVSGVGPGETRRPVTVIPA
FT                   RGRLRVVRVSPQYVTVRLEPRMEKTVPVELQLNGEPSPDYMIENPTVSVEQVTVSGARS
FT                   LVEQVARVVASVAVSGIQSTIAHSVTLVPVDASGRPVEAAYPQALVLEPPTAQVTVPVV
FT                   FMPRKTVPVQARLEGAPAQGFEIGNIAIEPAEVTVRAREERILQELDFLQTEPVDISGL
FT                   DRTVTREVALAPPEGVVVVGGPPAVRVTIEIRPVKEAPGAGGGAGTGTGTGAAGDGQAA
FT                   GGGAGSGGS"
FT   sig_peptide     277168..277272
FT                   /locus_tag="Tmar_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            278256..279722
FT                   /locus_tag="Tmar_0238"
FT   CDS_pept        278256..279722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0238"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterPro
FT                   IPR005844: IPR005845: IPR005846: IPR005843: IPR 006352:
FT                   IPR005841; KEGG: mta:Moth_2246 phosphoglucosamine mutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphoglucosamine mutase; TIGRFAM: phosphoglucosamine
FT                   mutase; PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50363"
FT                   /db_xref="GOA:E6SM33"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM33"
FT                   /protein_id="ADU50363.1"
FT                   /translation="MARLFGTDGVRGVANTELTAELALALGRAAARVLAGRWGDPPRVV
FT                   VGRDTRASGEMLEAALAAGLMSAGATVIPLGVMTTPGVSYLTGALHATGGAVISASHNP
FT                   PEYNGIKFFDPQGRKLPDELEEAVEELVLDGRGEGSPAAGGGPGAASGSGTGDGAAVAA
FT                   GRGGGAPAGAAGFVPPVGGGVGRWQAVPDAGERYLEHLRRVAGPGLEGLRVVLDCAHGA
FT                   ATPWAPAAWRAVGARVTVIHDAPDGTNINVGCGSTAPQSLAEAVRREGADLGLAFDGDA
FT                   DRVIAVDEQGRVVDGDAILAVLALDMARRGDLPGGTVVATVMSNLGLERALKAAGLRLV
FT                   RTRVGDRHVCEAMEEGGYVLGGEQSGHIILRRHAVTGDGILTGLALASVMVRTGQPLSR
FT                   LAAVVQPVPQVLINVPVARRDGWEEEPGIQAAIAAARQRLGEGGRILVRPSGTEPLIRV
FT                   MVEGDDEALVRELAESVAGAIRRALGRGTD"
FT   gene            280672..282501
FT                   /locus_tag="Tmar_0239"
FT   CDS_pept        280672..282501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0239"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR000583: IPR001347: IPR005855:
FT                   IPR017932; KEGG: sth:STH196
FT                   glucosamine--fructose-6-phosphate aminotransferase; PFAM:
FT                   sugar isomerase (SIS); glutamine amidotransferase class-II;
FT                   SPTR: Glucosamine--fructose-6-phosphate aminotransferase
FT                   [isomerizing]; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: SIS domain; Glutamine
FT                   amidotransferases class-II; TIGRFAM:
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50364"
FT                   /db_xref="GOA:E6SM34"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM34"
FT                   /protein_id="ADU50364.1"
FT                   /translation="MCGIVGYVGPKQAVPILIGGLRALEYRGYDSAGIAVSYNGTVDVR
FT                   KRVGRIDGLEQLLAQRPLRGTAGIGHTRWATHGRPSDANAHPHTDCTGTFVVVHNGIIE
FT                   NYAELRDELAGRGHRFASETDTEVVAHLLEDLYDGDLVRTVRRAAARLQGAYALAVLTR
FT                   REPGKIVAVKQASPLIVGLGQGENFLASDIPALLPHTRRVIPLDEGEMAVLTRDGVQLM
FT                   RLDGTPVEREPMTVTWDPGQAERGGYPHFMLKEIHEQPRAVRDTLSGRIHRSGEGVVLD
FT                   AVRFDPEWVRQLRAVYLVACGTAYHAGLIGGRLIERLAGIPAWTEIASEFRYREPLVDE
FT                   RTLFVAISQSGETADTLAAMREAKRRGARVLAITNVVGSSVAREADDVVYTWAGPEIAV
FT                   ASTKAYTTQIVALTLLAVHLAERTGFTGPLGRKNLLESLRQLPDAVEAALQVEEEVKQI
FT                   GELAGGWSDAFFIGRGLDYFTALEGQLKLKEISYIHAEAYAAGELKHGTLALIEQDTPV
FT                   IALATQPALREKMISNIEEVRARGATVFAVIRRDLTGVERYARHTVKLPVVHPLLMPVV
FT                   AAVPLQLLAYYAAVAKGTDVDKPRNLAKSVTVE"
FT   gene            complement(282868..284220)
FT                   /locus_tag="Tmar_0240"
FT   CDS_pept        complement(282868..284220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0240"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="COGs: COG2059 Chromate transport protein ChrA;
FT                   InterPro IPR003370: IPR014047; KEGG: sti:Sthe_2037 chromate
FT                   transporter, chromate ion transporter (CHR) family; PFAM:
FT                   Chromate transporter; SPTR: Chromate transporter, chromate
FT                   ion transporter (CHR) family; TIGRFAM: chromate
FT                   transporter, chromate ion transporter (CHR) family; PFAM:
FT                   Chromate transporter; TIGRFAM: chromate transporter,
FT                   chromate ion transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50365"
FT                   /db_xref="GOA:E6SM35"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM35"
FT                   /protein_id="ADU50365.1"
FT                   /translation="MHRSTLGEVVAVFFRLGVLAFGGPAAHIAMMQDELVRRRRWLDEQ
FT                   RFLDLLSITHLIPGPNSTELAMHLGMERAGWRGWLAAGACFILPAALMVGVLAHLYAVY
FT                   GRAPVAVRFLEGVLPVVLAIVVQALWGLGRTVFRAPEPGAAEGTGRPRPAAALAARAGL
FT                   AVTALALYWAGVHELLLLLAAAVAWGGAAAVARRRRRGLSAMAMVAGALGTAGLAGAGV
FT                   TRLAEAAGAAGSAGSARFPGAAAAGGSLDAASLAAAAGATGSGSLAVLAAAAPAVPFSL
FT                   STLFLTFLKIGSVLYGSGYVLLAFLRRDFVERLGWLTDRQLLDAIAVGQFTPGPVFTTA
FT                   TFVGYLTGGWAGAAVATAGIFLPSFVFVAAIRPLADRLRRSPVLAAALDGLNVASLALM
FT                   AGVTWQLARTAVFNLWTAGLFAAALVILGRTRLNSAWLIAAGAVIGLLMPR"
FT   sig_peptide     complement(284137..284220)
FT                   /locus_tag="Tmar_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            284846..285718
FT                   /locus_tag="Tmar_0241"
FT   CDS_pept        284846..285718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0241"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524: IPR011663; KEGG: sgr:SGR_144 GntR family
FT                   transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain-containing protein; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; SPTR:
FT                   Putative GntR-family transcriptional regulator; PFAM:
FT                   Bacterial regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50366"
FT                   /db_xref="GOA:E6SM36"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM36"
FT                   /protein_id="ADU50366.1"
FT                   /translation="MEGPQLDRTSPVPLYLQIKEWMLDQIRSGRWPQRFKLPAEEDLAG
FT                   AIGVSRGTLRKAIAALVSEGVLDQIHGKGTFVTAGGIEQPLAQRLSAFSELLEERGITY
FT                   STRVLEQALEEPASRVASLLRLEPGQRVVHLARIRLVESCPVAYMENYVPAHLAPGLER
FT                   ADFTRNGLFRTLEQEYGLRLAWGQRTFEALGAEGDVARYLDLPPGAPVFYIQQVVYLDD
FT                   GRPVEFSDVWLRGDRFRLSAVIRRSREGRGREGAGALRGPRVGPPVPGPGDAVPGGGWS
FT                   GPGAAKLSF"
FT   gene            285759..286703
FT                   /locus_tag="Tmar_0242"
FT   CDS_pept        285759..286703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0242"
FT                   /product="ribokinase"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611: IPR011877: IPR002139; KEGG:
FT                   rxy:Rxyl_1888 PfkB; PFAM: PfkB domain protein; SPTR: PfkB;
FT                   TIGRFAM: ribokinase; PFAM: pfkB family carbohydrate kinase;
FT                   TIGRFAM: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50367"
FT                   /db_xref="GOA:E6SM37"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM37"
FT                   /protein_id="ADU50367.1"
FT                   /translation="MSGHAEPRRPVVTVVGSFAVGLTLRADRFPVAGETVVGRDFDRGP
FT                   GGKGSNQAVQAARLGADVEFVGLVGDDDLAAMAWELYRREGVGTRYLGVVPGRNTGVGF
FT                   IVLNAQGENFIVLDPGANGCLGPAHVERARERLAQSHVVLTQLEIPVEAAVHALRLARD
FT                   AGVTAILNPAPARPLPLEHLALADVITPNETELRILLGLPPDDPADSLDLCHRLLAAGV
FT                   RTVVLTRGARGVLVVEPGGVVEIPAFPVAVVDTTGAGDAFSATFAVSLAEGRPLAEAAR
FT                   RAAAAGALACTALGVIPALPRRDQLDALLAARA"
FT   sig_peptide     285759..285836
FT                   /locus_tag="Tmar_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            286728..287681
FT                   /locus_tag="Tmar_0243"
FT   CDS_pept        286728..287681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0243"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="COGs: COG1957 Inosine-uridine nucleoside
FT                   N-ribohydrolase; InterPro IPR001910; KEGG: rxy:Rxyl_1896
FT                   inosine/uridine-preferring nucleoside hydrolase; PFAM:
FT                   Inosine/uridine-preferring nucleoside hydrolase; SPTR:
FT                   Inosine/uridine-preferring nucleoside hydrolase; PFAM:
FT                   Inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50368"
FT                   /db_xref="GOA:E6SM38"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM38"
FT                   /protein_id="ADU50368.1"
FT                   /translation="MPVRLIIDTDTAGDDVNSLLIALLHPEIQLEAVTISVGNVGFEQQ
FT                   IENALYTIEMAGRSGQVPVYPGCATPLLSEWVAADYVHGRDGMGDSFFPKARQRPEPKH
FT                   AVDALIERIHAAPGELTILAQAPLTNIAAAVIRDPSIAAKVKTLYIMGGTYFAPGNITP
FT                   AAEYNFYVDPEAARIVFRAGFDIRLVDWGLCVRDTVLDDADLDDIRRLDTELARFYLQV
FT                   NRVVRRFNETVGIRGVTHPDSIVAAMIADPAIARGWQPCQVDIETRGELTRGASVITPA
FT                   EYAGVEKRVEKPNAQVCLGADKARFKALLMDILSRR"
FT   gene            287947..288741
FT                   /locus_tag="Tmar_0244"
FT   CDS_pept        287947..288741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0244"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="COGs: COG0274 Deoxyribose-phosphate aldolase;
FT                   InterPro IPR002915: IPR011343; KEGG: nml:Namu_5350
FT                   deoxyribose-phosphate aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Deoxyribose-phosphate aldolase; SPTR:
FT                   Deoxyribose-phosphate aldolase; TIGRFAM:
FT                   deoxyribose-phosphate aldolase; PFAM: DeoC/LacD family
FT                   aldolase; TIGRFAM: deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50369"
FT                   /db_xref="GOA:E6SM39"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM39"
FT                   /protein_id="ADU50369.1"
FT                   /translation="MTSEGYPNGSAGTGTGRSGARLARFIQSTLIASDATEERVVAHCR
FT                   ACLEYGFHAAMVPPLWVPVARRVLAGSPVRVASFVDFPLGCMTTGARVALARELAEAGV
FT                   DEIDVMVPLGLFKSGRLAEFRADLEAVVRAARPAATKAMLELPLLEPGERERMVELALA
FT                   AGFDWLKNASGGAVGVATPDDIRFLRGRAPAGVGVKASGGIKTAAQAWALIDAGAELLG
FT                   TSSAVALVTGEDAQDAAGLAGGDEPAGRSGAAAGDRNPAAPY"
FT   gene            288973..289875
FT                   /locus_tag="Tmar_0245"
FT   CDS_pept        288973..289875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0245"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001018; KEGG: rca:Rcas_3009
FT                   beta-lactamase domain-containing protein; SPTR:
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50370"
FT                   /db_xref="GOA:E6SM40"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM40"
FT                   /protein_id="ADU50370.1"
FT                   /translation="MEPIRLTARVTMLHGAVNSGLVQTGEGVLVIDTGLDRSAANKILR
FT                   AVEELGGPVRAVLNTHAHADHFGGNAQIVRKTGVAVYAPAGEAEVIRQPLYEPVYLFGG
FT                   AAPIAALRHRFLLAEASPVHHEVEPGQRLEWDGVSVEVIDLAGHSLAQVGFLVDGVLFA
FT                   ADSFAGLGPLAKHPIPYLVDAGRMLESLERVREVDAGWFVPGHGPAVRAGAELGEVLEA
FT                   NAAAIRRLLEWAAERLRQGPAGTEDLLAEMGAALGVAMTDPVAYVLNRTALLGVLATLE
FT                   REGAVRAEVRDGRWWWAAV"
FT   gene            complement(290078..291184)
FT                   /locus_tag="Tmar_0246"
FT   CDS_pept        complement(290078..291184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0246"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="COGs: COG2309 Leucyl aminopeptidase (aminopeptidase
FT                   T); InterPro IPR000787; KEGG: rca:Rcas_2712 peptidase M29
FT                   aminopeptidase II; PFAM: peptidase M29 aminopeptidase II;
FT                   SPTR: Peptidase M29 aminopeptidase II; PFAM: Thermophilic
FT                   metalloprotease (M29)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50371"
FT                   /db_xref="GOA:E6SM41"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM41"
FT                   /protein_id="ADU50371.1"
FT                   /translation="MTDPRVRKLAQVLVRYSLGLEAGDHFLIQTTDLATPLVQAIYREA
FT                   LQVGAFPQVLAQLEGLSEIYLKEASEEQLRVLTPLDRVAFEQYQHAMVIHAPHNVKALS
FT                   GVDPRRLAIVHEARRQLADRLMARIGQGGKYCVTLFPTQALAQEAGMSLSDYQEFVFEA
FT                   CRLNDDDPVAAWQEVSHRQQRLVEFLNGVKEMRVVGDGTDLTVSVAGRTWINADGHINF
FT                   PDGEVFTGPVEDSVRGTIRFSFPGIFQGQEIEDIRLRFEDGRVVQAEAARGQALLDALL
FT                   ATDQGARYVGEFAIGTNERITRFSRNLLFDEKIGGTVHLALGASYPITGGRNQSAIHWD
FT                   MICDLRQGGEIYADGELIYRDGKFLIGV"
FT   gene            291459..292070
FT                   /locus_tag="Tmar_0247"
FT   CDS_pept        291459..292070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0247"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: bts:Btus_1400 methyltransferase type 12; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 12;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50372"
FT                   /db_xref="GOA:E6SM42"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM42"
FT                   /protein_id="ADU50372.1"
FT                   /translation="MHGHPHQVPWEAAVSWAEIFEHQKRRQPLVEEWLGWLELGPGDHL
FT                   ADLGTGPGLTSLMAANRVQPHGRVYAVDHWPEALDFLRRQAAAAGVDNIDLIQADLGHD
FT                   DLSGVVPAGRVRKAMLTHVLHHVPAPQSVLQRVHAWLGPGARMVVAEFDPGGPGRVGPP
FT                   PEERIREAELAQWLSDAGFHIVRRKTYPEQEQYALLVERR"
FT   gene            complement(292217..292867)
FT                   /locus_tag="Tmar_0248"
FT   CDS_pept        complement(292217..292867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:292433..292435,aa:Sec)
FT                   /locus_tag="Tmar_0248"
FT                   /product="glutaredoxin-like domain protein"
FT                   /note="COGs: COG3634 Alkyl hydroperoxide reductase large
FT                   subunit; InterPro IPR011903; KEGG: dtu:Dtur_0759
FT                   glutaredoxin-like domain protein; SPTR: Glutaredoxin-like
FT                   domain protein; TIGRFAM: glutaredoxin-like domain protein;
FT                   manually curated; PFAM: Glutaredoxin; TIGRFAM:
FT                   Glutaredoxin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50373"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM43"
FT                   /protein_id="ADU50373.1"
FT                   /translation="MQLSEQDRREIRRRFEALESPVVLKLFVRGDKDECPYCEDTRQLL
FT                   EAVAELDDRVTVEVHDLDLEPEVADRYGVDMAPAIVFARADGSDTGVRFYGIPAGYEFG
FT                   TLIDDIVDVSRGTGELSPETEAYLKSLDTDVHLQVFVTPTUPYCPRAVRLAHKMALASD
FT                   RVRADAIEAMEFPELANRFAVFGVPKTVVNGSAAVEGAVPEPHLLAVIQRALD"
FT   gene            complement(292899..293300)
FT                   /locus_tag="Tmar_0249"
FT   CDS_pept        complement(292899..293300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0249"
FT                   /product="protein of unknown function DUF302"
FT                   /note="COGs: COG3439 conserved hypothetical protein;
FT                   InterPro IPR005180: IPR016796; KEGG: sth:STH405
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF302; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50374"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM44"
FT                   /protein_id="ADU50374.1"
FT                   /translation="MAELDYTVATDKPVDEAIQALQSALAERKFSALWHLHVNEKLREK
FT                   GFHLEPDFHIFEVCNPAKAKQALETDQKVGYLLPCKIVVYSDRNDGNRTKIGLLRPQTL
FT                   IGLLDDERFRDLANEVEQELRAVVDAAAR"
FT   gene            complement(293448..293813)
FT                   /locus_tag="Tmar_0250"
FT   CDS_pept        complement(293448..293813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0250"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: sth:STH410 transcription
FT                   regulator ArsR; PFAM: regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR; SPTR: ArsR family transcriptional
FT                   regulator; PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50375"
FT                   /db_xref="GOA:E6SM45"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM45"
FT                   /protein_id="ADU50375.1"
FT                   /translation="MTAERTDTEKQLLELQARLCHVLASPKRLEILYTLAGGEMTAGEL
FT                   ARVVDTTTANLSQHLALMRQYGLVESRKEGLNVYYRLASREILEACQAVRQVLLEHLRR
FT                   NARLAAEGGAEPPSGQE"
FT   gene            294172..294513
FT                   /locus_tag="Tmar_0251"
FT   CDS_pept        294172..294513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0251"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763: IPR001307; KEGG: sth:STH355
FT                   hypothetical protein; PFAM: Rhodanese domain protein;
FT                   SMART: Rhodanese domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50376"
FT                   /db_xref="GOA:E6SM46"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM46"
FT                   /protein_id="ADU50376.1"
FT                   /translation="MAMRASLPDTVTPEELRRRLEAGNAPLIIDVREPDEYAGGHIPGA
FT                   RLLPLGQVPMRYRELPADQEIVLVCRSGNRSGLAQEWLQAMGFRNVRNLVGGMRRWNGP
FT                   VEYGAGQRR"
FT   gene            294528..295739
FT                   /locus_tag="Tmar_0252"
FT   CDS_pept        294528..295739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0252"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001763; KEGG: hha:Hhal_1932
FT                   beta-lactamase domain-containing protein; SMART: Rhodanese
FT                   domain protein; SPTR: Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily; Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50377"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM47"
FT                   /protein_id="ADU50377.1"
FT                   /translation="MDARTRTPWEIDAGELKRMLDRGETPFLIDVRNDEEFRRWRIEGR
FT                   QPLPVIHVPYYEILAEAEEDDVTASAKAYARRYWVDHLPREGRIVVVCAHGGTSRYVAQ
FT                   GLRELGYDAFSLRGGMIAWGDHYEFVPVVEEEGLAVYQINRPARGCLSYLVASEGEAVI
FT                   IDPLRHAERYLEFSRRHGLAITRVLDTHAHADHISSGTELAEKLGVPYHLHPYDAIHPM
FT                   DVLPATFRYQPVYDGQEVRVGRATLRAIHVPGHTLGQVVYLLDDRYLFSGDTIFVESIA
FT                   RPDLGGRAETWTPLYYRSLLRLMELPDSTLVLPGHFSRPQEADARGLVAGTLGDLKQSN
FT                   EGLQALAAGERAFVDFIMARLPEFPQHYVDIKRVNTGLLRPSEEQASELELGRNVCALA
FT                   EEAA"
FT   gene            295755..296363
FT                   /locus_tag="Tmar_0253"
FT   CDS_pept        295755..296363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0253"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763: IPR001455: IPR001307; KEGG:
FT                   aac:Aaci_2642 SirA family protein; PFAM: Rhodanese domain
FT                   protein; SirA-like domain-containing protein; SMART:
FT                   Rhodanese domain protein; SPTR: SirA family protein; PFAM:
FT                   SirA-like protein; Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50378"
FT                   /db_xref="GOA:E6SM48"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM48"
FT                   /protein_id="ADU50378.1"
FT                   /translation="MNATFKPSATVDARGLSCPLPIVRTRKAIDALQVGEILEVLATDR
FT                   GAPADFRGWCEQTEHKFLGVVEDDGFLRLYVKKLVPETREKGQLFDREMSNEELARRLE
FT                   AGDPLVVLDVREPEEYEAGHIPGAVSVPIESVSEFAAQLERSAEIAVVCRSGRRSAYAC
FT                   RILEQAGFEKVVNVVPGMSAWSGPVERGGAGDAPAPASR"
FT   gene            296439..296837
FT                   /locus_tag="Tmar_0254"
FT   CDS_pept        296439..296837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0254"
FT                   /product="DsrE family protein"
FT                   /note="COGs: COG2210 conserved hypothetical protein;
FT                   InterPro IPR003787; KEGG: gct:GC56T3_1441 DsrE family
FT                   protein; PFAM: DsrE family protein; SPTR: Hypothetical
FT                   conserved protein; PFAM: DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50379"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM49"
FT                   /protein_id="ADU50379.1"
FT                   /translation="MSVRRVAIIASHGNIDDAYKVLNIATAAAAMGAEVQVFFTFDGLK
FT                   IIHKEANRQLPVPEHLQPALEGFKKNNVPSVPELLEIARESGVKLIGCQMTMDVMGIGL
FT                   DELVDGVEPGGAAAFLAFAAEADVNVTF"
FT   sig_peptide     296439..296525
FT                   /locus_tag="Tmar_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            296953..297726
FT                   /locus_tag="Tmar_0255"
FT   CDS_pept        296953..297726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0255"
FT                   /product="protein of unknown function DUF81"
FT                   /note="COGs: COG0730 permease; InterPro IPR002781; KEGG:
FT                   cph:Cpha266_2123 hypothetical protein; PFAM: protein of
FT                   unknown function DUF81; SPTR: Putative uncharacterized
FT                   protein; PFAM: Sulfite exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50380"
FT                   /db_xref="GOA:E6SM50"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM50"
FT                   /protein_id="ADU50380.1"
FT                   /translation="MSALLFLIGLAGGFFSGLLGLGGAILMVPLLLFVPPLFGFPALDM
FT                   KQVAAITIVQVFFAALSGMLVHWRNRFVHKDLVLTMGGASALAALAGGLLSDLVNARAL
FT                   LLLFASIATVAGVLMFLPRREDDPDATADSVRFNRPLAVAIALAVGLVGGLVGAPGAFI
FT                   YVPLMMYVLKIPTRVTLGSTLAIVLFTATFGMVGKVATGQVDWPLALALVLGSVPGAQA
FT                   GGYLSKRVRAGALRWMVAAVVWASVLQMWRHALSG"
FT   sig_peptide     296953..297102
FT                   /locus_tag="Tmar_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            298105..298284
FT                   /locus_tag="Tmar_0256"
FT   CDS_pept        298105..298284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: min:Minf_1054 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50381"
FT                   /db_xref="GOA:E6SM51"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM51"
FT                   /protein_id="ADU50381.1"
FT                   /translation="MATNLRRVAEQDGLQQVAPVEEGVRDVEAPKGTLLVVFLYLLGIA
FT                   AMWSYVYFRLLRSA"
FT   gene            298335..298832
FT                   /locus_tag="Tmar_0257"
FT   CDS_pept        298335..298832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0257"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="COGs: COG1622 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 2; InterPro IPR002429: IPR001505; KEGG:
FT                   rmr:Rmar_1565 cytochrome c oxidase subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; SPTR: Cytochrome c oxidase
FT                   subunit II; PFAM: Cytochrome C oxidase subunit II,
FT                   periplasmic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50382"
FT                   /db_xref="GOA:E6SM52"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM52"
FT                   /protein_id="ADU50382.1"
FT                   /translation="MHVDRYEKMWIWVSAAFLLALVLVLAYTTCGMGIHLPGSGDAHAA
FT                   GVDHGTAAPAHVTANDPPFTAPGVRAVGPNRYEVVMTAQVFGFEPNEIRIPRGATVDFV
FT                   VTSKDVIHGFMIPGTTVNTMIIPGQVTHVQYTFDKPGEYTFFCHEYCGIGHHVMSGRIV
FT                   VE"
FT   sig_peptide     298335..298466
FT                   /locus_tag="Tmar_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            298861..300513
FT                   /locus_tag="Tmar_0258"
FT   CDS_pept        298861..300513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0258"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="COGs: COG0843 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 1; InterPro IPR000883: IPR022272:
FT                   IPR005829; KEGG: sti:Sthe_2053 cytochrome c oxidase subunit
FT                   I; PFAM: cytochrome c oxidase subunit I; SPTR: Cytochrome c
FT                   oxidase subunit I; PFAM: Cytochrome C and Quinol oxidase
FT                   polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50383"
FT                   /db_xref="GOA:E6SM53"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM53"
FT                   /protein_id="ADU50383.1"
FT                   /translation="MGSGGIPLEFREDYADARKHLLTAIFFGLVLGVLMGPLQALDKAR
FT                   IDLYQNLPLIKSYYQGLTLHGVALALIWTSFFNVGFLTFAAVRGFGRPLQSRRLSRATL
FT                   WIMWTGLALALFAILTNRATVLFTAYAPLKGHWTFYTGVALFAVVGTWLLAANVFLTYR
FT                   AWKRDNPGRKTPLLAFGTLVTLTMWTLATSGVAAEFVIYLIPWSLGLRQGVDPLLTRSL
FT                   FWLTGHPIVYWWLLPAYLSWYFMLPRQAGGKLFSESMARLALLLFIPFSLPIGAHHMYT
FT                   DPGVATPSKMLHGFLTFVVFLPSLITAFTVVASLEIAGRRRGGRGWLGWIRALPWREPS
FT                   VAAQLLAMVLFTVGGASGLINASYVLNLLVHNTLFVVGHFHLTVGSAVTLTFMGISYWL
FT                   IPELTGRALRGQRVALAQVWLWFLGMAIMGRGMAVMGLEGVPRRTWWSQAAYQIAQAQA
FT                   GGVMTAVGGVLLFVSMLLFVGVIVATMRGAEAPVRQEVPVAEPLDGGMPVPVWLNRLTP
FT                   WVVGTVVLTLLAWGPVVWGLLQSPFSAHGLRTW"
FT   sig_peptide     298861..298980
FT                   /locus_tag="Tmar_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            300793..301191
FT                   /locus_tag="Tmar_0259"
FT   CDS_pept        300793..301191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0259"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="COGs: COG0736 Phosphopantetheinyl transferase
FT                   (holo-ACP synthase); InterPro IPR008278: IPR002582:
FT                   IPR004568; KEGG: sth:STH2938 4'-phosphopantetheinyl
FT                   transferase; PFAM: 4'-phosphopantetheinyl transferase;
FT                   SPTR: Holo-[acyl-carrier-protein] synthase; TIGRFAM:
FT                   holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase superfamily; TIGRFAM:
FT                   phosphopantethiene--protein transferase domain;
FT                   holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50384"
FT                   /db_xref="GOA:E6SM54"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM54"
FT                   /protein_id="ADU50384.1"
FT                   /translation="MIVGTGIDIVQVERIEAILRRRGWRWAERVFSPDELAAAGAGPHR
FT                   ARRLAARWAAKEAFAKALGTGLRGLRWRDIRVRQDEGGRPWLEVAGRASALARAAGVRR
FT                   IHLSLSHDGQWAVAQVILEGTGPGEGRP"
FT   gene            301188..303362
FT                   /locus_tag="Tmar_0260"
FT   CDS_pept        301188..303362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0260"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro IPR004443:
FT                   IPR000631; KEGG: pap:PSPA7_5678 hypothetical protein; PFAM:
FT                   YjeF-family domain-containing protein; protein of unknown
FT                   function UPF0031; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: carbohydrate kinase, YjeF related protein; PFAM:
FT                   Carbohydrate kinase; YjeF-related protein N-terminus;
FT                   TIGRFAM: yjeF N-terminal region; yjeF C-terminal region,
FT                   hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50385"
FT                   /db_xref="GOA:E6SM55"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM55"
FT                   /protein_id="ADU50385.1"
FT                   /translation="MTAEEPAGTAGRTIEGTATGVSATPGGASVTEGGAYATPGEPPTT
FT                   PAGAPATGLAPASGTGPGADPGPAGTWVLSAAAVRRGDRLAADAGLGGPVLMETAGRTA
FT                   ATLLWKVAGPFSAREPVVVLAGGGNNGGDGMVLARWVARWAGPAAVKVFLLAEPGRLRG
FT                   EAAVQWSLLARAGVPAIALAGEPAPGAQQGTRQNPGAGAAPVAAEFPEPGAGRQPTAGP
FT                   AGAAGPHPGAGLQPGAGRPAAAGPGSGVGLAVDPFLDHLEAAVARARVVVDALLGVGVR
FT                   GALRPLAARALEVVGAAGVPVFALDLPSGLDADTGEAAPVVPRATWTATFAAAKWGLLL
FT                   GQGPERAGQVFVVDIGWPQAAGAGGTGGEAEAGAPGGTGGFPAARVLDAAGVAALLPRR
FT                   PWDAHKGWAGHVVVAGGRPGQVGAAVLAGTAALQAGAGTVTLAVPAPVRTEAAVHRPEI
FT                   MTWALPATAGGEWDAAAATALAEREGERRGRVVRVIGPGLGQSPGAAACLAQWLGLGDP
FT                   SAAGGPADPGPAGGPPAGAPAFPPTVLDADGLNLAARLGIDRLRERPGPFPLVLTPHPG
FT                   EAARLLGWTTAQVQARRPLAALELARRSGAVAVLKGAGTLIASPAGDLYVCTRGHPGMA
FT                   SAGMGDALAGVAGAMLAQGLEPLAAALAAVFLHALAGELAAPAAGIPVRATELIARLPA
FT                   ALELVRRGLPRGTEALGVPGVAWLRPPLAG"
FT   gene            303616..304800
FT                   /locus_tag="Tmar_0261"
FT   CDS_pept        303616..304800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0261"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COGs: COG0787 Alanine racemase; InterPro IPR001608:
FT                   IPR011079: IPR000821: IPR020622; KEGG: chl:Chy400_1942
FT                   alanine racemase; PFAM: alanine racemase domain protein;
FT                   PRIAM: Alanine racemase; SPTR: Alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: Alanine racemase, C-terminal
FT                   domain; Alanine racemase, N-terminal domain; TIGRFAM:
FT                   alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50386"
FT                   /db_xref="GOA:E6SM56"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM56"
FT                   /protein_id="ADU50386.1"
FT                   /translation="MEGPGRGRPVRPTWVEVDLDAIAHNVQTLQRLAAPAQLMAVVKAD
FT                   GYGHGAVMVARTALAHGARRLAVAVVEEGVHLRQSAIACPILVMGWTPPWQYSLALRYD
FT                   LELAVSSEDEARALAEAARREGRKVRVHLKVDTGMGRLGLRWDHPRLAETAARIAGLGG
FT                   LEVVGVFTHLATADDPEAPLTEDQLARFARIVHALDERGLRPLLRHAANSAALLRLPGA
FT                   RYDLVRPGIALYGLEPFPGAVAAFGLRPALAWKTRVALVKEVPPGTPISYGATFVTRRR
FT                   SRIATLPVGYADGLRRALSNRGQVLVGGRRAPIVGRVCMDQVMVDVTDAGPVAVGDEVV
FT                   LIGRQGDQQITADEMAGWMDTIGYEVVTGIGRRVPRIYLRGGRPVAQAPVSHLL"
FT   gene            304968..305159
FT                   /locus_tag="Tmar_0262"
FT   CDS_pept        304968..305159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg7335 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50387"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM57"
FT                   /protein_id="ADU50387.1"
FT                   /translation="MWSLVAAAMPPAGTEAGTAGTPWTEEWMRRGYQEMGPLNQRLAEE
FT                   WIPGELEPRRWEWGGEGG"
FT   sig_peptide     304968..305015
FT                   /locus_tag="Tmar_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            305161..305511
FT                   /locus_tag="Tmar_0263"
FT   CDS_pept        305161..305511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0263"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="COGs: COG2337 Growth inhibitor; InterPro IPR003477;
FT                   KEGG: chy:CHY_0716 PemK family regulatory protein; PFAM:
FT                   PemK family protein; SPTR: Regulatory protein, PemK family;
FT                   PFAM: PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50388"
FT                   /db_xref="GOA:E6SM58"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM58"
FT                   /protein_id="ADU50388.1"
FT                   /translation="MEVRRGDIFFADLSPVVGSEQGGIRPVLVIQNDVGNRYSPTTIVA
FT                   AITSQINKAKLPTHVELPAGSYGLEKDSVVLLEQIRTIDKRRLLERVARLDAAAMRRVN
FT                   VALEISLGLREV"
FT   gene            305570..306595
FT                   /locus_tag="Tmar_0264"
FT   CDS_pept        305570..306595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0264"
FT                   /product="L-asparaginase II"
FT                   /note="COGs: COG4448 L-asparaginase II; InterPro IPR010349;
FT                   KEGG: ttj:TTHA0067 L-asparaginase II; PFAM: L-asparaginase
FT                   II; SPTR: L-asparaginase II; PFAM: L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50389"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM59"
FT                   /protein_id="ADU50389.1"
FT                   /translation="MNAELLVEVTRGGWVESRHDGHAVVVDKQGQIVAALGDPGHVSFL
FT                   RSSLKPFQALAVVASGAPDAFGFTDAEIALMCGSHAGEPEHVAAATSMLAKLGLGPDHL
FT                   ACGPHPLTSPAARRALAETGMEPTRVHNNCSGKHAGMLALARHRGWPVEGYHRPDHPVQ
FT                   QEVRALVAALTGLSPGGPDWHEAVDGCGVVTFALPLVAVARMFRYLGRPDLLPADLAHL
FT                   APALDRIRRALVAHPTMIRGAGQFDTEVIRATGGAWIGKVGAEGYYAAGLATGHALALK
FT                   IADGQDRARPVAVLALLERFGLLPPGAEALKERWARVPVTNTRGEVVGEIRPAGRLAAG
FT                   L"
FT   gene            306659..307660
FT                   /locus_tag="Tmar_0265"
FT   CDS_pept        306659..307660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0265"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="COGs: COG1573 Uracil-DNA glycosylase; InterPro
FT                   IPR005122: IPR005273; KEGG: sth:STH2917 uracil-DNA
FT                   glycosylase; PFAM: Uracil-DNA glycosylase superfamily;
FT                   SPTR: Uracil-DNA glycosylase; TIGRFAM: phage SPO1 DNA
FT                   polymerase-related protein; PFAM: Uracil DNA glycosylase
FT                   superfamily; TIGRFAM: uracil-DNA glycosylase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50390"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM60"
FT                   /protein_id="ADU50390.1"
FT                   /translation="MARPEAELLRIADMAALEQVVKGCTACRLRAGCRGVVFGDGNPAA
FT                   RLMLIGEGPGADEDRLGRPFVGRAGQLLDRILAACGFDRQRHVYIANVVKCRPPGNRTP
FT                   TPDERAACLPNLRAQMRLVNPVIVVLLGSTALQALIDPAARITRWRGQWIHRDGVWYMP
FT                   TYHPAALLRNPSLKRDCWHDFKKVIDKYRELVDPYHVAPHHPPEAAEEPAGGGAPAAAP
FT                   GGRAVAGEPAAGAGGRGPGAGAAVEARAEAAAAAEPAGVEPAPATPAPVERAAPGAGGP
FT                   GGTGPGEANAAPPGVQLTLFDFDPDGGPVGRRGRHRGRRHAGDLQPWEGGAW"
FT   gene            307654..308247
FT                   /locus_tag="Tmar_0266"
FT   CDS_pept        307654..308247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0266"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="COGs: COG0802 ATPase or kinase; InterPro IPR003442;
FT                   KEGG: hmo:HM1_1717 hypothetical protein; PFAM:
FT                   Uncharacterised protein family UPF0079, ATPase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   P-loop hydrolase UPF0079; TIGRFAM: ATPase, YjeE family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50391"
FT                   /db_xref="GOA:E6SM61"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM61"
FT                   /protein_id="ADU50391.1"
FT                   /translation="MVTVAWTARIPSAEAMERLGERLAAALQPGDWIALTGPLGAGKTT
FT                   LVRGLARGLGFRGRVASPTFTLVHVYRGRLPLYHLDLYRLEGEDALRDVVDPGEMEAAG
FT                   AVVVEWADRAPRWIPADALWLDLAVDPAGDGRRVAARAGGDRARRLAAHLAHRADPAVE
FT                   PAAGAIPAGPGAAGPGSPGGEAGRPATGKDEGRR"
FT   gene            308244..309206
FT                   /locus_tag="Tmar_0267"
FT   CDS_pept        308244..309206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0267"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="COGs: COG1214 Inactive homolog of metal-dependent
FT                   protease putative molecular chaperone; InterPro IPR000905;
FT                   KEGG: rsq:Rsph17025_2280 peptidase M22, glycoprotease;
FT                   PFAM: peptidase M22 glycoprotease; SPTR: Peptidase M22,
FT                   glycoprotease; PFAM: Glycoprotease family; TIGRFAM:
FT                   universal bacterial protein YeaZ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50392"
FT                   /db_xref="GOA:E6SM62"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM62"
FT                   /protein_id="ADU50392.1"
FT                   /translation="MTWILGIDTSGPRCGVALLKDGEPAGAEELAAPGTNRALMPAVDR
FT                   LCRRAGIGPRQLDGIAVALGPGSFTGLRIGLAAAKGLALGLGRPLAGVGTLDAVVFAAA
FT                   GPAGDAATGTAGGGAEGGGAGPWQGWLVARPARRGEFYAAAYDGPGRRLWGPDLVAAAA
FT                   LAEAVRRPGGPVRPPAGEGAGRSAEGAPGDCGPGPALAGRGAAAAAPAAGARAAGASTA
FT                   SSGPGATVGWWAVVVDPQHAAALGLSPEEAGVEGEAAAGQSLHRRGPAVALVPDPGAVP
FT                   VAVARLALPRLAAGGDDPATLAPLYLPAGSTFRPYPGAG"
FT   gene            309268..310023
FT                   /locus_tag="Tmar_0268"
FT   CDS_pept        309268..310023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0268"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="COGs: COG0456 Acetyltransferase; InterPro IPR000182:
FT                   IPR006464; KEGG: aac:Aaci_0371 ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   PRIAM: Ribosomal-protein-alanine N-acetyltransferase; SPTR:
FT                   Ribosomal-protein-alanine acetyltransferase; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   Acetyltransferase (GNAT) family; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50393"
FT                   /db_xref="GOA:E6SM63"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM63"
FT                   /protein_id="ADU50393.1"
FT                   /translation="MALSHDVQSQPGEIRIEPMTPGDLPLVLAIERRSFPTPWSERAFV
FT                   GELRDNLYADYIVARHDGRVVGYAGMWCILDEAHVTTIAVDPDFRGRGVGDRLLTALEE
FT                   RALRYGCRRMTLEVRVSNHVAQRLYRRHGFRPCGIRRGYYVDNGEDAIIMWRDRLDPPG
FT                   PVATEEPGPDGTAAPPAGAGASGGTAGAGALSSAAPAAPAAGGSAPAAGSAAGSSAGAG
FT                   SGTGTAGAGGPAGPAGTETGGVPAGSEAP"
FT   gene            310020..311081
FT                   /locus_tag="Tmar_0269"
FT   CDS_pept        310020..311081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0269"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR000905: IPR017861:
FT                   IPR017860; KEGG: sth:STH2921 O-sialoglycoprotein
FT                   endopeptidase; PFAM: peptidase M22 glycoprotease; PRIAM:
FT                   O-sialoglycoprotein endopeptidase; SPTR: Probable
FT                   O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM:
FT                   Glycoprotease family; TIGRFAM: putative glycoprotease GCP;
FT                   metallohydrolase, glycoprotease/Kae1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50394"
FT                   /db_xref="GOA:E6SM64"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM64"
FT                   /protein_id="ADU50394.1"
FT                   /translation="MSRPHLTLGIETSCDETSFAVVAGGRRILANVVLSQTGEHRRYGG
FT                   VVPELASRRHVTNAVPLLQAALAEAGIGLGDLDLIAVTRGPGLVGALLVGVSLAKALAW
FT                   ALDKPLVGVHHLAGHVYANFLAPPGGDTAPEPRYPAVTLVVSGGHTDLFHLEAGGGLRW
FT                   LGGTRDDAAGEAFDKVARELGLGYPGGPVIDRLAAQGDPGAFAFPRAMLDDDTLDFSFS
FT                   GLKTAVLYELERRGWRDPDRRAELEAHLPDLAASFQQAVVDVLVAKTLRAARQVGARQI
FT                   YLAGGVAANRRLRHDLGVAAAAAGLDLAYPPPVLCTDNGAMIAAAGFAAWQRGRRDGLD
FT                   LDVDPDPPLDEWF"
FT   gene            311142..311942
FT                   /locus_tag="Tmar_0270"
FT   CDS_pept        311142..311942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0270"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451; KEGG: pth:PTH_2726
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Bacterial transferase hexapeptide (three
FT                   repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50395"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E6SM65"
FT                   /protein_id="ADU50395.1"
FT                   /translation="MGAAGDGREHAHPEVGGRPRPGPAPAPAIPGGPGHGRPAHHGAET
FT                   SRERRHDAPHGCRGGASSGWWPLEEPAGSQARAAADGQEAARRPAGSSGETAAGWHAVP
FT                   RQERLQRHPVPPGRNSLHYWRQAKSLPRVAWNFFVISLCRVLPWFGVKNFLYRRLGMKV
FT                   GRDVAFGLMAMVDIFWPELIQVGDNSIIGYNTVLLAHEFLIDEYRTGPVVIGRNVMIGA
FT                   NCTVLPGVVIGDGAVVSAHSLVNADVPPGAVVGGVPARPLGRRP"
FT   gene            312157..313596
FT                   /locus_tag="Tmar_0271"
FT   CDS_pept        312157..313596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0271"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="COGs: COG0773 UDP-N-acetylmuramate-alanine ligase;
FT                   InterPro IPR000713: IPR013221: IPR004101: IPR005758; KEGG:
FT                   sth:STH2918 UDP-N-acetylmuramate-alanine ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; SPTR:
FT                   UDP-N-acetylmuramate--L-alanine ligase; TIGRFAM:
FT                   UDP-N-acetylmuramate/alanine ligase; PFAM: Mur ligase
FT                   family, catalytic domain; Mur ligase family, glutamate
FT                   ligase domain; Mur ligase middle domain; TIGRFAM:
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
FT                   diaminopimelate ligase; UDP-N-acetylmuramate--alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50396"
FT                   /db_xref="GOA:E6SMD6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMD6"
FT                   /protein_id="ADU50396.1"
FT                   /translation="MEEPGYAPPVEWSGKRVHFIGIGGYGMSGLARVLLARGARVSGSD
FT                   VRPSDRTRWLAEQGAAVHIGHAARHVAGADLVVYNTDVPADNVELVAAREAGIPVWHRS
FT                   QVLADLLNHRRSVAVTGTHGKTTTTAMTGLVLVAGGLDPTVLVGGEVPEFGAATARLGE
FT                   GPWVVAEACESDGTFLRYLPEIAVVTNVEPEHLDHYGGDFAQLLQAFARFLRNVRPGGL
FT                   VVACGDHPVLRQLLADRTPAPGVRVVRYGMEAEDSDLRARDVQAGPEGTRFTVWQGGRP
FT                   LGEVRLAVPGLHNVLNALAAVAVGLELRVPFAAAAAALASFHGAKRRFQVIYNRDGILV
FT                   VDDYAHHPTEIRATLRAARQRQGEGGRVIAVFQPQRYSRTRLLMDEFARAFGDADRVIL
FT                   TEIYAPPGERPIPGVSSAVLADRIAREEGRPVELIASREELVEHLLRTVRPGDLVLTMG
FT                   AGDIWTVARDLARRLQAVTPA"
FT   gene            313771..315420
FT                   /locus_tag="Tmar_0272"
FT   CDS_pept        313771..315420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0272"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="COGs: COG0516 IMP dehydrogenase/GMP reductase;
FT                   InterPro IPR000644: IPR001093: IPR005990: IPR018529: IPR
FT                   015875; KEGG: tte:TTE0582 IMP dehydrogenase/GMP reductase;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein; PRIAM: IMP dehydrogenase; SMART: CBS
FT                   domain containing protein; SPTR: Inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain; IMP dehydrogenase / GMP
FT                   reductase domain; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50397"
FT                   /db_xref="GOA:E6SMD7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMD7"
FT                   /protein_id="ADU50397.1"
FT                   /translation="MRADYETAGTAGDGRAGGTGVQAAAGSSAKAATGDARNGIRQDPA
FT                   GPARDGAVWTEAARAGAAGGKIVAEGLTFDDVLIIPAASEVLPRDVDVSTRLTRQLRIR
FT                   IPLVSAAMDTVTEARLAIALAREGGIGIIHKNMPPEQQAAEVDKVKRSEHGVIVDPFYL
FT                   SPQHRVRDALQLMARYHISGVPIVDGDGVLVGIITNRDVRFEENLDRPIAEVMTREGLV
FT                   TAPEGTTLARAKEIMRQHKIEKLPLVDGAGRLRGLITIKDIEKAIRYPNAAKDDKGRLM
FT                   VGAAVGVGPAGLERADALVEAGVDVLVVDSAHGHSRNVLETVRALKRRHPGVPVIAGNV
FT                   VTAEGTRALIEAGADAVKVGVGPGSICTTRVVTGAGYPQLSAILDCSREADKYDVPVIA
FT                   DGGIKYSGDIVKALAAGASSVMIGSLFAGTEEAPGELEIYQGRSFKVYRGMGSLGAMKQ
FT                   GGADRYFQEGEAKFVPEGVEGRVPYRGPLSETVFQLVGGLRAGMGYAGAPDIESLRRNA
FT                   RFVRITAASLVESHPHDVTVTKEPPNYWLGRV"
FT   sig_peptide     313771..313839
FT                   /locus_tag="Tmar_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            315590..317263
FT                   /locus_tag="Tmar_0273"
FT   CDS_pept        315590..317263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0273"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /note="COGs: COG0285 Folylpolyglutamate synthase; InterPro
FT                   IPR013221: IPR004101: IPR001645; KEGG: sth:STH367
FT                   folylpolyglutamate synthase; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; PRIAM: Tetrahydrofolate synthase; SPTR:
FT                   Folylpolyglutamate synthase; TIGRFAM: FolC bifunctional
FT                   protein; PFAM: Mur ligase family, glutamate ligase domain;
FT                   Mur ligase middle domain; TIGRFAM: folylpolyglutamate
FT                   synthase/dihydrofolate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50398"
FT                   /db_xref="GOA:E6SMD8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMD8"
FT                   /protein_id="ADU50398.1"
FT                   /translation="MQQRREGRQDGTRGPAATGLGSAGPAIPETDGGAAGTGGTAGTAA
FT                   RAAGRSANGAGGAGATAGNGSGSASGAAGTARTGAGIASTGAGAARTGAGQAAVEYLQG
FT                   LSRFGMRLGLERIRQLLQRLGHPEEGLPPVYHITGTNGKGSTACILEAVLRSAGYRTAL
FT                   FTSPHLVHYEERFVFDGRPVTGAELAAAVERARAAAGAMAAEGEAPTEFEVATAVFLLL
FT                   VQMRQPDAVVLEVGLGGRYDATNAVPRPVVSVVTNVALDHTDRLGRTVEEIAYDKVGIA
FT                   RPGVPLVTGALDPGALAVLRREAARVGAPLWEVRPDEPGPQGPGPAAAARYRLRSTGPD
FT                   GSRWDYRCGAVTPAGQGGLPGTPVRWDDLPLALLGPHQVANAAVAVTALLAAAAAGRGL
FT                   PVTREVVERGLAAARWPGRMERLAWRGREIWLDGAHNPAGMAALARTAATLWPGRQALL
FT                   VIGMLDDKDVEAAAAAIAPTVARAVVTEPPSPRAAPARRVAAALEACGVPVTVEREPMA
FT                   ALDRALGEAAPGQPVLVAGSLYLVGAVRGRVLEPAAAPGR"
FT   gene            317533..318705
FT                   /locus_tag="Tmar_0274"
FT   CDS_pept        317533..318705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0274"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR020616: IPR020617: IPR002155: IPR020615: IPR 020610:
FT                   IPR020613; KEGG: bts:Btus_3277 acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase-like; PRIAM: Acetyl-CoA
FT                   C-acetyltransferase; SPTR: Acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase,
FT                   C-terminal domain; Thiolase, N-terminal domain; TIGRFAM:
FT                   acetyl-CoA acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50399"
FT                   /db_xref="GOA:E6SMD9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMD9"
FT                   /protein_id="ADU50399.1"
FT                   /translation="MIIDGARTPFGKFGGALKDVPAVELGAVAIRAALDRAGVAPEQVD
FT                   YVLMGMVVQAGAGQIPSRQAAVKAGLPVTVPSDTINKVCASALRAVNLGDALIRAGDAA
FT                   VVVAGGMESMSQAPYLARQARWGGRMGHLQLEDALLTDGLLCAFGGCHMGVYGSRVAAE
FT                   YGVTREEQDRWALRSHQRAIAAMDAGRLAEEIVPVQVPGRKGEVTRVEVDEAPRRDTSY
FT                   EKLAALPPVFEQDGTVTAGNAPGLNDGAAALVLMEAERARALGLKPLATIVSQGQASLD
FT                   PPYLHTVPYYAAERALKKAGLRWDDIALFEVNEAFAAVALTTMKLGNWDPEKVNVNGGA
FT                   VALGHPIGASGARILLTLAYELRRRGGGYGIATICSGGGQGEATLIRVDG"
FT   gene            318899..320212
FT                   /locus_tag="Tmar_0275"
FT   CDS_pept        318899..320212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0275"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR005110: IPR001453: IPR005111: IPR020817; KEGG:
FT                   rca:Rcas_1860 molybdenum cofactor synthesis
FT                   domain-containing protein; PFAM: MoeA domain protein domain
FT                   I and II; molybdopterin binding domain; MoeA domain protein
FT                   domain IV; SPTR: Molybdenum cofactor synthesis domain;
FT                   TIGRFAM: molybdenum cofactor synthesis domain protein;
FT                   PFAM: Probable molybdopterin binding domain; MoeA
FT                   N-terminal region (domain I and II); MoeA C-terminal region
FT                   (domain IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50400"
FT                   /db_xref="GOA:E6SME0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME0"
FT                   /protein_id="ADU50400.1"
FT                   /translation="MPDRSILHDERGPHEPPGPGTPGFRAPFPTAGLPTVAEARQRILA
FT                   AAGRPPLQVEELPLAEALGRVLAKPVYAPEDVPGFHRSTVDGYAVRSQDLRGIQPDRPA
FT                   RLQVVGRVLVGRPADVRVEAGQAVAVPTGGMLPPGADCVVMFEHTSREGPWLLVHRFAG
FT                   PGDNVIARGEDAVAGLALLAPGRRLGPADLGALAGAGITRVAVAREPRVALLLTGDEVV
FT                   PPGRSPGPGQIRDINGVALAAALRQDGARPLEPVYVPDEPAAFRQALRDALAAADLVLI
FT                   SGGSSVGERDLTAELAAELESPGVILHGVALKPGKPTLFAMAGRTPVFGLPGNPVSALV
FT                   VYRLLVRPVIFRWLGLEESPGPGPRIRARLETPLRRPPGREEYVPVALIWRGGEYGARP
FT                   QPRKSGLITALTGAQGLVHLPLEVEGLPAGAEVEVIPW"
FT   gene            320209..320823
FT                   /locus_tag="Tmar_0276"
FT   CDS_pept        320209..320823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0276"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="COGs: COG0315 Molybdenum cofactor biosynthesis
FT                   enzyme; InterPro IPR002820; KEGG: mta:Moth_2134 GTP
FT                   cyclohydrolase subunit MoaC; PFAM: molybdopterin cofactor
FT                   biosynthesis protein MoaC; SPTR: GTP cyclohydrolase subunit
FT                   MoaC; TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: MoaC family; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50401"
FT                   /db_xref="GOA:E6SME1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME1"
FT                   /protein_id="ADU50401.1"
FT                   /translation="MNGSSHPPDEPAWTHLDPAGQARMVDTSGKAATVREAVARGRVRM
FT                   APATLARLRAGAVPKGDVWAVARVAGIMAAKETGRLIPLCHPLPLDAVTVDFRLGPEAV
FT                   EIQATARTVARTGVEMEAMVAVAVAALTLVDMCKALDKGMVVEGIRLVRKTGGRSGEYA
FT                   RPGEPPWEALGDPVGPGGRGRAGDGEGTQAVQAAQQGPGPG"
FT   gene            320839..321429
FT                   /locus_tag="Tmar_0277"
FT   CDS_pept        320839..321429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0277"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="COGs: COG0521 Molybdopterin biosynthesis protein;
FT                   InterPro IPR001453: IPR008284; KEGG: bts:Btus_1305
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   molybdopterin binding domain; SPTR: Molybdenum cofactor
FT                   synthesis domain protein; PFAM: Probable molybdopterin
FT                   binding domain; TIGRFAM: molybdenum cofactor synthesis
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50402"
FT                   /db_xref="GOA:E6SME2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME2"
FT                   /protein_id="ADU50402.1"
FT                   /translation="MRVAILTVSDGVSQGWRQDASGDYLARWAAQRGATVVARGVVPDH
FT                   RAAIARWLAAVADGRPAPGEARDPAPGHDAGHAAPAGSSPARAPVPDLILTTGGTGLGP
FT                   RDVTPEATLDVIQRAVPGLPERMRAVTGAGNPLAYLSRAVAGIRGRTLIVNLPGSPRGV
FT                   AECLAAIEPLLSHALAILHGGGHEAPEGGDGGA"
FT   gene            321688..322014
FT                   /locus_tag="Tmar_0278"
FT   CDS_pept        321688..322014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0278"
FT                   /product="Chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR020818: IPR001476: IPR018369; KEGG: dtu:Dtur_0958
FT                   co-chaperonin GroES; PFAM: Chaperonin Cpn10; SPTR: 10 kDa
FT                   chaperonin; PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50403"
FT                   /db_xref="GOA:E6SME3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME3"
FT                   /protein_id="ADU50403.1"
FT                   /translation="MSVQPQPKGGTVSVKLRPLGDRVVVKVIEEEERTKGGIILPDTAK
FT                   EKPQQGEVLAVGTGRILENGQKVPLEVKEGDRVIFSKYAGTEVKLDDEELLILSERDIL
FT                   AVIQ"
FT   gene            322043..323662
FT                   /locus_tag="Tmar_0279"
FT   CDS_pept        322043..323662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0279"
FT                   /product="chaperonin GroEL"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR002423: IPR001844: IPR018370; KEGG:
FT                   tjr:TherJR_0775 chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; SPTR: 60 kDa chaperonin; TIGRFAM: chaperonin
FT                   GroEL; PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50404"
FT                   /db_xref="GOA:E6SME4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME4"
FT                   /protein_id="ADU50404.1"
FT                   /translation="MPKQLVFNEQARRSLEKGLNTVANAVKITLGPKGRNVVLEKKFGS
FT                   PTITNDGVTIARDIELKDPFENMGAKLLTEVATKTNDVAGDGTTTAIVLGQAMVREGMK
FT                   VVAAGANPILVKRGIEKAVNAVVEEIKRIAKPVETKEATQQVASISANDEEIGKMIADA
FT                   MEKVGKDGVITVEEAKTLDTTVDVVEGMQFDRGYLSPYFVTDAEAMEAVLEDPFILITD
FT                   RKISSVNDLLPVLQRVVERGKPLLIIAEDVEGEALATLVVNKIRGTLQSCAVKAPGFGD
FT                   RRKAMLEDIAILTGGQVVSEDLGIKLENVTPDMFGRAKKVVVEKENTTIVEGAGDPEKI
FT                   KARINVIKRQIEETTSDFDREKLQERLAKLAGGVAVIKVGAATEVEMKEKKYRIEDALS
FT                   ATRAAVEEGIVPGGGSTLVHAIKALDKVEAKNEDERMGIEIVRRALEEPLRQIATNAGL
FT                   EGSVVVERVKQLPDNEGFDALTGEYGDMFQRGIVDPAKVTRSALQNAASIAAMVLTTES
FT                   LVADLPEDKKETPGGGMGDMDF"
FT   gene            complement(323812..324285)
FT                   /locus_tag="Tmar_0280"
FT   CDS_pept        complement(323812..324285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0280"
FT                   /product="PilT domain-containing protein"
FT                   /note="COGs: COG4113 nucleic acid-binding protein contains
FT                   PIN domain; KEGG: npu:Npun_BR048 PilT domain-containing
FT                   protein; SPTR: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50405"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME5"
FT                   /protein_id="ADU50405.1"
FT                   /translation="MSERVVCFDTSILVKFLTPDEQEDAVTRLVDRALQEGARLVAPAW
FT                   AWAELGSVLLKKVRMGLLEITEATQLWTACQDLPIEYVESPSLRRRAWEIARRLDLPTL
FT                   YDAGFFACTELAAAGTGTPAEFWTADTALLRQLGNRKPAYVRSLRDDLPAPRS"
FT   gene            complement(324278..324538)
FT                   /locus_tag="Tmar_0281"
FT   CDS_pept        complement(324278..324538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyt:cce_3903 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50406"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME6"
FT                   /protein_id="ADU50406.1"
FT                   /translation="MAEGRHPLTVRVPAELLAGIRQVQEPGESLNDFLVAAARREITRR
FT                   QALRARDTIVRLRQAIRERTGVHPDPIPLIRALREGEARDE"
FT   gene            324752..326332
FT                   /locus_tag="Tmar_0282"
FT   CDS_pept        324752..326332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0282"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterPro IPR000991: IPR001674: IPR004739: IPR017926: IPR
FT                   011702: IPR006220: IPR001317; KEGG: mta:Moth_2105 GMP
FT                   synthase; PFAM: GMP synthase domain protein; glutamine
FT                   amidotransferase class-I; SPTR: GMP synthase
FT                   [glutamine-hydrolyzing]; TIGRFAM: GMP synthase, large
FT                   subunit; GMP synthase, small subunit; PFAM: GMP synthase C
FT                   terminal domain; Glutamine amidotransferase class-I;
FT                   Asparagine synthase; TIGRFAM: GMP synthase
FT                   (glutamine-hydrolyzing), C-terminal domain or B subunit;
FT                   GMP synthase (glutamine-hydrolyzing), N-terminal domain or
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50407"
FT                   /db_xref="GOA:E6SME7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME7"
FT                   /protein_id="ADU50407.1"
FT                   /translation="MRMSMTDLEPSRVEPEERVVILDFGSQYGHLIARRVRELGVYSVV
FT                   LPHHAPLAEILRHRPRGVILSGGPASVYEPGAPQCDPGLWQAGVPVLGICYGMQLMVHQ
FT                   LGGRVDRADHREYGPATLEVEEPGRLLAGLGPRVDVWMSHGDRVDALPPGFTVLARTAG
FT                   SPYAAVEGGDGRWLGVQFHPEVAHTPRGREILANFLYRVCGCKGGWSMAEFVERAVPAL
FT                   RRQLAGARALCALSGGVDSAVAAALVHRAIGPRLICVFVDTGLLREGEVEEVRSIFTGL
FT                   GMDLRVVDARDRFLAALDGLADPEAKRKAVGETFIRVFEEEARRLEAQVGAIPFLVQGT
FT                   TYPDVIESGGGAAATIKSHHNVGGLPADLEFQLVEPLRDLFKDEVREVGRRLGLPPAIV
FT                   DRQPFPGPGLAIRMIGPVTAERLQRLRACDRIVREEIRRAGLEDRLWQAFAVLTGTPTV
FT                   GVMGDRRTYGEAVAVRAVTSDDGMTADWARLPYEVLDRIARRLANEVEGVNRVVYDVTS
FT                   KPPATIEWE"
FT   gene            326605..326715
FT                   /locus_tag="Tmar_0283"
FT   CDS_pept        326605..326715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50408"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME8"
FT                   /protein_id="ADU50408.1"
FT                   /translation="MRVGGGAMFYRLLAAAAGIVTGLVAALNSQVSWPIG"
FT   sig_peptide     326605..326691
FT                   /locus_tag="Tmar_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            327054..329963
FT                   /locus_tag="Tmar_0284"
FT   CDS_pept        327054..329963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0284"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661: IPR003594: IPR006674: IPR003018: IPR
FT                   013656: IPR000014: IPR005467: IPR000700: IPR004358; KEGG:
FT                   bts:Btus_0284 signal transduction histidine kinase,
FT                   nitrogen specific, NtrB; PFAM: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; GAF
FT                   domain protein; metal-dependent phosphohydrolase HD sub
FT                   domain; PAS fold-4 domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SPTR: Signal transduction histidine kinase,
FT                   nitrogen specific, NtrB; TIGRFAM: PAS sensor protein; PFAM:
FT                   HD domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; GAF domain; His Kinase A (phosphoacceptor) domain;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50409"
FT                   /db_xref="GOA:E6SME9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E6SME9"
FT                   /protein_id="ADU50409.1"
FT                   /translation="MKPSGVVARYMAVVAAAGLLGVAALAVVEAAPPSALSLLLGVALL
FT                   IAELCQVMSAGGEAVSMGSLVVLVALWLLGPAVPVWAEVVGWCLVGAWRRSPGLVVAFN
FT                   LGQTVLAVLAAAAAFRLGGGDWGLPLASGDSVVPYLASAAAFGLVNAALVAAAFALYKR
FT                   VPFREQWRDYMVADSWRLAVSWLLALGVYVLFTRHDYPPAALAVFPVLAVIHQVGTSVW
FT                   TRRLRQRAVERFLRTLHADLEVVRRAELLVRLVTNLAESLGVGGRELDNLRHAALLHEA
FT                   GGPRPLGVGESEPAPDLLVRHALASAREVARIVVLEPVARILRHHHEHWDGTGGPDGLR
FT                   GTAIPLPSRVLAVAEAYLFALQRWGDADAAWDAVLRRAGSRYDPQVVEALAGARDLVGW
FT                   AAEPRLSVVGELAVAADQLRRFVREEGCRSGGRGVGFHDDHLLRQAAGGVVALSHFARV
FT                   INATLRPDQVAERVLDTFLEVLGGRVLWLVPAGPPAVLRVAGVRNAPPDLVGGELDLNR
FT                   PPFRQLVEQDKALVIRLEPDQGPSWLLGGQRRWILAVPLVARGQLLAAVVVVRDGPPPY
FT                   PFTQGNLLDVVASQAALSLDNARLFEQVQLRLQELTSLKRFQDLVFEQVGTGIVAADAT
FT                   GTVTLANRTAAEILRRAGWPGCQLPPPRPLGAGNPCDSMLLEQLTARHPLPPRTWELEA
FT                   EDGSPLVVTAQAFPLVGHDGERAGAVVLLRDVTQERELEQRARRSERLAAVGQLAAGAA
FT                   HEIRNPLTAIKGFIQLIGRKLEGEAAGYMDIVLQEIDRIEGIVNDLLLLARPPKPRLRP
FT                   VDVGGLLARLVEMIRLDEAARGCTVELAVAGPLPPVVADEAQLRQVFLNLVRNGLDAMP
FT                   AGGVLRVRALYDRATDTVQVEVEDRGPGIPPEHLNRIFDPFFSTKEGGTGLGLAVSYGI
FT                   VRNHGGHIDVDSEPGCGTRMRVVLPVAGPAGQPARPEGS"
FT   sig_peptide     327054..327143
FT                   /locus_tag="Tmar_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            329983..332358
FT                   /locus_tag="Tmar_0285"
FT   CDS_pept        329983..332358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0285"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR000212: IPR005751: IPR014016: IPR014017; KEGG:
FT                   tjr:TherJR_0848 ATP-dependent DNA helicase PcrA; PFAM:
FT                   UvrD/REP helicase; SPTR: ATP-dependent DNA helicase PcrA;
FT                   TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM: UvrD/REP
FT                   helicase; TIGRFAM: ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50410"
FT                   /db_xref="GOA:E6SMF0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF0"
FT                   /protein_id="ADU50410.1"
FT                   /translation="MADLLADLNPAQREAVTHPGGPVLVLAGAGSGKTRVLTRRVAFLL
FT                   EQGVAPHQILAITFTNKAAREMRERVEQLVGTGARDMWIGTFHASCVRILRRDGYRIGY
FT                   DRNFIILDEDDRRSVLRDVLKERNLSETRYPPNAVGGMISAAKNQLLDPEEFAARHRDF
FT                   YRQQVAAVYAAYQERLQRNGAMDFDDLLMQAVRLLEEAPDVLAYYQRRFVHILVDEYQD
FT                   TNHAQYRLLRLLAAGHRNLFVVGDPDQSVYRWRGADITNILRFEEDYPDARVVRLELNY
FT                   RSTASILGAAQAVIEHNTQRKEKQLRSVHGEGARVVVFGAADEHDEAWFVAREMERLHG
FT                   EEGYGYGEMAVLYRTHAQSRVLEETLLRRGIPYRIVGGLKFYERKEVKDILAYLRLAVN
FT                   PDDRISLRRVINVPRRGIGEATLARLEAYLDREGVGLLDALARAEDIPGVTRPQAAALM
FT                   AFGGVIADLRAMAEQRPAYDVIALALDRTGYKEMLEQEQTPDAMSRLENLKELLSVARD
FT                   FERQRGAGDAPLVDFLAEVALVSDVDQLDEGARAVSLMTLHSAKGLEFDVVFITGMEEG
FT                   VFPHSRSLDDPHELEEERRLCYVGMTRARRRLYMCFTRQRTLFGATRRQVPSRFLEEAD
FT                   QRYLEWQGLPPGSDEPAFGDGGDAWEAGAPAWRGAGARWGAAGRPGRGSGAFGWDRGRG
FT                   GPGGGAGLDGRARGGPAWNGRGASETAGATLRGDGTCGPAAAGGEPFRPGERVVHPRFG
FT                   EGTIVMRRGEGDDAEVTIAFPDAGLKTFIVRYANLRRA"
FT   gene            332386..334680
FT                   /locus_tag="Tmar_0286"
FT   CDS_pept        332386..334680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0286"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="COGs: COG0272 NAD-dependent DNA ligase (contains
FT                   BRCT domain type II); InterPro IPR013840: IPR003583:
FT                   IPR001357: IPR013839: IPR 004150: IPR004149: IPR001679:
FT                   IPR018239; KEGG: hmo:HM1_3028 DNA ligase, nad-dependent;
FT                   PFAM: NAD-dependent DNA ligase adenylation; NAD-dependent
FT                   DNA ligase OB-fold; BRCT domain protein; PRIAM: DNA ligase
FT                   (NAD(+)); SMART: NAD-dependent DNA ligase ;
FT                   Helix-hairpin-helix DNA-binding class 1; BRCT domain
FT                   protein; SPTR: DNA ligase; TIGRFAM: DNA ligase,
FT                   NAD-dependent; PFAM: NAD-dependent DNA ligase OB-fold
FT                   domain; NAD-dependent DNA ligase adenylation domain; BRCA1
FT                   C Terminus (BRCT) domain; NAD-dependent DNA ligase C4 zinc
FT                   finger domain; TIGRFAM: DNA ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50411"
FT                   /db_xref="GOA:E6SMF1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF1"
FT                   /protein_id="ADU50411.1"
FT                   /translation="MDQHQPVTGAGPNAAGGPDGLEAARARAEALREQIRHHDYLYYVL
FT                   DRPEIDDAAYDALMRELRELEARFPEIVTPDSPTQRVGGKPAAPFARVEHAEPMLSLDN
FT                   AFSREELEAFDQRVRRAVGGDVAYVAELKIDGLSIALTYEEGRFVRGATRGDGEAGEDV
FT                   TANLRTIRSLPLRLRDRERQVPQRVEVRGEVYMTFDAFRRLNQEQEARGQAPFANPRNA
FT                   AAGSVRQLDPAVTAARSLNLWVYALAGWEGDPAAAPRSQWEVLQTLRQWGLPVNPHARR
FT                   CTSLDELLAYIDEWAARRHQLPYLIDGIVIKVDDLAQQRELGTTARSPRWAIAYKFPAE
FT                   KARTRVRDILVSVGRTGALTPVAVLDPVLLAGTTVSRASLHNADYIREKDVRIGDLVVV
FT                   HKAGEIIPEVVEVVKEARTGDERPFTMPERCPACGSPVVRVEGEAATRCPNAACPAQQL
FT                   ERIRHFASRDAMDIEGLGPAVIEQLVARGLVRDVADLYRLEAEPVAQLERMGPKSAANL
FT                   IAAIDASRARPLRRLLYGLGIRFVGERVAGVLARHFGTIHRVMEAEPAELMAVPEIGPR
FT                   IAESVAAFFRDEHNRDLIRRLAEAGVRAAAGEPEPGSAAARAAAGAGAAAGVAGAAEGA
FT                   GMAAGPAGIPGVAGGDAATDGLGSGPGATGPGGVGAPPGPDGPGVPPEVRERVAGKTFV
FT                   FTGGLASMTRDEAEALVEALGGRATGSVSRKTDYVVAGEGAGSKLAKARELGIPVLDEQ
FT                   AFLRLVGRQPS"
FT   gene            334949..336694
FT                   /locus_tag="Tmar_0287"
FT   CDS_pept        334949..336694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0287"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG4166 ABC-type oligopeptide transport system
FT                   periplasmic component; InterPro IPR000914: IPR010916; KEGG:
FT                   tte:TTE0611 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, periplasmic components; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR:
FT                   ABC-type dipeptide/oligopeptide/nickel transport systems,
FT                   periplasmic components; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50412"
FT                   /db_xref="GOA:E6SMF2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF2"
FT                   /protein_id="ADU50412.1"
FT                   /translation="MLKRNRKVFALFSLLVVASLVLAACGNGGGGQTGTTGQGGEQQAS
FT                   GPDSPNYLKLNLGDEPPSLDPQLATDSVSFSIIGATYEGLVRQDANGDFPQGSGIAESW
FT                   EVSEDGLTYTFHLRDAQWSDGKPVTANDFAFAWKRAMDPRTASQYSYIVYPYIKGGDAV
FT                   ASACGDDGSCDGDDAKIEEALNNVGIEVVDEKTLKVTLSKNVPFFMNLLTFPVWRPVRQ
FT                   DIVEKYGDQFATDADKAVYNGPFIVKEWNHNNSLRIEKNPNYWDAANVKLDYVDFVMVS
FT                   DAAAYINAYEAGELDATGVPAEFKEQFEQTHADELGSYYDGATFYLVLNTTKKPWNNPK
FT                   ARQAVSLAIDRETYINALNKGIGLPATSYTNPVITAPGEPGVSFEEKYVRPLNLFPTKA
FT                   DPAKAKQLWQEALQEEGLTEVPTLEFVGDNGDVVKTRLEFFQQQLKQNLGIDLQIVQVP
FT                   FEERLERQRTQKFDIIMAGWGPDYDHPLTFLDMWVCDGPYNDGKYCSQQYDNLVKQLQE
FT                   ATDPAQQRELSIQLEKLIAQDVPIVPIYHREVLYAQKPYVKNLIRRAIGFSPEFKWAYT
FT                   EGRGQ"
FT   sig_peptide     334949..335041
FT                   /locus_tag="Tmar_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            336986..337915
FT                   /locus_tag="Tmar_0288"
FT   CDS_pept        336986..337915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0288"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: bbe:BBR47_17640 oligopeptide ABC transporter permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Oligopeptide ABC
FT                   transporter permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50413"
FT                   /db_xref="GOA:E6SMF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF3"
FT                   /protein_id="ADU50413.1"
FT                   /translation="MRRYVIQRLALMLVSIWAVVTLTFVMMHAIPGNPFADPRLRPEIL
FT                   ALMMDKYGLNDPLWEQYLRYWGNLLQGDLGVSLKNIGQSVNRMIAEGFPWSAWIGGQAL
FT                   IFALAVGLTLGTIAALNRNRWPDYAAMVIAVLGVSVPSFVIAVFAQWLFAVKLNWVPVL
FT                   WNGTWQTSILPSLALGGTMLATLVRMMRTQMLDVMGQDYINTARAKGLSQGEVIWRHAL
FT                   RNAILPIVTILGPLVAGILTGTVVIEAIFGIPGLGKYYVESVYQRDYPLILGTTVFYFI
FT                   FLIVANFLVDLSYGIIDPRIRLTNRARG"
FT   sig_peptide     336986..337093
FT                   /locus_tag="Tmar_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            337920..338891
FT                   /locus_tag="Tmar_0289"
FT   CDS_pept        337920..338891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0289"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: tte:TTE0613 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50414"
FT                   /db_xref="GOA:E6SMF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF4"
FT                   /protein_id="ADU50414.1"
FT                   /translation="MAVNRAAPPAPAPTPALTPDMFQPAPVATGEAEAIVRPSLTFWQD
FT                   AWIRFRANRLAMLGLVLLIFMALGSLLGPVISYRLLGHTFDFQDYANINKPPSAQFWFG
FT                   TDQIGRDLFTRVWMGGRISLFIGIVAALLELVIGVLYGGISGYLGGRVDEIMMRIIDVL
FT                   YGIPYLLLVILLLVVMDPGLPTIILAMGMTGWVGMARLVRGQILQLREMEFVLAARVLG
FT                   VPTMPLILRHLVPNIMGPIIVSLTLTVPGAIFGEAFLSFIGLGVPPPRASWGTLINEAY
FT                   TVMRIWPWQFAFPALALSITMFAFNAVGDGLRDALDPRLRAR"
FT   gene            338906..339916
FT                   /locus_tag="Tmar_0290"
FT   CDS_pept        338906..339916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0290"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR013563: IPR010066: IPR 017871; KEGG:
FT                   tpd:Teth39_1686 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50415"
FT                   /db_xref="GOA:E6SMF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF5"
FT                   /protein_id="ADU50415.1"
FT                   /translation="MEKLLEVRDLRVHFRTHGGEVQAVRGVSFDLHKGETLCIVGESGC
FT                   GKSVTAQTIMRLIPMPPGRIVSGSIRFQGQDLVRLPEREMQKIRGRSMGMIFQDPMTSL
FT                   NPTMTIGRQIAEPLIKHQGMRPDQARARAVELLQMVGIPNPEERVRQYPHQFSGGMRQR
FT                   AMIAIALACNPALLIADEPTTALDVTIQAQILELMQDLKQRLGTAIILITHDLGVVARM
FT                   ADRIAVMYAGQIVEQGTAEEIFHHPKHPYTEALLRSIPRLDDRRERLQAIPGTPPDLFA
FT                   PPAGCPFAARCPYTMRVCHDYDPELEEIRPGHYAKCWLHHPYAPVVGLNAEERGA"
FT   gene            339920..340972
FT                   /locus_tag="Tmar_0291"
FT   CDS_pept        339920..340972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0291"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR013563: IPR010066: IPR 017871; KEGG:
FT                   tpd:Teth39_1685 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50416"
FT                   /db_xref="GOA:E6SMF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF6"
FT                   /protein_id="ADU50416.1"
FT                   /translation="MAKGGAGTVAVPAGGAAGAQDEAAPGERPLLEVRNLKRYFDVGRG
FT                   AVLKAVDGVSFSLRRGEVLGLVGESGCGKSTVGRTIVRLYDPTEGQVLFDGQDVHKLAG
FT                   KDLMRFRRRAQMIFQDPYASLNPRMLVSEIIGEALDLHGMVKSRKERTERIHELLNLVG
FT                   LNRDHANRFPHEFSGGQRQRIGIARALAVKPEFIVADEPISALDVSIQAQIVNLMTDLK
FT                   EQFGLTYIFIAHDLSMVKHISDRVAVMYLGQIMELAPSDELYHRPQHPYTQALLSAVPI
FT                   PDPHVERTRERIVLKGDVPSPVNPPRGCPFSTRCPLAEKICFEARPPLEEIAPGHWAAC
FT                   HLVKGTNAAA"
FT   sig_peptide     339920..339976
FT                   /locus_tag="Tmar_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            341367..343088
FT                   /locus_tag="Tmar_0292"
FT   CDS_pept        341367..343088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0292"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914: IPR001412; KEGG:
FT                   pjd:Pjdr2_4828 extracellular solute-binding protein family
FT                   5; PFAM: extracellular solute-binding protein family 5;
FT                   SPTR: Extracellular solute-binding protein, family 5; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 5
FT                   Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50417"
FT                   /db_xref="GOA:E6SMF7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF7"
FT                   /protein_id="ADU50417.1"
FT                   /translation="MLRKARLGTALALLLVVALVLVACGQGGGQGPAQGEGGQQQSAEG
FT                   EQSRPQKGGTLTVGTFSDIITINPLFIDDVPSQEVANLVLASLYDVDPQANVIVSDTSL
FT                   AAELPQISEDGLSYTVKLKDTPKWTDGRPVTAEDVAWTIEMYANPEVGSPAIASFDKVD
FT                   KVEVVDPQTVRVTLKQVYAPFLYTLAELQPLPKHVFEGVAPKDLQKQPYGTDPSKTVTN
FT                   GPWKWTEWTQKQYVTLERNENYWGPEPYIDRVVFKIYADQNTLAQAMLNREIDILPGVD
FT                   VKTLPALQGQSGIQIVEAPGPVYDYLGFNFKPENFPDGFVPWASQKTRQAIAYAINRQG
FT                   MVDSILKGHGQLLNGPFLPGSWADAGTAVNYEYNVEKAKQLLAEDGWQPGPDGILQKDG
FT                   RKFEFTLQTNAGNERREQVAAVIQQNLKDVGIKVNIETLDFSSWVENYILPGKFQAILI
FT                   GWRLALDPDAESIFSSKYVPPNGQNAGWYKNEQIDQLWVEGYSTTDQEERKQVYAEIAR
FT                   LISQDLPYVFLYTQNVIAAYSDRVQWQEADKPVLTLPDGWQYNMEKWWLSDAQGGQ"
FT   sig_peptide     341367..341471
FT                   /locus_tag="Tmar_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            343182..344153
FT                   /locus_tag="Tmar_0293"
FT   CDS_pept        343182..344153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0293"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: bbe:BBR47_51870 oligopeptide ABC transporter permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Oligopeptide ABC
FT                   transporter permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50418"
FT                   /db_xref="GOA:E6SMF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF8"
FT                   /protein_id="ADU50418.1"
FT                   /translation="MAEYLVRRVVQSLLVLWLVSVVTFAIIHLAPGGPIQYFLQPGLSP
FT                   AAIQQQIKNLGLDRPIPVQYLDWLGDLLRGDLGHTFKGYMPVAQIIWPTFKNTLILMTT
FT                   AWVLTLVIAIPWGVYNSARQYGFSDTLASLVGYAGFAMPSFWLGIILQETFALKLKWFP
FT                   LSNMYTYGREGDVLDLLHHMVLPVTTLVIINLAAYLKYARASMLEVLGQDYIRTARAKG
FT                   VPERRVIFRHALRNALIPVITILGLDLPFVVSGAALTEAVFNWPGMGQLFVQMAFAREY
FT                   QVLMAITLIVTVVVVLGNLLADILYAVVDPRVRLTGKGVQSA"
FT   sig_peptide     343182..343253
FT                   /locus_tag="Tmar_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            344150..345241
FT                   /locus_tag="Tmar_0294"
FT   CDS_pept        344150..345241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0294"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: bbe:BBR47_51860 oligopeptide ABC transporter permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Oligopeptide ABC
FT                   transporter permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50419"
FT                   /db_xref="GOA:E6SMF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMF9"
FT                   /protein_id="ADU50419.1"
FT                   /translation="MSHPLPWHQPGLPDAPVQDEPAPADGGEPAGAPGDILWRIALRRF
FT                   MANPWAVAGLLILLFFIGVAVAAPWIAPYPPDQIDLLNPDAPPSAEHWLGTDGIGRDIL
FT                   SRLIYGSRVSLVVGFSVAAGTVLLGSLVGALAGYFGGWVDTVLMRLIDVMLSFPALFLN
FT                   ILVLAIFGTDFKYLIMILVLTSWMGVARLVRGQFLQLREMQYVEAARAIGTPAWQIIVH
FT                   HLLRNATAPLIVNATLMIGGAILAESALSFLGLGVQPPHTSWGQMLNNAQQYMLTNPML
FT                   AVYPGACIFLTVLAVNFVGDGIRDALDPRQKERVRRRWRVAVAFGRAPAPAVPAAAGGS
FT                   GIRPGDGEVARLAGHGEAGGDGR"
FT   gene            345238..346341
FT                   /locus_tag="Tmar_0295"
FT   CDS_pept        345238..346341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0295"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR013563: IPR010066: IPR 017871; KEGG:
FT                   bbe:BBR47_51850 oligopeptide ABC transporter ATP binding
FT                   protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide ABC transporter ATP
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50420"
FT                   /db_xref="GOA:E6SMG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG0"
FT                   /protein_id="ADU50420.1"
FT                   /translation="MSRGVAAAAGAAATGRTTRPLLEVQGLTAGFLTRQGPLVAVEDVS
FT                   FHVGVGETVCLVGESGSGKSVTSLAIMRLLEYDNGTIFGGRILLDGTDLVTQSQEAMRR
FT                   IRGRHVAMVFQEPMTALNPVFPIGDQIAEAVMLHEGKGRAEAWARAVEMLRLVGIPEPE
FT                   VRVRQYPHQFSGGMRQRAMIAMALACRPRLLIADEPTTALDVTIQAQILDLLRRLKAEL
FT                   GMSILLITHDMGVAAEMADRIVVLYAGRVVEEGPVDRIFERPAHPYTMGLLASVPDLDR
FT                   PRQRRLRAIPGSVPSLDRMPRGCRFHPRCPYAEERCRREEPPLRPWQDGHVACWLAEQV
FT                   AAQAAVPVAGGGEPDQVRRDGAGEVHG"
FT   sig_peptide     345238..345288
FT                   /locus_tag="Tmar_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            346341..347339
FT                   /locus_tag="Tmar_0296"
FT   CDS_pept        346341..347339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0296"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003593:
FT                   IPR003439: IPR013563: IPR010066: IPR 017871; KEGG:
FT                   pjd:Pjdr2_4824 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50421"
FT                   /db_xref="GOA:E6SMG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG1"
FT                   /protein_id="ADU50421.1"
FT                   /translation="MAVAEPRVRTAEPLVKVEGLKKYFPITRGLLSRTVGYVRAVDGVS
FT                   LEIHPGETFGLVGESGCGKSTLARLVLRLIPATEGRVWFDGQDLFALPPAAMRKMRRQM
FT                   QIIFQDPFGSLNPRFTVADIIGEPLRVHGMRRRADRDRRVAELMEMVGLNPAWRHRFPH
FT                   QFSGGQRQRIGIARAIALNPRFVVADEAVSSLDVSVQAQILNLLADLQERLGLTYLFIA
FT                   HGLNVVRHVSTRVGVMYLGQLVEVAPVDELFSHPAHPYTAALLSAVPVPHPRRRRERIV
FT                   LQGDVPSPANPPAGCRFHPRCPFAQPRCREERPVLRTLTSGHAVACHFPLE"
FT   gene            347521..348876
FT                   /locus_tag="Tmar_0297"
FT   CDS_pept        347521..348876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0297"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933: IPR011650:
FT                   IPR018236; KEGG: rca:Rcas_1840 peptidase M20; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Peptidase M20; PFAM: Peptidase family M20/M25/M40;
FT                   Peptidase dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50422"
FT                   /db_xref="GOA:E6SMG2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG2"
FT                   /protein_id="ADU50422.1"
FT                   /translation="MEGALAYSRAHREEALEDLRALLRQPSVAAQNLGMQACAEQVAAM
FT                   LEAVGARVELVPLEGGFPVVFGEIDAGAPRTLLFYNHYDVQPPEPLEEWEVDPFAAEIR
FT                   DGRLIARGVADNKGNLMTRIKAVEAWLQGEGRLPVNVKFVIEGEEEIGSVHLHQFMERY
FT                   ADRLAADGVVWESGGKDARGRPAISAGCKGILYVELVARAANQDLHSSLAAVVPNPAWR
FT                   LVQALSTLKDVTTDRVLIEGFYDAVRGPTPAERRLLEQFPLEEDEMLASWGLNEFIGGL
FT                   RGVALQEKLLYAPTCTICGIVSGYTGPGTKTVLPREARVKLDFRLVPDQRADDILAKLR
FT                   AHLDRHGFGDLEIVVLGPEDPAQTDPDHPLVGVIRDTAREVYGVEPVVRPRTAGTGPMF
FT                   LFHRIGLTATVDGVGIGHHGSLVHAPNENVFVDDYYRGIEHVIRVLDRFARV"
FT   gene            348929..350110
FT                   /locus_tag="Tmar_0298"
FT   CDS_pept        348929..350110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0298"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000587: IPR000994; KEGG: sti:Sthe_0528 peptidase M24;
FT                   PFAM: peptidase M24; creatinase; SPTR: Peptidase M24; PFAM:
FT                   Metallopeptidase family M24; Creatinase/Prolidase
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50423"
FT                   /db_xref="GOA:E6SMG3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG3"
FT                   /protein_id="ADU50423.1"
FT                   /translation="MWWISDGELARRRRRVLAELSERGAAAFLTYNPTSIFYLTNFHFI
FT                   PTERPAALLLEESGRCGLLVPRLELEHAQLVARVDEVRDYPEYPGEVHPMEHLARWLKD
FT                   RGLGAAHLLAEAAGYASSWGYQGPPLTELLPGARITVDAKLIERHRLVKSPEEIALIRE
FT                   SCRWGNLAHELLQEYAVPGASEVEISHRASHEATMAMIRAFGRGRRPVGPLSAFAGFRG
FT                   QVGPNSALPHAVTINAVLKRGDVLVTGATASVGGYLSELERTMFVGEPSPEQVRFFQHM
FT                   LELQEVAFAAIKPGVPCSAVDREVRRYYDEHNLWPYWRHHVGHNIGLLGHEAPFLDIGD
FT                   ETLIEPGMLFTVEPGLYVPGLGGFRHSDTVLVTEDGIEILTYYPRDLESLICG"
FT   gene            350269..350562
FT                   /locus_tag="Tmar_0299"
FT   CDS_pept        350269..350562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0299"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="COGs: COG0721 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase C subunit; InterPro IPR003837; KEGG:
FT                   afw:Anae109_4339 glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   SPTR: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C; TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   TIGRFAM: glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50424"
FT                   /db_xref="GOA:E6SMG4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG4"
FT                   /protein_id="ADU50424.1"
FT                   /translation="MADITREEVRRIAALARLGLDPAEEERLAGQMVRIVEAMAQLRRV
FT                   DAGNAEPLTHVLAGLGNVTRPDEPRPGTDREALMAAAPDRSGPFWRVPRVID"
FT   gene            350562..352028
FT                   /locus_tag="Tmar_0300"
FT   CDS_pept        350562..352028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0300"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR000120: IPR004412: IPR020556; KEGG: mta:Moth_2009
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A;
FT                   PFAM: Amidase; SPTR: Glutamyl-tRNA(Gln) amidotransferase
FT                   subunit A; TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; TIGRFAM: glutamyl-tRNA(Gln) and/or
FT                   aspartyl-tRNA(Asn) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50425"
FT                   /db_xref="GOA:E6SMG5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG5"
FT                   /protein_id="ADU50425.1"
FT                   /translation="MEELWFEPAHRLARRLEAGEISARELARAFLDRIQELDGTVGAYL
FT                   TVTAELALAQAREEDDKRRRGEPVGPLSGIPVAIKDNLCIQGVPTTAASKLLAGYRPPY
FT                   TATAVERLRKAGAVVLGKTNMDEFAMGSSTENSAFRITRNPWDPQRVPGGSSGGSAAAV
FT                   AAGEAAAALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRYGLIAFASSLDQIGPLTRDVT
FT                   DAALLMEAIAGHDPADATSAPVPVPSWRDALTGEVAGVRIGLPREFYGEAVEPEVAGAV
FT                   RAAVERLVADGAVADETSLPSAEHALPAYYLIATAEASSNLARYDGVRYGYRADAGNLA
FT                   DMYLETRKNFGPEVKRRILLGTFALREGYYDAYYRKALQVRRLIKDDFDRLFATFDVLI
FT                   TPTSPVVAFPLGARTADPLAMYAADICTLPVNLAGLPAVSVPCGFAGGLPVGLQIIGRP
FT                   FAEDMVLRVAYAIEQRLQLDLRPPLGRVAA"
FT   gene            352025..353653
FT                   /locus_tag="Tmar_0301"
FT   CDS_pept        352025..353653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0301"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog); InterPro
FT                   IPR017958: IPR004413: IPR006075: IPR018027; KEGG:
FT                   bts:Btus_2800 glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; Asn/Gln amidotransferase; SPTR:
FT                   Glutamyl-tRNA(Gln) amidotransferase, B subunit; TIGRFAM:
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit; PFAM:
FT                   GatB/GatE catalytic domain; GatB domain; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50426"
FT                   /db_xref="GOA:E6SMG6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG6"
FT                   /protein_id="ADU50426.1"
FT                   /translation="MTATAGAGARGGPVPAAGMAPVSGVAAGAAPKGAAAGGSGAVTAP
FT                   APAGAEAPAAWQEKNGLRYRVIVGLEVHVELRTRTKIFCSCPNQFGAEPNTHVCPVCMG
FT                   LPGTLPVLNRQALEYAALAALALNCRIARETKFDRKNYTYPDLPKGYQISQYDQPLATG
FT                   GWVEIDAPAGPKRVRIRRLHLEEDAGKSVHDQDETGTLLDFNRAGVPLIEIVTEPDLAS
FT                   PEEARLFLQELRAAILYTGVSDVRMEEGSLRCDANVNVVVRGAGPDGGDLRTPITEIKN
FT                   LNSFRSVVRALEYEVERHLEAVRRGERLERETRHWDEQRGRTRPSRGKEEAHDYRYFPE
FT                   PDLPRLVLDEAWVEGLRARLPELPRQRRARYVEELGLPAYDAGVLTADPALARFFEDVV
FT                   AAGVPAKAASNWIMSEVLAHLNATGREVQDLPFGPGQLAALLQLVEKGTISGKIAKQVF
FT                   AEMLETGGDPETIVRERGLVQVTDEGQLVEWVERAIAENPEAVANYKGGKTTALGFLVG
FT                   QVMRYSKGKANPQRVNELLKERLDG"
FT   sig_peptide     352025..352111
FT                   /locus_tag="Tmar_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353816..357313
FT                   /locus_tag="Tmar_0302"
FT   CDS_pept        353816..357313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0302"
FT                   /product="acriflavin resistance protein"
FT                   /note="COGs: COG0841 Cation/multidrug efflux pump; InterPro
FT                   IPR001036; KEGG: bts:Btus_3161 acriflavin resistance
FT                   protein; PFAM: acriflavin resistance protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: AcrB/AcrD/AcrF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50427"
FT                   /db_xref="GOA:E6SMG7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG7"
FT                   /protein_id="ADU50427.1"
FT                   /translation="MAVWRWAIARPVATLMAMGVLVWAGLFSLRTLPVGLLPALDPPVL
FT                   TVVTTLPGASPEAIDQLLAPPLTQALRTVRGVEEITARSGDEAAVVVLRFRWGTGLDAA
FT                   REQVHQRLDALPLPPGAGRPQVLRFDPQQLPMMEVSLAGPGDPVQRARQVREVLLPRLE
FT                   AVPGVAAASLRGAPEERVEVVLDAAALRRHGLAPGQVQAAVAAAAATVPAGAVAGGDGA
FT                   RRWPVEVEGGFDHLDDLERVVVGLSSPVAVVPPGPVPGLQTPERGAIPEPGAAGDTPVA
FT                   ASPGMEGSRDGTPDRPDGAPGRGGAPGRRPAPVLAGAVPVRLADVATVTVRRDPPPDVE
FT                   RLNGRDGLGLVIYQEPGANTVSVSRGVREALAGGLAALPGWEATVTYDAGLLVERAVRG
FT                   VGQSLLVGSLLAVAILWLFLRRGRAVAVVAVAIPISACATLAAMHLAGMTLNVMSLGGL
FT                   ALSAGVLVDQAIVVLESIAHRHRQGLPPREAAEAGTAEVAAAVAGSTVTNLIVFLPVLF
FT                   LGGLAGQLFHDLAVTNALAQAASLLVAVTVVPVLAAWWLDEPVPLPAKASRAQASSPPA
FT                   TGPVPATGAVPAPGPAEGPAPWAVGHPGPDGAGTSATTLVVPPLPRPFEACLARPAVTL
FT                   VAALVLVAASVPAAARLGTEFLPAVDERAVDVTVTLPQGSSLAATTAALERVEAAVLRL
FT                   PGVETVVVRAGGSAWPGMAGAQNQGLVRVQLAEGAGSSAAWAERIRRRLDGARDPGLDR
FT                   LGAQVTVQPRNLWADVGAGAPVVELALRAEDPATLAEAAAQARRVLAGMPGLADVAVDL
FT                   DPTAPRLLVRVDAAAAAGYGLAPAQVGQQLRLALAGEAVARARVDGRWLPVVLRTAGMP
FT                   ARGNLPAVTGAGPSGAGSSAAPAGPAPAGDQGARPALGAGVGQLPLAGGTGWTRLNDVA
FT                   TVRPDATPAALVRRDGWLSATVTARVDGTDLGTAVTRARQRVAAALPPGAAVAPAGTAV
FT                   LMEEGFATLVPAALGALLLIYMAMAAQFESLVHPLLMMVTLPLALVGAVAGLAVTGYPI
FT                   GLTAVMGGIVLAGIAVNNGIVLVDAARRYRAEGLAPAAAIRQAWRRRLRPVLMTALTTL
FT                   LGSLPMVLAPGRGSELEVPLAAVLVGGLFTSTALTLVVLPCAWLVVETRRRPGAPSRP"
FT   sig_peptide     353816..353977
FT                   /locus_tag="Tmar_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            357524..358279
FT                   /locus_tag="Tmar_0303"
FT   CDS_pept        357524..358279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0303"
FT                   /product="geranylgeranylglyceryl phosphate synthase family
FT                   protein"
FT                   /EC_number="2.5.1.41"
FT                   /note="COGs: COG1646 phosphate-binding protein with
FT                   TIM-barrel fold; InterPro IPR008205; KEGG: sth:STH150
FT                   geranylgeranylglyceryl phosphate synthase-like protein;
FT                   PFAM: PcrB family protein; PRIAM: Phosphoglycerol
FT                   geranylgeranyltransferase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; PFAM: PcrB family; TIGRFAM:
FT                   geranylgeranylglyceryl phosphate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50428"
FT                   /db_xref="GOA:E6SMG8"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG8"
FT                   /protein_id="ADU50428.1"
FT                   /translation="MDWRRWRHAVKLDPARPLDPEVVRGLATTGTDALILGGSDGIRRE
FT                   AVFHLLGAARATGLPVAIEVSSEEAVVPGADWYLIPMVLNTRDPRWLVGAHREAFQNLH
FT                   RIAPGIPVPWDRVVTVAYVVCNPDATVARVAAAVPPAGPDEVAAWTTVAERLLRADIVY
FT                   IEYSGRFGDPAWVGAAAGAMRGARLFYGGGIGTAEQAAVMAARAHTVVVGNALYRPGGL
FT                   ECIRATVEGARRVRPGEGGEPIAAGGRLP"
FT   gene            358254..359150
FT                   /locus_tag="Tmar_0304"
FT   CDS_pept        358254..359150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0304"
FT                   /product="D-amino acid aminotransferase"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR018300: IPR005784: IPR001544; KEGG: sth:STH1330
FT                   D-alanine aminotransferase; PFAM: aminotransferase class
FT                   IV; SPTR: D-alanine aminotransferase; TIGRFAM: D-amino acid
FT                   aminotransferase; PFAM: Aminotransferase class IV; TIGRFAM:
FT                   D-amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50429"
FT                   /db_xref="GOA:E6SMG9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005784"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMG9"
FT                   /protein_id="ADU50429.1"
FT                   /translation="MPPEVVFLNGSFVPYEQAVVPVEDRGFLFADAIYEVIRCYGGRFF
FT                   RLNDHLERLEQSAAALEIPLPYDRARWTAVLEELIQRNGVRDGSVYVQVSRGVSPRSHT
FT                   WPGGLQPTVVAIARSGGAPAPEAVRQGVKAITVPDNRWGLCWVKTTGLLPNVLAKQQAA
FT                   RAGAYEALFVRDGLLTEGTSSNVFVVLDGVLYTHPLANILPGVTRTVVLEVAREAGIPV
FT                   REQAIPVRWLERASEVVLSGTNSEVLAVVEVDGRPVGDGRPGPVFARLRQGYLARVAAE
FT                   TGAPVDAGTEAGTGTGA"
FT   gene            359327..359842
FT                   /locus_tag="Tmar_0305"
FT   CDS_pept        359327..359842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0305"
FT                   /product="phosphodiesterase, MJ0936 family protein"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro IPR000979:
FT                   IPR004843; KEGG: dau:Daud_0456 phosphodiesterase; PFAM:
FT                   metallophosphoesterase; SPTR: Phosphodiesterase, MJ0936
FT                   family; TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   Calcineurin-like phosphoesterase; TIGRFAM: phosphoesterase,
FT                   MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50430"
FT                   /db_xref="GOA:E6SMH0"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH0"
FT                   /protein_id="ADU50430.1"
FT                   /translation="MPTRVLVLSDTHVPGRARALPPAVLEAAARADLIVHAGDLVRLEV
FT                   YEELALLAPVVAVHGNVDDPEVYRRLPARAVFERDGVRVGVTHGHLGRAATTPARALEA
FT                   FAGEDVPPAVVVFGHSHQPLIQRQDGVLLVNPGSPTDPRQAPAPTYAWLELDGGEARAR
FT                   LVELSRRP"
FT   gene            359868..361685
FT                   /locus_tag="Tmar_0306"
FT   CDS_pept        359868..361685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0306"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   pca:Pcar_1870 dipeptide transport protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR:
FT                   Dipeptide transport protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50431"
FT                   /db_xref="GOA:E6SMH1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH1"
FT                   /protein_id="ADU50431.1"
FT                   /translation="MSEQTLNWRRRLGAAVILALVLVAAAGIWHLAGTAGPGPAVPADP
FT                   TGAPATPPGDQPSVPELVLGSLGGFEGWNPLLTERHPLQPLLFRSLVRYNDRMEVEPDL
FT                   AASWDVSDDGRVYTLHLAEASWQDGRPVTADDVVFSLTTRLHPRADRLAAYNLAPLDGA
FT                   EAYLAELESLDREKAAGLLDEATWEARAQAAYGRWLKRGAVRAVDPRTVVVTFAEPYAP
FT                   ALELFTLPVVPAHAFASQAEALDPENPFHTGRPVGSGPYRLVSWVPGVQARLVARDDLP
FT                   AEAAPGYRVVVVRFFRDQEELDRAVLAGEVDAGRLSPEAAREVVASREPLRLVEFPDLG
FT                   YTYVAYNLRAPVLADPAVRRAIDLAVDRQAMVRDLFGRYAEPLTSPGLPGTWWAAPAPL
FT                   PRHDPEAARAVLEAAGWKDADGDGVRERGEQRLAIQLLTHRENRYREEAAAMLAASLRE
FT                   VGIAVEVRLVDWPELVAALQEGRYEAALLGVAVGVDPDGYALWHSGGHLNFTGLHDAEL
FT                   DRLLEEGRRGGDRRAVYRQVQERLVQLQPALFLWQEIQVLAVRPGVDGPISGSPGGFFW
FT                   NLAAWHPSDRQPTEPPGAGVEEPAAPARP"
FT   sig_peptide     359868..359996
FT                   /locus_tag="Tmar_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            361851..362219
FT                   /locus_tag="Tmar_0307"
FT   CDS_pept        361851..362219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0307"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG0838 NADH:ubiquinone oxidoreductase subunit
FT                   3 (chain A); InterPro IPR000440; KEGG: afl:Aflv_2700 NADH
FT                   dehydrogenase subunit A; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; SPTR:
FT                   NADH-quinone oxidoreductase subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50432"
FT                   /db_xref="GOA:E6SMH2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH2"
FT                   /protein_id="ADU50432.1"
FT                   /translation="MDSRVWIDVLVFLIAGASFPMVNVAVSRLLRRDWREPSKLTTYET
FT                   GIRPYGDARVRYSIHYYIFALIFLVFDVEVVFFYPWAVQFRELAQMGPFAFVEMALFIV
FT                   MLAVGLIYAWKKKVLRWA"
FT   sig_peptide     361851..361931
FT                   /locus_tag="Tmar_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            362210..362791
FT                   /locus_tag="Tmar_0308"
FT   CDS_pept        362210..362791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0308"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG0377 NADH:ubiquinone oxidoreductase 20 kD
FT                   subunit and related Fe-S oxidoreductase; InterPro
FT                   IPR006138: IPR006137; KEGG: gem:GM21_4009 NADH-quinone
FT                   oxidoreductase, B subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH-ubiquinone oxidoreductase 20 kDa
FT                   subunit (NADH dehydrogenase subunit 10); TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50433"
FT                   /db_xref="GOA:E6SMH3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH3"
FT                   /protein_id="ADU50433.1"
FT                   /translation="MGVTNPRVTGPSGITLADLAWDETDPDHLIDRAAERLPGVWEYLP
FT                   GVITTNLQTLVNWGRKNSLWYLLFGIACCAIEMMAAGASRIDLDRLGSVFRASPRQADL
FT                   MIVAGTVTEKMAPVIKTLYDQMAEPKYVIAMGACASNGGPYYQGYNVVDGVDKIVPVDV
FT                   YVAGCPPRPEALIYAIMKLQDKVARANLPA"
FT   gene            362997..363653
FT                   /locus_tag="Tmar_0309"
FT   CDS_pept        362997..363653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0309"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="COGs: COG0852 NADH:ubiquinone oxidoreductase 27 kD
FT                   subunit; InterPro IPR020396: IPR010218: IPR001268; KEGG:
FT                   bbe:BBR47_54430 NADH dehydrogenase subunit C; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 30 kDa subunit; SPTR:
FT                   NADH-quinone oxidoreductase; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50434"
FT                   /db_xref="GOA:E6SMH4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH4"
FT                   /protein_id="ADU50434.1"
FT                   /translation="MAERAEAAPGQAGDDRPIHIHQDDKPLLEALPLPAEGTFVDPKAK
FT                   KKAAGEGTGEEPAADPVVARLREAFPDLTFEPVAATADGGPIVTVPVDRWLEVARFLRD
FT                   DPQLGFDYLSDLCGVDYKDALQVVYQLRGVGHDRRLTVKVNVGKDDPEVPSVVEVWPGA
FT                   GWHEREAFDMFGIRFSGHPDLRRILMPPWTPDDVFPLRKDFVDRRPKRERKVRPR"
FT   gene            363808..364983
FT                   /locus_tag="Tmar_0310"
FT   CDS_pept        363808..364983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0310"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR001135; KEGG: sth:STH2774 NADH
FT                   dehydrogenase I subunit D; PFAM: NADH-ubiquinone
FT                   oxidoreductase chain 49kDa; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH-quinone oxidoreductase subunit D 2;
FT                   PFAM: Respiratory-chain NADH dehydrogenase, 49 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50435"
FT                   /db_xref="GOA:E6SMH5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH5"
FT                   /protein_id="ADU50435.1"
FT                   /translation="MSLTREPVQPLELDPRLGDRVRIEPLDGGRQTMTMSMGPQHPSTH
FT                   GVLRVVLTLDGETVVDAQPDIGYLHRNWEKIAEYMTYAMTVPFSDRNDYLAAITNELAL
FT                   VQAVEKLTGIEVPERAQILRIIFSELQRITSHLLWFGTFGLDLGAVTAFLHAFTAREYC
FT                   YRLFERATGARFLYGYLRIGGMRNDVPDGWVEDLLSFVDQLERTYWPEFMRLLIDNAIF
FT                   IRRTKGIGVLKPEVAVAYGASGPVLRGSGVKYDVRKADNYLPYDRFEFDIPVGENGDVY
FT                   DRAVVRMYEMLESAKIIRQAVKELPDGPVMAKVPRAIRPYGEVYHRVEGPRGEVGVYLV
FT                   AAGDTNAYRARWRSPCFVHLQLLPLLARGHLVADVVAIIGSIDIVLGEVDR"
FT   gene            364983..365945
FT                   /locus_tag="Tmar_0311"
FT   CDS_pept        364983..365945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0311"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR018086: IPR001694; KEGG:
FT                   mta:Moth_0981 respiratory-chain NADH dehydrogenase, subunit
FT                   1; PFAM: respiratory-chain NADH dehydrogenase subunit 1;
FT                   SPTR: NADH-quinone oxidoreductase subunit H; PFAM: NADH
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50436"
FT                   /db_xref="GOA:E6SMH6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH6"
FT                   /protein_id="ADU50436.1"
FT                   /translation="MPEWLVAVLWAILKATIALAFIGVNFMFLVWLERKVSARMQYRVG
FT                   PYRVGKPHGWLQLIADAIKMFSKEDVMPAAADRWVWAAAPVVVFAPAVLLFVILPVGPN
FT                   FGVQPDFNLGLLFLSAVSSFTLFGIFMAGWGSNNKYSLIGAMRAAAQLMAYEIPLVLAV
FT                   LGVVMLAGSLSLQDIVAAQRTYWYVFPQFLGFIVFLIAAIAELNRTPFDLSEAESELVA
FT                   GYFTEYSGIRWGMFMFAEYTNLFTMSAIAASLFFGGWNGPILPPVVWFLIKTYAFVLLA
FT                   MWIRWTLPRIRIDQLLDLGWKFLVPVGLLNLVITGLFLV"
FT   sig_peptide     364983..365096
FT                   /locus_tag="Tmar_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            365962..366441
FT                   /locus_tag="Tmar_0312"
FT   CDS_pept        365962..366441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0312"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR017896: IPR017900: IPR010226; KEGG: sth:STH2772
FT                   NADH dehydrogenase I subunit I; SPTR: NADH-quinone
FT                   oxidoreductase subunit I 2; TIGRFAM: NADH-quinone
FT                   oxidoreductase, chain I; PFAM: 4Fe-4S binding domain;
FT                   TIGRFAM: NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50437"
FT                   /db_xref="GOA:E6SMH7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH7"
FT                   /protein_id="ADU50437.1"
FT                   /translation="MSVLAEIWQAAKSIVVGHAVTWRSTTRPPVTVNYPDERPDLPKGY
FT                   RGIPVLKTNLETGQLNCTACGLCARSCPVNVIEVVEETDENGKRLRRPKVFNIDMSRCM
FT                   VCNLCVEACPFDALEMANHFEIADYSVPNLIFNKEQLAEIWKQYDAVRLAGGEKP"
FT   gene            366438..367106
FT                   /locus_tag="Tmar_0313"
FT   CDS_pept        366438..367106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0313"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="COGs: COG0839 NADH:ubiquinone oxidoreductase subunit
FT                   6 (chain J); InterPro IPR001457; KEGG: sth:STH2771 NADH
FT                   dehydrogenase I subunit J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; SPTR:
FT                   NADH dehydrogenase I subunit J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50438"
FT                   /db_xref="GOA:E6SMH8"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH8"
FT                   /protein_id="ADU50438.1"
FT                   /translation="MTGAAVIFAILAAVVLLGAWRVVTSEQIAHSALFLGLTFVGMAGL
FT                   FVLLQAPTFALLHVLVYVGAILTVVVFAIMLSDPEELRGAGDLPPGERLRRRLLSPYYG
FT                   WIPVVVAGVLVAVVLASLAAAQLPRVPLGEPVADDLRAIGRDMFTRYALPFEVASLALL
FT                   AALIGAIGLTRRNTSEERGRTGRDTAAGAGTGTPDGAGRNGSAAAGRAGTAGAAGEVSR
FT                   "
FT   sig_peptide     366438..366524
FT                   /locus_tag="Tmar_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            367106..367420
FT                   /locus_tag="Tmar_0314"
FT   CDS_pept        367106..367420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0314"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="COGs: COG0713 NADH:ubiquinone oxidoreductase subunit
FT                   11 or 4L (chain K); InterPro IPR001133; KEGG:
FT                   pmj:P9211_01741 NADH dehydrogenase subunit K; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: Putative
FT                   NADH Dehydrogenase subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50439"
FT                   /db_xref="GOA:E6SMH9"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMH9"
FT                   /protein_id="ADU50439.1"
FT                   /translation="MGGVPLMDYLVVGTLLFGLGLWGALTRTNAIRILMCIELMLNAVN
FT                   LNLVALNQYLDPGSVEGQIFGLFIIAIAAAEAAIGIGIVLMVVRRRGEVDINKIRLMRG
FT                   "
FT   sig_peptide     367106..367195
FT                   /locus_tag="Tmar_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            367546..369429
FT                   /locus_tag="Tmar_0315"
FT   CDS_pept        367546..369429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0315"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterPro IPR003916: IPR018393: IPR003945: IPR001516: IPR
FT                   001750; KEGG: mta:Moth_0985 proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein; SPTR:
FT                   Proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone oxidoreductase (complex I),
FT                   chain 5 N-terminus; NADH-Ubiquinone/plastoquinone (complex
FT                   I), various chains; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50440"
FT                   /db_xref="GOA:E6SMI0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI0"
FT                   /protein_id="ADU50440.1"
FT                   /translation="MVESAWLIPLFPLAAFVLTVFVGRRLGERAGWIGVAGMLAATVMA
FT                   LGVFRDAVVRPEAYEAAWRWLQFGSFELRVGFRVDNLEATLLLMVSFVSLMVHVFSLGY
FT                   MHGDARYNRYFALISLFTAGMLGLVISDNAVFWLLWWEIMGACSYLLIGHWFEERENQA
FT                   AAYKAFITTRIGDVLMMAGFWYMFHLTGSLRFADWQAWVEHQAGAGAPDFTRAMTVAAL
FT                   LIFGGAVGKSAQAPLHVWLPDAMAGPTPVSALIHAATMVAAGVFLIARTYFIFAQSPTA
FT                   LAVVAFLGAFTAFLAASIAVVQSDIKKVLAYSTVSQLGYMVMALGVGGYTAALFHLWTH
FT                   GFFKALLFLGSGSVIHAVHTQNMHEMGGLARKMKLTAATFIVGTLALAGIWPFSGFYSK
FT                   DEILLAAYHSRYPVLFWVGAATAGLTAFYMTRAVVLTFFGRPRDAHKYEHAHEGGPELT
FT                   WPLLLLAIPAFAAGFLAPALFGAPVHEFITFGEHVSGYEPESVVVLTGTLFAVAGILLG
FT                   IVVYGLGWISPQTLRAAFATPYFVLQEKWFFDRAYQAVVLAGSSAVARLAAGFDRLVID
FT                   GIVNGVARLVAGVGEVVRRWSTGLVQGYMLTLFAGVVVLALLILQVTGGLR"
FT   sig_peptide     367546..367626
FT                   /locus_tag="Tmar_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            369429..370979
FT                   /locus_tag="Tmar_0316"
FT   CDS_pept        369429..370979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0316"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /note="COGs: COG1008 NADH:ubiquinone oxidoreductase subunit
FT                   4 (chain M); InterPro IPR003918: IPR010227: IPR001750;
FT                   KEGG: amr:AM1_2126 proton-translocating NAD(P)H-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   Proton-translocating NAD(P)H-quinone oxidoreductase, chain
FT                   M; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50441"
FT                   /db_xref="GOA:E6SMI1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI1"
FT                   /protein_id="ADU50441.1"
FT                   /translation="MSASLPYLSLIVGVPAAGALLTLLIPRDNHRAIRLLGTVALALPL
FT                   LLVAAVWAGFDPAAGGPQFVERYRWIPTLGAWYYLGVDGLSLPLVALTALVAPLAALAS
FT                   WGIEHRVKEYWVLLGLLVTGIFGVFLALDYLLFYVFFELSLIPMYFLIGIWGGPRRDYA
FT                   SLKFFIYTLVGSIVLIVGILGLYFLTGASTFDMVELARRAPAAVPPALKLPLFLLLFAG
FT                   FAIKTPMWPVHTWLPDAHVEAPTPISVILAAVLLKMGTYGMMRITWPTLPDVARDLAGT
FT                   LAALAVIAILYGAFTALGQRDFKRLVAYSSVSQMGFVVLALAAAAMAPAAAEAAQLAGR
FT                   DPQVVLEAGQSATMAAVFMMVAHGLASALLFLLVGFWYDRTHTRDFDRLGGMFRTTPVA
FT                   ATFLGIAAFANLGLPGFSTFIGEFFTLLGTLPVFPTAVYVALVGLVGAAMYNLTMLQRV
FT                   TMGPPKPEWHGLPDVTPRELVTFVPLVAAMLLLGWMPGLLTQVLSTPVAQFVAKLGGM"
FT   sig_peptide     369429..369587
FT                   /locus_tag="Tmar_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            370982..372538
FT                   /locus_tag="Tmar_0317"
FT   CDS_pept        370982..372538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0317"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="COGs: COG1007 NADH:ubiquinone oxidoreductase subunit
FT                   2 (chain N); InterPro IPR003916: IPR010096: IPR001750;
FT                   KEGG: sth:STH2767 NADH dehydrogenase I subunit N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   NADH-quinone oxidoreductase subunit N 2; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain N;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50442"
FT                   /db_xref="GOA:E6SMI2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI2"
FT                   /protein_id="ADU50442.1"
FT                   /translation="MPVLPAGELVYLLPEIVLAATAMILLLADAFAGGRDEATTAAGAA
FT                   PGAAAAGPAAEGRRDWIGYLAVLGVVVAMILIRRDVTQPGPILGGMVASDGYAAFFKAV
FT                   FLIATALVALMSIDYVAQRGIAAGEYFSLLLLATTGALFMAGAANLLTFYLGLELLSLS
FT                   SYALAGLMRTDPRSQEASLKYFLNGALSSGVLLFGISLLYGATGTFDLVELARQVGQAL
FT                   QGGEPAGPLPAPVLALGVAFLLAGLAFKAGAVPFHLWLPDAYQGAPTPITAYLAVASEG
FT                   AAFAAILRVFYGGLGGAQATWQEAFIILAVLTMTVGNVTALRQTDVKRLMAYSSIAQAG
FT                   YILAAVGAATELSRPAVLYYVMAYTFMNVGAFAVITALQVQGEGREVRDFAGLARREPL
FT                   LAALLVVFLVSLVGLPPTAGFMAKFSVFRALVSAGNFWLPVVVALNSVISVGYYYNLVR
FT                   YMYVVPADKEPVPSTPVAVPAPVWTVLVVCAFFTLVLGLWPDAFVRWAEVSLMAMGGAG
FT                   F"
FT   sig_peptide     370982..371113
FT                   /locus_tag="Tmar_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(372776..373198)
FT                   /locus_tag="Tmar_0318"
FT   CDS_pept        complement(372776..373198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0318"
FT                   /product="UspA domain-containing protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro IPR006015:
FT                   IPR006016; KEGG: rca:Rcas_3775 UspA domain-containing
FT                   protein; PFAM: UspA domain-containing protein; SPTR: UspA
FT                   domain protein; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50443"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI3"
FT                   /protein_id="ADU50443.1"
FT                   /translation="MKFLIAVDGSPASARAVELAGQLLRGQSDPQVVLVHCVPGMSGDL
FT                   FVGPDAVYRFQEESERLGRAILEAAADRLGQPRPPVEPVLRRGEPGREIVAEAERQRPD
FT                   LVVVGRRGLGRLSSALLGSVSAYVVEHWRGPVLVVQ"
FT   gene            complement(373461..374813)
FT                   /locus_tag="Tmar_0319"
FT   CDS_pept        complement(373461..374813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0319"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="COGs: COG0475 Kef-type K+ transport systems membrane
FT                   components; InterPro IPR002052: IPR018313: IPR006153; KEGG:
FT                   hau:Haur_4248 sodium/hydrogen exchanger; PFAM:
FT                   sodium/hydrogen exchanger; SPTR: Sodium/hydrogen exchanger;
FT                   PFAM: Sodium/hydrogen exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50444"
FT                   /db_xref="GOA:E6SMI4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI4"
FT                   /protein_id="ADU50444.1"
FT                   /translation="MPSFLQVAVLLAVVITAAKGAGALSKRLGQPAVFGELLAGILLGP
FT                   TLLDVLHWPVFTDPPYLERLTRDLAELGVIFLMFLAGLETDLEEMRKVGAAAFFGAVGG
FT                   VALPFLAGTALGLAFGFPLYESIFIGTILTATSVSITAQTLLELGRLRSREGTTILGSA
FT                   VIDDVMGIVILSVVVALHQAGLAGAGDAAGGAAAVAAGSSGSTAAAQGADAGGAGALAV
FT                   GLIVLRMVAFFAAAIAAGRWLLPPILRRAARWPGTEPQFAMALVAGLLLAVAAEELGGV
FT                   AAITGSYMAGVMLTLVPDVKRAVEERLAVLAYGFFVPIFFVNIGLETDLLDAVAASGPA
FT                   FLVLILLAAALGKIVGSGSGVRPFGFTWMEALRVGIGMVSRGEVALIVAGIGLQEGVIS
FT                   QAVFSVMVVMTLFTTLITPILLRWSFGRAPGSPSGAAAFSPAPGPRSGEAD"
FT   sig_peptide     complement(374745..374813)
FT                   /locus_tag="Tmar_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(374859..375695)
FT                   /locus_tag="Tmar_0320"
FT   CDS_pept        complement(374859..375695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH3143 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50445"
FT                   /db_xref="GOA:E6SMI5"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI5"
FT                   /protein_id="ADU50445.1"
FT                   /translation="MPVPLQPIDGVKRGLAEIMTSPNPDASQPALHQGPPASGWVGPPP
FT                   APPRFPWNWAVACVLLGWGAGSLFRLRRLLGINILDMFGFWCLVGAGLCAARFFTLMQV
FT                   ADGRRRLLDALERLPGGLVKLVLPPTPHRGRGGAELLVAGENRAWVVATLDVSAAARPK
FT                   AARKHLVRAAERLAADTQTLVSELAAAGIRWTVAPQPVLVLTRRPVPGPVLEHGAWQVN
FT                   PEHVAKLFEGRTEGAQAGSSLREALLAWQRARLEGTSHRSGPAGGRAGGSAGRTRR"
FT   gene            complement(375841..376857)
FT                   /locus_tag="Tmar_0321"
FT   CDS_pept        complement(375841..376857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0321"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056: IPR003088; KEGG: sth:STH3144
FT                   hypothetical protein; PFAM: cytochrome c class I; SPTR:
FT                   Putative uncharacterized protein; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50446"
FT                   /db_xref="GOA:E6SMI6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI6"
FT                   /protein_id="ADU50446.1"
FT                   /translation="MSKRKVVALALLWALILILQGYWLFESQRMTRASAAARDEQATRG
FT                   AQIYAQNCMVCHGPVGEGIIGPPLNREEFRAEGKTGIQVATIQDFLTKTIARGRPGFDR
FT                   NTWQIEGGKIHSYTRMPTWATSDNGPLNEQQIRDLVTFLMYGDWKEPSKYAAAPEVARL
FT                   TVTEYVTNPDTGQQEPRTRAVTAEDLDVKAAGLTDEENQEAKKLFVTMNCVQCHTLGSY
FT                   GGVVGPNLTRAGEWLPSQEFVERWIANPQAFAPWERMPSVWHGQGTPVDLTETYRKEQD
FT                   KFRSIMPAFENAMSPEQIRLLARFLMGLGDVENRNAAAAPGTTEGTGSQGQGQGGGA"
FT   sig_peptide     complement(376753..376857)
FT                   /locus_tag="Tmar_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(376888..377016)
FT                   /locus_tag="Tmar_0322"
FT   CDS_pept        complement(376888..377016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50447"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI7"
FT                   /protein_id="ADU50447.1"
FT                   /translation="MFEVLESVELLAVLVVIFLCLLAVDTVERFTGRPLETSGEDD"
FT   sig_peptide     complement(376930..377016)
FT                   /locus_tag="Tmar_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(377045..377944)
FT                   /locus_tag="Tmar_0323"
FT   CDS_pept        complement(377045..377944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0323"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="COGs: COG0723 Rieske Fe-S protein; InterPro
FT                   IPR005805: IPR017941; KEGG: sth:STH3146
FT                   plastoquinol--plastocyanin reductase; PFAM: Rieske [2Fe-2S]
FT                   iron-sulphur domain; SPTR: Plastoquinol--plastocyanin
FT                   reductase; PFAM: Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50448"
FT                   /db_xref="GOA:E6SMI8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI8"
FT                   /protein_id="ADU50448.1"
FT                   /translation="MADDQERGPEAAEGQPAAGSRPAGQAPDAAAGTAASGEVAGGRPA
FT                   AAGSGGTAASRSGAGDGGAAGAGGTEGKPARPKVDPEKLAAAKAAAAKAAAAKAAAGRA
FT                   AAAGAAGEPAGAAAGSARPAPARAGGHGAAAGREEPVTRRTFLHWALWGSALLWLGQFA
FT                   GSFANYFWPRKVGFFGQKINIGPVANYPVGSVTKVDAGKFYLVHVEEGMIALYWRCTHL
FT                   GCTVPWKPEERPDVGGCFCCPCHGSQFNKVGEKIGGPAPRPLDYFPIEIDAAGNVWVDT
FT                   GRVQQRQAFSPDQLTRVS"
FT   gene            complement(377992..378771)
FT                   /locus_tag="Tmar_0324"
FT   CDS_pept        complement(377992..378771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0324"
FT                   /product="putative menaquinol-cytochrome c reductase"
FT                   /note="InterPro IPR005798: IPR001986; KEGG: sth:STH3147
FT                   putative menaquinol-cytochrome c reductase; SPTR: Putative
FT                   menaquinol-cytochrome C reductase; PFAM: Cytochrome
FT                   b(C-terminal)/b6/petD"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50449"
FT                   /db_xref="GOA:E6SMI9"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMI9"
FT                   /protein_id="ADU50449.1"
FT                   /translation="MAQPQPVKAAAGEEPQRPNPKEQVTVWPHLLLIEFVGALIYTIGL
FT                   SLLAILIKAPLLDLANPTRTPNPAKAPWYFLNLQELLLHMHPSLAGVIVPGLALVLIAA
FT                   IPYIDTDPSDTGVWFSGEKGLRIFKFSFVYTTLIVLGLILFDAFFTVNVGGVDYIGTRG
FT                   LVAGIMRLFMSPEAIHAQAQVVEWIAGVVIPLIVMAAVPGALAAIVRRRYQANTRETII
FT                   ALFTVFVASYFVLTVIGTGFRGESLRLVWPWQLKPPH"
FT   gene            complement(378909..379679)
FT                   /locus_tag="Tmar_0325"
FT   CDS_pept        complement(378909..379679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0325"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="COGs: COG1290 Cytochrome b subunit of the bc
FT                   complex; InterPro IPR005797; KEGG: sth:STH3148
FT                   menaquinol-cytochrome c reductase; PFAM: Cytochrome b/b6
FT                   domain; SPTR: Menaquinol-cytochrome C reductase; PFAM:
FT                   Cytochrome b(N-terminal)/b6/petB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50450"
FT                   /db_xref="GOA:E6SMJ0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ0"
FT                   /protein_id="ADU50450.1"
FT                   /translation="MSRVGTPEQQPPAPGGRKSLIGRLADWIFNSALWKSMYMNPYPRD
FT                   RRTRGLAVLNSLFLHLHPGRITRQALTFRYTFGLGGTSFFMFILLTVTGVILMFYYIPA
FT                   VPQAYFSVEDLETTVAFGQFFRNMHRWAAHAMVLLVFLHMVRVFYTGAYKPPRQFNWVI
FT                   GVVLLVLTFLMSFTGYLLPWDQLAYWAVTVGTNMAGATPFVGDKLKFLLIGGYDINQNT
FT                   LIRWYTLHVFALPLVAAVFMGMHFWRVRKDGFSR"
FT   gene            380367..380924
FT                   /locus_tag="Tmar_0326"
FT   CDS_pept        380367..380924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0326"
FT                   /product="ATP-cone domain protein"
FT                   /note="COGs: COG1327 transcriptional regulator protein
FT                   consists of a Zn-ribbon and ATP-cone domains; InterPro
FT                   IPR005144: IPR003796; KEGG: gtn:GTNG_2647 transcriptional
FT                   regulator NrdR; PFAM: ATP-cone domain protein; SPTR:
FT                   Transcriptional repressor nrdR; manually curated; PFAM: ATP
FT                   cone domain; TIGRFAM: transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50451"
FT                   /db_xref="GOA:E6SMJ1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ1"
FT                   /protein_id="ADU50451.1"
FT                   /translation="MRCPRCHAPDTRVLDSRPTEEGMAIRRRRECQACGERFTTYEKVE
FT                   VTPLLVIKKDGRREVFNRDKVLRGMLTACEKRPVELERLQAIAAEIERELRSRYDKEVE
FT                   SRVIGEMVMDRLRRLDQVAYVRFASVYRQFKDIETFRRELDRLLAGDEPAPAAQDRDAP
FT                   AAAGPMPDHAGDEPAVQGTSPR"
FT   gene            380938..383583
FT                   /locus_tag="Tmar_0327"
FT   CDS_pept        380938..383583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0327"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="InterPro IPR000788: IPR013344: IPR013509; KEGG:
FT                   ttr:Tter_0049 ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; SPTR: Ribonucleoside-diphosphate reductase;
FT                   TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: Ribonucleotide
FT                   reductase, all-alpha domain; Ribonucleotide reductase,
FT                   barrel domain; TIGRFAM: ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50452"
FT                   /db_xref="GOA:E6SMJ2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ2"
FT                   /protein_id="ADU50452.1"
FT                   /translation="MELTGIRRTVFLDRYARKGPDGKPVESSPEEMWDRVARAIAEVEE
FT                   PGQREVWERRFRQALEGFKFVPGGRILAGAGTGNKVTYYNCYVIPSPEDSRKGIMDNVS
FT                   LMVEIMSRGGGVGVNLSTLRPRGTYVRGVNGTASGPVSWAEVYSTATGSVIQGGSRRGA
FT                   LMLMLDDDHPDIEEFITVKRDLTKITNANLSVCISDAFMEAVQQDLPWDLKWNGKVYKT
FT                   VRARDLWELICESAWASGEPGVVFMERVNKRSNTWYCEPINCVNPCGEQPLGPWGVCNL
FT                   GAINLAAFVHEGELDLEGLKDTVAVAVRFLDNVIDATEYFFPENEKAQRYGVRRIGLGT
FT                   MGLADMLIKLRIRYGSEKAFEVCDQVYRLIRDEAYRTSALLAKEKGAFPWFDKEKYLQG
FT                   WFIQRLPEDIRQLIAQHGIRNGFLLTQAPTGTTSLLAGVSSGIEPVFAFSFKRTDRTGT
FT                   HIVYHELYKEWLEKHPDEPVPDYFVSADQLTPEEHVRMQAIIQQYVDASISKTVNAPRE
FT                   HTVDQVRTLYRLAYELGCKGITYYRDGSREGVLHKLDDGGKAKQGKGTGQGKGQAGSEA
FT                   AAAADGAATTAAGGAGAAATAAAVPAGAAAGAGTGAEAATAQLRVTWGHIRPIERPSKL
FT                   NGFTVRRTTPLGNLYLTLNTFNGYPFELFAQIGKAGSDVAAFTEAIARLVSLAFRAGVD
FT                   PHEVVEQLRGIGGSRSVGFGPNRVLSVPDAIAQFLDDYMAGKIERDPVDEVAAGQLTVF
FT                   SADPAQQAREAVAAARAGQPAAGEAGGAGGTGEAGQVGFNLAAAGTGGAAGGNGGTGGN
FT                   GTGRGPSEPGSAVVVNGTPGAPAAEPPAPRITGGNGRELSMDLCPECGSHALVREEGCS
FT                   KCLACGYSEC"
FT   gene            complement(383838..384752)
FT                   /locus_tag="Tmar_0328"
FT   CDS_pept        complement(383838..384752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0328"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: bts:Btus_2741 protein of
FT                   unknown function DUF6 transmembrane; PFAM: protein of
FT                   unknown function DUF6 transmembrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: EamA-like transporter
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50453"
FT                   /db_xref="GOA:E6SMJ3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ3"
FT                   /protein_id="ADU50453.1"
FT                   /translation="MAGVLIGASLWGLSGTAAQQLMQGYGVTPHWLVTTRMLVAGLLLL
FT                   ATARLLGARDGLGPWRDPASRWQLVLFALGGLVGVQYSYMASIALGNAATATFLQYLGP
FT                   AFVTVYEVLRWRRRPRRQEGLALLLATGGTLLLATGGSLDRLAVPAGAVVWGLISALAL
FT                   AFYTLSGAGLLRRWPPALIIGWAMLLGGAAMAVLAPPWHPGPRPVAWDAAAAGLWAFVV
FT                   LGGTLLAFTLYLASLRHLRPSQTSLLACMEPLAAAASATLWLGVPFTGPMAAGGGAVLA
FT                   AVLLLSSQSRDEAQGPASSGVPR"
FT   sig_peptide     complement(384699..384752)
FT                   /locus_tag="Tmar_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            384938..385417
FT                   /locus_tag="Tmar_0329"
FT   CDS_pept        384938..385417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0329"
FT                   /product="CBS domain containing protein"
FT                   /note="InterPro IPR000644; KEGG: hmo:HM1_0167 cbs domain
FT                   protein; PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; SPTR: Cbs domain protein; PFAM:
FT                   CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50454"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ4"
FT                   /protein_id="ADU50454.1"
FT                   /translation="MKAVMAVNVAFFLLPKSEVVWLSPRNTLRQALERMERHRYSAVPL
FT                   VDDGGRYAGTLTEGDLLWFIKATPGFTFDRAERILVADVPRRLRNDPVSIYADVRDLIR
FT                   LAAVQSFVPVVDDRGLFIGIVRRREIIEYCARLLFGEGGAPPAARGPATGEDRDG"
FT   gene            complement(385414..386904)
FT                   /locus_tag="Tmar_0330"
FT   CDS_pept        complement(385414..386904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0330"
FT                   /product="Protein of unknown function DUF2600"
FT                   /note="InterPro IPR019712; KEGG: gym:GYMC10_4613 protein of
FT                   unknown function DUF2600; PFAM: Protein of unknown function
FT                   DUF2600; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF2600)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50455"
FT                   /db_xref="InterPro:IPR019712"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ5"
FT                   /protein_id="ADU50455.1"
FT                   /translation="MNLAENGEPFHRDEPGPAARPLEAAAPRDFFPAGHVRRVNPFRRE
FT                   PGPSRDADSPAARRRSASACEAGGVPDVGEPARSKPPGGARRLLAEAARLATYVGRVLP
FT                   AVDRALDRWQARAALIPDPELRRQALASLRTKRFHCEGGAVFAAAVPPDRRATLVEAIV
FT                   ALQTISDYLDNLCDRSESLDPADYRQLHQAMLDAVTPWPAQAPASVPRRAVMPPPHRGQ
FT                   APLPSRAEAPLPRLATVPAPHRGAPPSADEGTAGSGGRAYYRLHPHQDDGGYLAALVTS
FT                   CRTALAAFPGYHAVASPVRRLVALYNDLQVNKHGDQAGRLPRLEAWYHREAGRWHGRLA
FT                   WWEFAAACGSTLGVFALFREALLHPAPPAERVAALVDAYFPWIGGLHILLDYLIDQAED
FT                   RAGGDLNLVRPYGDPSRAVEGLAAFAREAARRAEALPDAPLHRLVVDGLLGLYLTDPKV
FT                   ARQHLQPVARRLLAAGGPGARMCFAASRFVRRWRGNAG"
FT   gene            complement(386921..387154)
FT                   /locus_tag="Tmar_0331"
FT   CDS_pept        complement(386921..387154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5663 integral membrane protein; SPTR:
FT                   Dexh-box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50456"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ6"
FT                   /protein_id="ADU50456.1"
FT                   /translation="MFRRGQWVRHRRSGELGIIIRLRSSRQSIRVRWQSGHEQECTSDD
FT                   VEPWDPPPGVDPARFLASGGDGATGRRSASGE"
FT   gene            complement(387224..387841)
FT                   /locus_tag="Tmar_0332"
FT   CDS_pept        complement(387224..387841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0332"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COGs: COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase; InterPro IPR005904: IPR000836;
FT                   KEGG: amt:Amet_2903 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; PRIAM: Hypoxanthine
FT                   phosphoribosyltransferase; SPTR: Hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50457"
FT                   /db_xref="GOA:E6SMJ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ7"
FT                   /protein_id="ADU50457.1"
FT                   /translation="MSVNEPGATAPGGPRKARIDRVLFSQEAIAGKVRELAERIRQDYA
FT                   AVPGANGTGGHGAPLTVVGILKGAFVFTADLVRALGALDVPLQVDFMAVSSYGTATQTS
FT                   GIIRILKDLDRPIRGQHVLLIEDIVDTGLTLRYLREHLMAQDPASLRACVLLDKPERRL
FT                   VDVPVEYVGFQIPDEFVVGYGIDYAEQFRYLPYIACVRLEPQ"
FT   gene            complement(388007..390718)
FT                   /locus_tag="Tmar_0333"
FT   CDS_pept        complement(388007..390718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0333"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="COGs: COG1305 Transglutaminase-like protein;
FT                   InterPro IPR002931; KEGG: sth:STH2555 hypothetical protein;
FT                   PFAM: transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Transglutaminase-like
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50458"
FT                   /db_xref="GOA:E6SMJ8"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ8"
FT                   /protein_id="ADU50458.1"
FT                   /translation="MKAWRSHGHRAQVPVLSPWYVLLVAAGLGSTLAMIRALGPFLGWA
FT                   PDSSEPARLVLKAAALLWLPVTFPWLLLVLAGAGAVWVGWMALRRPDHLATLLEVPGTA
FT                   VFGSGMAARWAPVLQDLWRGTYQQLPPDLLGPGTALLAGFHLVLVFLAARRPALALMPP
FT                   VTGGLILLLAWFYGDLPRPQGPLAAYLVLAFAFAALARAAAAAPGSRHPVPGRLVLPAA
FT                   VQALALVLIAALLAGALPSLDEPAADWVAVTSVANRLLPFTVADRAGGWGAIPGAGGGF
FT                   QVPTRQFLGGPFFPGATPLLTVELSGDAIPATVYLRGATRLTYDGRSWGPPVDVPWYSR
FT                   QGVSLWLAAGGEGGAAWYTANGYGDPSAPVPAMREARLLVQAITPHQPVHPYLYAAFEA
FT                   REVQDGAPLGQGPQPGLDAGRDGRNPVMRTADDTLVVLHPQAGTYTVRSLVPQIDPGAA
FT                   RRAAAAAEARNPAWRDDPALQPYLALPPELPRRVRDLAAQITAEFDNPYDRARAIERYL
FT                   RGFRYDLNMPFLPAGRDFVDYFLFDLQRGYCVAFASAAVVLLRSGGLAARWVEGFVVPT
FT                   GGRPGTYVVTYAQAHSWPEVLIPGYGWIPLEPTPAYPEGPLLAAPANPPGSEPDAPAGD
FT                   GPAPPVPSPRPRAAAEPEDPSSRPEPAEGGGAGATGGAGPAAVAGMVVAAAILAAAAAV
FT                   LLERRRRRRSLPADPALAARAVFVRVERWLDRLGHGRPPALTAREYARWLARRVPELAP
FT                   AWERLAALYELARYAPGPGTSEAAGSGGPQAWAGPGGGRTSLDPAAGTPALTAESVREA
FT                   ARSLRRDLERHFGWRFRRVLLTPDPAVVLAAVARWAQAVRNGLAARFGGRRPALRSGGT
FT                   GRHRPSLRGRRPPAAGPGGRFVRTAGPAGGSR"
FT   gene            complement(390715..392439)
FT                   /locus_tag="Tmar_0334"
FT   CDS_pept        complement(390715..392439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0334"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: sth:STH2554 hypothetical
FT                   protein; PFAM: protein of unknown function DUF58; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50459"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMJ9"
FT                   /protein_id="ADU50459.1"
FT                   /translation="MRLQSWGLPVWTLAALAFALTTGGPVPWFLAKFLAALHLLAAAWA
FT                   WVLARGLHVEARIDRPTATAGDRVQVEVAVHNESLLPVPRLSVSLPAWTEPPDRSGRPA
FT                   PWWIRAVAAGRLPAVGAAVVPGAVFYRSLGPLGNLVFRDTVAVHRRGRYTLGPVVVELQ
FT                   EPLGIFRVRREVYAEPGLTVYPPVVPVDHLPVLPRQPFGRQRVDTRAWQDPSSLADVRP
FT                   FQPGDNPKHIHWKLSAHLDELHVKEFELRATTDCFLFLDLYGGPPAGPAPAAGGPAAAG
FT                   GTEAPAAAGEPLPAGAAGAGGVASRAGTAAGGPRARGTVAAAGPGHSRNGAGGGFSGPD
FT                   RIPLDPGEWVAGVAAGIAAQALHRDLVVAAAAHGDRPYRLPPGRGPQHFRRLLEWLVDV
FT                   DRPGDMPLADFLAAQGSGLTPRSAVLVVTRRLDRRLARVLVQLRGKGHAVGLWIVQTGP
FT                   EPAHTGRGAGTGASTGTSRDPDRHHRPAPAGLGAPARLPAPDDPGLPPADPELVRWLRG
FT                   AGVAVHPVTVPAATSLSSSAGRAGAVPYLLAGKQVPVGGATGGEPAGLGTPSRGWWR"
FT   sig_peptide     complement(392305..392439)
FT                   /locus_tag="Tmar_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(392450..393430)
FT                   /locus_tag="Tmar_0335"
FT   CDS_pept        complement(392450..393430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0335"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003593:
FT                   IPR016366: IPR011703; KEGG: sth:STH2553 methanol
FT                   dehydrogenase regulatory protein; PFAM: ATPase associated
FT                   with various cellular activities AAA_3; SMART: AAA ATPase;
FT                   SPTR: Methanol dehydrogenase regulatory protein; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50460"
FT                   /db_xref="GOA:E6SMK0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMK0"
FT                   /protein_id="ADU50460.1"
FT                   /translation="MQRVQEVAGRVMASVERVIVGKRAEIRYLLAALLANRHVLIEDVP
FT                   GVGKTTMVRALARSIDCTFRRIQFTPDLLPSDITGLSVYDPATRQFTFRPGPIHSQVVL
FT                   ADEINRTSPKTQSALLEAMEEGQVTVDGQTYPLPRPFFVLATQNPIEYEGTFPLPESQL
FT                   DRFGLRIRLGYPRPAEERAILDLHHAGRPVDALQPVTTAEEILELQQLITQVHVDDSVK
FT                   DYLVRIVQATRAHSAVYLGASPRASLSLYRLSQALAAMDGRDYVLPDDVKELAPLVLAH
FT                   RLVLQPEARWHDTDPEAVVRDVLEHVPAPVERRAERWAGSLLRRR"
FT   gene            393646..395076
FT                   /locus_tag="Tmar_0336"
FT   CDS_pept        393646..395076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0336"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216:
FT                   IPR005500; KEGG: sen:SACE_1661 methyltransferase; PFAM:
FT                   Methyltransferase type 11; protein of unknown function
FT                   DUF309; SPTR: Methyltransferase; PFAM: Domain of unknown
FT                   function (DUF309); Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50461"
FT                   /db_xref="GOA:E6SMK1"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMK1"
FT                   /protein_id="ADU50461.1"
FT                   /translation="MAGEPRFDFDAVFDPDDYLYFYEPILTPERTQREVAMVWTLLGLR
FT                   PGEEVLDLACGHGRLAIPLAAMGVRVTGLDRSAGFLARARAEAARQGVEVEWVQGDMRR
FT                   LPWRDRFDAAFNVFTSFGYFADEENLQVLAQVAAALRPGGRFLLETQHRDALLARFAPF
FT                   NVVERGDDFLIDAHRWDAVTGRMVTRRTVIRAGRVRRGEFFVRLYTPAELAGLLRQAGL
FT                   EPEGFYDETAAPLSPQSRRMVVVARKPVGRTRPSVAASEPAGRSRMGVAACEPAGRTRP
FT                   GDEGPSAGDRPAGQPGAAGRPGGLPAAALAGRAAVAGAGSAAAGRSGPASVPGAQGPDD
FT                   APHRLVPPPLATFLWLYHRGRFFESHEVLEEAWHRSRSDFYHGLIILAAAFVRRDRGTP
FT                   RGVRRNLAKARRYLAKYRPHYLGLDVDAILAFIDRQIPAVERAGDPEGEALRRLVPDLP
FT                   LPVHPGWVRGDEPEWEDG"
FT   gene            395127..395588
FT                   /locus_tag="Tmar_0337"
FT   CDS_pept        395127..395588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0337"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro IPR017936:
FT                   IPR000866; KEGG: rrs:RoseRS_3555 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; PRIAM: Peroxiredoxin; SPTR: Alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50462"
FT                   /db_xref="GOA:E6SMK2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SMK2"
FT                   /protein_id="ADU50462.1"
FT                   /translation="MVKPGDQAPDFTAVNDRGETVRLADFRGRKVVLYFYPKDDTPGCT
FT                   REACSFRDDYSQLQQAGAVVLGVSPDPVESHVKFRDKYGLPFPLLSDPDHQVAEAYGVW
FT                   KEKRMYGRTYWGIERTTFVIGEDGRVLAVIRGVKPEEHPRRALKALGVA"
FT   gene            395728..395820
FT                   /locus_tag="Tmar_R0026"
FT   tRNA            395728..395820
FT                   /locus_tag="Tmar_R0026"
FT                   /product="tRNA-Sec"
FT   gene            395931..396047
FT                   /locus_tag="Tmar_0338"
FT   CDS_pept        395931..396047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50463"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG46"
FT                   /protein_id="ADU50463.1"
FT                   /translation="MAPAARRWDMNQQEAKASLERVRREVAEWFPHHPLDPS"
FT   gene            396800..397102
FT                   /locus_tag="Tmar_0339"
FT   CDS_pept        396800..397102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_12060 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; TIGRFAM: DNA binding
FT                   domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50464"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG47"
FT                   /protein_id="ADU50464.1"
FT                   /translation="MSEYLTSSQAARLLGVARSTFHNWHISGKLEEYGVHAIQTLGGHY
FT                   RYRREEIEALRDLLLSRARRSAAASPNGHAFGEAVGHPEEGDYGAKEPASPSESG"
FT   gene            397186..400212
FT                   /locus_tag="Tmar_0340"
FT   CDS_pept        397186..400212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0340"
FT                   /product="S-layer domain-containing protein"
FT                   /note="InterPro IPR001119; KEGG: dsy:DSY3329 hypothetical
FT                   protein; PFAM: S-layer domain-containing protein; SPTR:
FT                   S-layer domain protein; PFAM: S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50465"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG48"
FT                   /protein_id="ADU50465.1"
FT                   /translation="MSSVHRQHSRKFAVIVTVLALLLGLFPVAAFASHGQFPDVSGVLA
FT                   GEIKAAHDAGLVDGYDDGTFRPNENVTRAAFAKFIVLAVEKATGQSLPTGDEPFSDVAP
FT                   NQALYEYVVKAYKAGYIQGYSDGTFGYDKPINRQEAAAILQRALKLADAPENFADVPDD
FT                   SAFAKAIGAVAAAGLMKGYDNGNFGPSDKVNRAQAAAVAVRGYNHLAQQNVQYEVVSVA
FT                   AVSSKALRVTFNKAVDDTSKVKFDVKRDGVAVDLTAKWAEDKKSVDLESSSKLQVGTYT
FT                   VTVSGLDFAEGKNSGSVKVEEETVAKIEIVGDKLIRDKNTPSVARIGYKVYNQYGEDIT
FT                   NSSVAAGIEAKSSAGSASITSTGVVEITNNPSNQAWPLDAKVVLTLVHSATGVTASKTL
FT                   TVADSGQLTSFAFGNIIYPDDSKRIYTGRSEAAWIEVQATDANGQPADEAYLRNAVTLV
FT                   PQSGLQADFATRDGKPVIKIDTTSIVTAGKYTLTAVVLSSPDLNKSITLDVVKEPYPAK
FT                   VELSAPEGLVAARDAAGTVVLGLKVYDQFGNEMAGKDVAAHSADIEVRAVGAGFASGAN
FT                   VDVFGIATTGANIGKVVNTDVIPALASGNAGTITVFATAKETGNTSTVQFQVRPEREPA
FT                   AVVLPTDAVTNLLYNASSVVSLNFKDQYEANYDPAKADPAGAVQSFGYKVTLSGQDVVT
FT                   VTVGGVTLDLGAAPAVSEAAKNGTAGTPATSVLVDLKNITLQAKSASGNATVTVQLLKG
FT                   SNVVSSVQFNVSVAAPSSTLQYSLAQIPALYWDADGDPTNNSGTTNGGSATAAYAEEIR
FT                   VVAKDSTGKTYTVAPSTIVVATVDGADFETGKDGNVWKVWSTRTQRPTDKVTGTLTVQV
FT                   QTTDAGLVTLTGTVTISNEDRYAVNVLVRDAGLTSPNGSVSLPANSNPVSEATYDTAAT
FT                   PPSLTPKPYVAVEDQFGRYWVPGNLKLAPANVSLGVTVTDVSYAATGEVTVSASGAGTF
FT                   DVVIQAPNGKTATIKVNVR"
FT   sig_peptide     397186..397281
FT                   /locus_tag="Tmar_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            400807..402042
FT                   /locus_tag="Tmar_0341"
FT   CDS_pept        400807..402042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0341"
FT                   /product="Integrase catalytic region"
FT                   /note="COGs: COG4584 Transposase and inactivated
FT                   derivatives; InterPro IPR017894: IPR001584: IPR013249;
FT                   KEGG: chy:CHY_1117 ISChy4, transposase; PFAM: Integrase
FT                   catalytic region; Sigma-70 region 4 type 2; SPTR: Integrase
FT                   catalytic region; PFAM: IclR helix-turn-helix domain;
FT                   Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50466"
FT                   /db_xref="GOA:E6SG49"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG49"
FT                   /protein_id="ADU50466.1"
FT                   /translation="MLKGGSLMDILRLKAEGLSVREIARRTGLSRNTVRKYLRQPEPPR
FT                   YKPRPPKASKLDPFKPYLEQRMAQGVFNANRLLQELRAQGYTGGKTILKEFLRPHRPPR
FT                   VPRAVVRFELPPGTQAQVDWGEFAYTDLQGRRRKVYGFVMVLSYSRAMYVEFVEQQDLS
FT                   TLLRCHLHAFAALGGVPKEILYDNMKTVVLRRHGAEVDYHPRMLDFALLAGFAPRVCRP
FT                   YRAQTKGRVERAIGYLKQHFWPAVQFTDLADLNRQVRAWVAEVANRRIHGTTGQRPADR
FT                   LGEEQAHLTPLRPLAAFTSLLHKERRVSRDGYVQYAGSRYGVPWRYSGRYVTVFATETE
FT                   VEIRDGDRVIARHPRALLPGLTISLPEQYHGLALGGTQRPEPPQGQQVVGPAVERRSLQ
FT                   VYEDLLRAGERR"
FT   gene            join(402039..402377,404116..404556)
FT                   /pseudo
FT                   /locus_tag="Tmar_0342"
FT   gene            402702..404006
FT                   /locus_tag="Tmar_0343"
FT   CDS_pept        402702..404006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0247 transposase; SPTR:
FT                   Transposase; manually curated; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50467"
FT                   /db_xref="GOA:E6SG50"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG50"
FT                   /protein_id="ADU50467.1"
FT                   /translation="MTGRERTDNAPRTYVGIDVGRRRHRAAILPIGRAMHGWEHAPVLA
FT                   FTADTDGFREFFDALHAAGATPANTVCALEPTGGYSSQPIFQALKHHGFEVLWVKNQAV
FT                   HDLRETLYGRRSKTDAEDARLIARLLYLREAIGQEYAFQVAHTGSAPYRNLRLLVELRW
FT                   KQVQAHRRASNQLMQVLDVLFPEMRQIFRKGTTRPTPLHLLRRFSTVQAIAAASEQDLR
FT                   HVLVNEARSLRHQTAVSELRRLAQTSVGAREGRDVLELAQGWLIQQLHDLQDSLVDLEA
FT                   RIKAAVEEFPETSILRTFPSMSARRIATLLAGMGAPIDAFPNDRALRKQWGWYVEIEQS
FT                   GARTRSRLGRGGYRGTRRELYLMAMQLIKEQTQDNPFRHYYRRLLRGNPTPKVPKVALG
FT                   HVASKLITVMYVCMRRREPYDPAKLWRHMGVKTTA"
FT   gene            406155..406688
FT                   /locus_tag="Tmar_0344"
FT   CDS_pept        406155..406688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0344"
FT                   /product="protein of unknown function DUF124"
FT                   /note="COGs: COG2013 conserved hypothetical protein;
FT                   InterPro IPR002838; KEGG: sth:STH841 hypothetical protein;
FT                   PFAM: protein of unknown function DUF124; SPTR: Putative
FT                   uncharacterized protein; manually curated; PFAM: Protein of
FT                   unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50468"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG51"
FT                   /protein_id="ADU50468.1"
FT                   /translation="MAFGENGGKRPERAFSNFKTSGGWRYRPRWVRFLHAPAKRYRGYT
FT                   LSGCGRFTSSWHRPLRHANCNRGPAPVRRGSGHPAEDSPERSPTCRYGGGTGRDDGYLK
FT                   PGERYVVDTGHVVAFSDGMGFQVRRAGTGWFSSIASGEGLACEFTGPGTVYIQTRSEAS
FT                   FLGWLIPKLPAKRD"
FT   gene            complement(406721..406885)
FT                   /pseudo
FT                   /locus_tag="Tmar_0345"
FT   gene            complement(406898..407875)
FT                   /locus_tag="Tmar_0346"
FT   CDS_pept        complement(406898..407875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0346"
FT                   /product="protein of unknown function DUF1002"
FT                   /note="COGs: COG4086 secreted protein; InterPro IPR009343;
FT                   KEGG: afl:Aflv_1013 predicted secreted protein; PFAM:
FT                   protein of unknown function DUF1002; SPTR: Predicted
FT                   secreted protein; PFAM: Protein of unknown function
FT                   (DUF1002)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50469"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG52"
FT                   /protein_id="ADU50469.1"
FT                   /translation="MRPRQKHRWLRWMWVALTLALVVSFVLTALAPALAASDSSTSSSS
FT                   SSPAATGEAAGSGRTVVVLGADLTEAQRQEVLRLLGLDPATWDGEPLVLTHQEEVALVG
FT                   DYVPRQQLGSRAISSVRVEPAAPGSGIRVETKHITWVAPEMYAEALATAGVKDAVVYVA
FT                   APFDVSGTAALAGIYKAYEISAGESLDAQRKDLGAREIGVMVRIAQEIGNPEKAGQFLT
FT                   LLKERMAEHPPTSREEILALIRELEQDLGIQLSDPLREELATLVEKLRDAGIDWQAVTT
FT                   QLQQVREQVNRFLGDDTPILKGFFNQAWNWLLQVVDAIRSWFGQ"
FT   sig_peptide     complement(407771..407875)
FT                   /locus_tag="Tmar_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(408073..408678)
FT                   /locus_tag="Tmar_0347"
FT   CDS_pept        complement(408073..408678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0347"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: sth:STH2141 alkaline phosphatase; PFAM:
FT                   SNARE associated Golgi protein; SPTR: Alkaline phosphatase;
FT                   PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50470"
FT                   /db_xref="GOA:E6SG53"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG53"
FT                   /protein_id="ADU50470.1"
FT                   /translation="MDWLTQVVERWGYLGLVAVVALENLFPPIPSEVVIPFAGFLTTFG
FT                   MLTLPGVIAASTLGSLLGALVLYGAGRALGRHRLEALTRRYGHYLGIQIEHVERAEAWF
FT                   ARYGAWAVLVGRLVPIVRSLISIPAGLAGMPGLMFAVYTVAGTLVWNTALAGAGTALGA
FT                   AWPLVQEWVRLYQRVLLMAALVLVAVWVGLRLAARPRK"
FT   gene            409247..409942
FT                   /locus_tag="Tmar_0348"
FT   CDS_pept        409247..409942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:ZK265.2 COLlagen; SPTR: Protein ZK265.2,
FT                   confirmed by transcript evidence"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50471"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG54"
FT                   /protein_id="ADU50471.1"
FT                   /translation="MQAGWTSLIVTVAVLAAVVLLARSLVRARPRLRALRQQQEWQASR
FT                   EADREAARRVLAVPMAEWPLLERLPEGVPPHPAYYATRCTVLEERPEGGFASRGQGWLV
FT                   VGRDSLFFHPDPDGPRPGEPGADEPRRRGDRRGERAGAPGGTQGGPNPAGRAGASGEAS
FT                   PGGAAGPEPLAIPYSAIERVDSPYVNVLEVIAQDPVTRAWTSHFFRMNRPLVVAAYLSR
FT                   LARFELILS"
FT   sig_peptide     409247..409330
FT                   /locus_tag="Tmar_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(410055..411179)
FT                   /locus_tag="Tmar_0349"
FT   CDS_pept        complement(410055..411179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0349"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="COGs: COG2385 Sporulation protein and related
FT                   protein; InterPro IPR013486: IPR013693; KEGG: slp:Slip_0673
FT                   SpoIID/LytB domain protein; PFAM: Stage II sporulation
FT                   protein D; SPTR: SpoIID/LytB domain; TIGRFAM: SpoIID/LytB
FT                   domain protein; PFAM: Stage II sporulation protein;
FT                   TIGRFAM: SpoIID/LytB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50472"
FT                   /db_xref="GOA:E6SG55"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG55"
FT                   /protein_id="ADU50472.1"
FT                   /translation="MTDHHQARPGPGGRGAGGALPAGAAAIWAGVALVLIYAVLATGPL
FT                   AGLPAARPPGTGPGGTGPGEACPGGPGRAGGPEPAGEDGGAAPLDPALARRFAREPQIT
FT                   VFDHAAGAPRGMGMETYVAHVVAGETLPGWRPDALRAQAVAARTYTVSLLMAGEASTPR
FT                   RLYGTDTSTDPAEAQAFRPVVPPAVRAAVEATRGEILVYGGKPIVALFSACAAERTAGL
FT                   RESFPGDDRPAPYLRPVPSPCDRAAPDFIRRWSVALTSSELAGVAGVSPVEVRAVDIAR
FT                   RGPSGRAVLIRIGPRLVHAADLRRQIGPDRLKSTFVTEIEARQGGVWIFRGRGWGHGVG
FT                   LDQWGAEAMARDGRSYRDILAHYYPGTALVQLYR"
FT   sig_peptide     complement(411057..411179)
FT                   /locus_tag="Tmar_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(411240..412118)
FT                   /locus_tag="Tmar_0350"
FT   CDS_pept        complement(411240..412118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0350"
FT                   /product="stage II sporulation protein P"
FT                   /note="InterPro IPR010897; KEGG: sth:STH481 stage II
FT                   sporulation protein P; PFAM: Stage II sporulation P family
FT                   protein; SPTR: Stage II sporulation protein P; TIGRFAM:
FT                   stage II sporulation protein P; PFAM: Stage II sporulation
FT                   protein P (SpoIIP); TIGRFAM: stage II sporulation protein
FT                   P"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50473"
FT                   /db_xref="GOA:E6SG56"
FT                   /db_xref="InterPro:IPR010897"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG56"
FT                   /protein_id="ADU50473.1"
FT                   /translation="MAATGRGPFRRVRGPGAVTGRPVGPGGRVVLWVLLAVAVVVAAAL
FT                   GWRARPGPDHLQWGEQPLVLVYHTHATEAFLPDLPGGDRPDRDIHRDAFTRDARRSIRA
FT                   VGQALARRLAERGLDVVWSGTVYDAASRDDAYERARAGLKELLARHSSIRVALDVHRNA
FT                   TSTRVQVGGQPAAGVLLVVGAGHPGWHRNLALAEALADRLERIHPGLVRGIALKPWHYN
FT                   QDLLPGSLIVEIGGAENTLAESLRTARWVADALVEALAIRPDRPPARPTILPPAPHGKA
FT                   FLPGAGGPGAG"
FT   sig_peptide     complement(411981..412118)
FT                   /locus_tag="Tmar_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            412539..413165
FT                   /locus_tag="Tmar_0351"
FT   CDS_pept        412539..413165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ath:AT5G07540 GRP16 (GLYCINE-RICH PROTEIN 16);
FT                   lipid binding / nutrient reservoir; SPTR: Oleosin; PFAM:
FT                   Small, acid-soluble spore proteins, alpha/beta type"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50474"
FT                   /db_xref="GOA:E6SG57"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG57"
FT                   /protein_id="ADU50474.1"
FT                   /translation="MRSQEPAQVPGGGTDPRVAAGSPGGLGEGAGDGPAGDADEPAAGL
FT                   AAGLTSDSATGGAPGAAPWGSGAPGDADEGDPAAAEPATGDLTAGAAPSPWAGVELPPT
FT                   ATSRRRRKRGHRGGVGRRGGRRVAQPNPEDDPLYPFKVQAAKELGLWPKVEAEGWGALT
FT                   SLESGRIGGYMQRLVKEAQEEGRIPPEVVQRLMQQRRIRPASTET"
FT   gene            413226..413969
FT                   /locus_tag="Tmar_0352"
FT   CDS_pept        413226..413969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0352"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG1234 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; KEGG: amt:Amet_3060
FT                   beta-lactamase domain-containing protein; SPTR:
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50475"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG58"
FT                   /protein_id="ADU50475.1"
FT                   /translation="MRLTILGRDGPYPAPGGACSGYLLEGPQGPVLLDCGPGVLARLRQ
FT                   RVDVPQLAAVFYSHYHPDHCSDHFVLRYVLDIARYLGCQRPEPLPLYGPARPADLAGRM
FT                   PYKDVFTPHFLDPGESVAIAGFDVEVRATDHPIPCLASSWSAGGRRVVYSGDTGPGAAA
FT                   ELVQLARGADLLLIEASLLARRGDRAPGHLTARQAAEIAREAGVRQLLLTHLLPEYDPQ
FT                   EVLAEAQEVFPAARLAEPGATVELP"
FT   gene            414163..415350
FT                   /locus_tag="Tmar_0353"
FT   CDS_pept        414163..415350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0353"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR001176: IPR004838: IPR004839;
FT                   KEGG: adg:Adeg_1380 aminotransferase class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase
FT                   class I and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50476"
FT                   /db_xref="GOA:E6SG59"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG59"
FT                   /protein_id="ADU50476.1"
FT                   /translation="MHLSARARGIQPSVTITIDTRAKELKAAGEQVINLSAGEPDFPTP
FT                   RHVREAAIAAIEAGFTRYTPAAGIAELRRAIAEKHRRDNGVEYAEDEIVVSSGGKHALF
FT                   NAFMAVCDPGDEVIIPAPYWVSYPEMVRLAGGAPVIVQTGPETGFKLTPEALRRALTPR
FT                   SRALILNSPSNPTGTVYTREELDALAAVAAEAGLWMVTDELYEHLIYEGEHVSIAALRP
FT                   EYRERVILINGVSKAYAMTGWRIGWAAAPRPVAKAMAAIQSQATSSVNSIAQKAAVAAL
FT                   TGPQDDVVAMREEYRRRRDLLVEGLSRLPGIEVLRPAGAFYVYPSVRGLLGRQIGGRRA
FT                   GDDVALAEILLEAARIAVVPGTAFGTPGYLRLSYATSRTDLEEALRRLERLLGGA"
FT   gene            415350..417044
FT                   /locus_tag="Tmar_0354"
FT   CDS_pept        415350..417044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0354"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR005762: IPR013221: IPR004101; KEGG: sth:STH1031
FT                   UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; SPTR:
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50477"
FT                   /db_xref="GOA:E6SG60"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG60"
FT                   /protein_id="ADU50477.1"
FT                   /translation="MPAGERGRRAGGGVPEAASGAGTNRPTSAAPSWRAGGSVVAGPVG
FT                   GPEPHGGPGPATGPEPRVMGGAVTGPEPRGGPAAATGPDSSVVPGPVAVVGLGRSNRAL
FT                   VRYLLARGVPVVGCDRQPPDQADPEIRALREAGVELHLGPDYLRVLRERPFATVFLTPG
FT                   MKKDLPEIRAARAAGAQIRGEIDLFLERCRAKVIGVTGSAGKTTTTSLIGEGLRRATAP
FT                   GGPLEGRPVYVGGNIGRPLIEEVDRIPPEALVVLELSSFQLELCHRAPQVAVYLNLRPN
FT                   HLDVHGSMEAYAAAKSRIVALQAAEGWAVLNGDDPAPAGLAPRAPGRVAIFAASARVAR
FT                   QLAEQEAGRRGGPVRAAYLAGEHLAVWDGQEERCVLDGRAMVLRGAHNRLNALAAILAG
FT                   WVAGAPPEAMAEAAAAFRGVEHRLELVREVDGVRYYNDSIATAPDRTLAALEAFTEPVV
FT                   LIAGGYDKGIPFDPLGPAVCRRARAVVLLGKTAGAIQRVIEEAAAREGRRPVVRRVGSL
FT                   EEAVAEARRLARPGDVVLLSPACASYDMFRDYVERGQRFKELVRALG"
FT   gene            complement(417057..417548)
FT                   /locus_tag="Tmar_0355"
FT   CDS_pept        complement(417057..417548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1874 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50478"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG61"
FT                   /protein_id="ADU50478.1"
FT                   /translation="MPPSPRLRLLAALAVGAFLGAGLTLPLTARRVDTLTLLATDLLRE
FT                   LAEAENELARLREEPPGSVAVYETRLELVGGRGQRLPQATEIVLRQQLEPLAQRLVGEN
FT                   VYDLSPAVVRDLFDQRRLQVDETLYRVTVESMVLGPRSLFRLRVEPVPTAPGAGGQDGT
FT                   "
FT   sig_peptide     complement(417462..417548)
FT                   /locus_tag="Tmar_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(417648..418007)
FT                   /locus_tag="Tmar_0356"
FT   CDS_pept        complement(417648..418007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bts:Btus_1024 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50479"
FT                   /db_xref="GOA:E6SG62"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG62"
FT                   /protein_id="ADU50479.1"
FT                   /translation="MARLSVGHLIYVACIAAGIVVGGSLAGGLARLLFVQVPLDAPSSL
FT                   PVGSLPDLANRLKLWGTFAALGGTLSALQNLESGILGRSFGVAAAQLLLILSAFTGAHL
FT                   AYVALRYLAGAPPGS"
FT   sig_peptide     complement(417930..418007)
FT                   /locus_tag="Tmar_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(418393..418725)
FT                   /locus_tag="Tmar_0357"
FT   CDS_pept        complement(418393..418725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmr:PMI0376 alanyl-tRNA synthetase; SPTR:
FT                   Alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50480"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG63"
FT                   /protein_id="ADU50480.1"
FT                   /translation="MLTEKLREAIRSGFELDEQVTFSELRSAAWMKTLAERGKLRVAPR
FT                   QEVVGVLLSPQAWEALRQLEAYVEELEERLEELEIERLWGDRLHHERRPAPIVAERLRG
FT                   LLRGEE"
FT   gene            complement(418776..419732)
FT                   /locus_tag="Tmar_0358"
FT   CDS_pept        complement(418776..419732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0358"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: bpf:BpOF4_16060
FT                   integrase family protein; PFAM: integrase family protein;
FT                   integrase domain protein SAM domain protein; SPTR:
FT                   Integrase family protein; PFAM: Phage integrase, N-terminal
FT                   SAM-like domain; Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50481"
FT                   /db_xref="GOA:E6SG64"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG64"
FT                   /protein_id="ADU50481.1"
FT                   /translation="MTPLPERAEQYLETKRVERGLRTSRLEEYRRDLADFCRWLAGRLR
FT                   KNPEDLTDADLAGFDRDGARRWLAHLADRELAPSTRDRRWSTVGGWFRWMVAEGVLPRD
FT                   PFAGLERPVRGERHKRLPVYLAETEAERLLRTVLSDEGLTPRQKAHHARLKERDHALVT
FT                   TLLYQGLRISEAVGLRYGDVDFDEDTLRVIGKGDKERLLPLHRRTKEALLRYLATWPGP
FT                   KKPKAPQDPLWWTLTGQPLTKNAAAVKRHLVRAGLWRASAHKLRHTFGTRLAEAGVDLL
FT                   VIKDLLGHATVATTQATTQIYAHVAQRRLREAVEKIR"
FT   gene            complement(419823..420071)
FT                   /locus_tag="Tmar_0359"
FT   CDS_pept        complement(419823..420071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0359"
FT                   /product="SpoVT/AbrB domain-containing protein"
FT                   /note="InterPro IPR007159; KEGG: ate:Athe_1988
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain-containing protein; SPTR: Transcriptional regulator,
FT                   AbrB family; PFAM: SpoVT / AbrB like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50482"
FT                   /db_xref="GOA:E6SG65"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG65"
FT                   /protein_id="ADU50482.1"
FT                   /translation="MAVARVQGRGQFTLPAAFRKAVGVKPGDVLLLEARDPGHFEVRVL
FT                   SRQSLLDFPRIDAEGFNMRSARDAMERALAEEAFESP"
FT   gene            420235..420594
FT                   /locus_tag="Tmar_0360"
FT   CDS_pept        420235..420594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0360"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="InterPro IPR006339: IPR007159; KEGG: tko:TK1076
FT                   SpoVT/AbrB family transcription regulator; PFAM: SpoVT/AbrB
FT                   domain-containing protein; SPTR: Transcription regulator,
FT                   SpoVT/AbrB family; TIGRFAM: transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT / AbrB like domain; TIGRFAM:
FT                   looped-hinge helix DNA binding domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50483"
FT                   /db_xref="GOA:E6SG66"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG66"
FT                   /protein_id="ADU50483.1"
FT                   /translation="MGTRGDRAVAIVKILQRGQMTLPKAIRERVGLEEGDDVLVYVNGQ
FT                   GEIVLYPLPRPRSLKELGNVLKIDRPVSPAEARQAIREHRTRRWAEKDGLEAAGTQGLA
FT                   QAAAGGEPAAERVRE"
FT   gene            420598..421032
FT                   /locus_tag="Tmar_0361"
FT   CDS_pept        420598..421032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0361"
FT                   /product="PilT protein domain protein"
FT                   /note="InterPro IPR002716; KEGG: gwc:GWCH70_3234 PilT
FT                   protein domain protein; PFAM: PilT protein domain protein;
FT                   SPTR: PilT protein domain protein; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50484"
FT                   /db_xref="GOA:E6SG67"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG67"
FT                   /protein_id="ADU50484.1"
FT                   /translation="MSTWLLDANVVVYCLAREHILANPQAAHLHERLEALDRALERAIA
FT                   AGHRLRITPVVVAETLYVLEGAYGYSPAEAVAALLQFVRAPEVDVEDEEAVLAGLRHHA
FT                   AGQLDFVDGYLAARTADEDVFLLTNDRAIARFTDARVVQW"
FT   sig_peptide     420598..420645
FT                   /locus_tag="Tmar_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            421086..421409
FT                   /locus_tag="Tmar_0362"
FT   CDS_pept        421086..421409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0362"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: nmg:Nmag_2925 transcriptional regulator, AbrB
FT                   family; SPTR: Transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50485"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG68"
FT                   /protein_id="ADU50485.1"
FT                   /translation="MGMATGQVIGPARVQAEGRLQIPAALLEALGIRPGDGLLFEAVGP
FT                   DEGRFWVIRSQPLEEFFDRHRIDEPVPERLWETAVDDMVRDVMGRNVGGGDADSAVDRG
FT                   EKP"
FT   gene            421563..422783
FT                   /locus_tag="Tmar_0363"
FT   CDS_pept        421563..422783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0363"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="COGs: COG3464 Transposase and inactivated
FT                   derivatives; InterPro IPR002560; KEGG: pmo:Pmob_1557
FT                   transposase IS204/IS1001/IS1096/IS1165 family protein;
FT                   PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; SPTR: Putative transposase; PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50486"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG69"
FT                   /protein_id="ADU50486.1"
FT                   /translation="MDKGIAMLLGLQSWILYRVHVQPDRIDVYTGRPRKEARCPACGSV
FT                   NRSVYDRCRQWQQKLHTWCNGLPVFLWVRPRRFRCRDCRKVFTERLPGLRPWARRTERA
FT                   EAQLLEELARRSFRGAAEATGTSPNTLRRLLLRRVKDGVGLERALQDLPEVVLGIDEHS
FT                   FRGRDMMITVTCVAPKRRLLALLPHDRVRLLEQFLRKLPASVRGKIRAVCIDLKEGWRR
FT                   AVERALPGVPVVADPFHVIQDANRRVDEARRVEQEVTGQRIPRWPLVKNEENLTDQQAA
FT                   QLAAIRKRHKNVAHFHWVKEQLRDVYRASSREEAAAILDRLILNAQEAEDAALVQWGRT
FT                   LRRWRTAILAFHEHQASNGYTEGVHTKIKLIKRLSYGFRNREAYVRKMLLAFLPLAGLT
FT                   ARPHFLT"
FT   gene            422798..423163
FT                   /locus_tag="Tmar_0364"
FT   CDS_pept        422798..423163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:386635 v-erb-b2 erythroblastic leukemia
FT                   viral oncogene homolog 3a; SPTR: Novel protein similar to
FT                   ErbB (V-erb-b erythroblastic leukemia viral oncogene
FT                   homolog, neuro/glioblastoma derived oncogene homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50487"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG70"
FT                   /protein_id="ADU50487.1"
FT                   /translation="MYPEEYRYAKWPEAYATNFPGTAYLNTQASDDETEENWTVGTLDA
FT                   GEFEPYVQYYADIIGSPDYPGTNWWKLYFELGVIDAPLCGITVSPEWCMLYPHDRYMRI
FT                   PFTYHYTFPGGIYWYGQ"
FT   gene            423280..423699
FT                   /locus_tag="Tmar_0365"
FT   CDS_pept        423280..423699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:373996 caveolin 1, caveolae protein,
FT                   22kDa; SPTR: Caveolin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50488"
FT                   /db_xref="GOA:E6SG71"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG71"
FT                   /protein_id="ADU50488.1"
FT                   /translation="MSRLKRVYWLAGLILVLTVAAFGLPLLFPDTTSSDISDAELHRKA
FT                   VHRLRVEIDSIYKINPAYLQIIEVRLASEQPPIEPEGVGVWRTLFGVPVGVVKYKLPDV
FT                   EFNLNTSRLGIVWGSFLLIQTLLARQLVVACRRAH"
FT   sig_peptide     423280..423381
FT                   /locus_tag="Tmar_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            424184..425254
FT                   /locus_tag="Tmar_0366"
FT   CDS_pept        424184..425254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0366"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR000257: IPR006361; KEGG: ttr:Tter_2590
FT                   uroporphyrinogen decarboxylase; PFAM: Uroporphyrinogen
FT                   decarboxylase (URO-D); PRIAM: Uroporphyrinogen
FT                   decarboxylase; SPTR: Uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); TIGRFAM:
FT                   uroporphyrinogen decarboxylase; methyltransferase,
FT                   MtaA/CmuA family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50489"
FT                   /db_xref="GOA:E6SG72"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG72"
FT                   /protein_id="ADU50489.1"
FT                   /translation="MTPSQRFLAACRRQPVDRTPVWFMRQAGRIFPEFRALRRQYGFVE
FT                   LMQHPDLCAEITVMPVERLGVDAAILFADIMTPLQPLGVDYRIEPGVGPVVGQPLAAAA
FT                   DLGRLRRFDPREELAPVLETVRLVRRALGDRVPLIGFAGAPFTLACYLIEGRPSREFHR
FT                   ARALMYGDPAFWHGLMERLAETVLDYLRAQVEAGVQAVQLFDSWVGGLGPAAYRRFVLP
FT                   YSRRVLEGLGDLGVPRIHFGTGNAALLPLMAQAGAEVVGVDWRVDLDRAWEAIGPDKAI
FT                   QGNLDPAALLAPFDQVEEQARDVLRRAAGRPGHIFNLGHGVLPETPVDHLRRLVELVHR
FT                   VTERPAEPEPEPVAGA"
FT   gene            425376..425807
FT                   /locus_tag="Tmar_0367"
FT   CDS_pept        425376..425807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0367"
FT                   /product="protein of unknown function DUF1094"
FT                   /note="InterPro IPR009474; KEGG: aac:Aaci_2088 protein of
FT                   unknown function DUF1094; PFAM: protein of unknown function
FT                   DUF1094; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1094)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50490"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG73"
FT                   /protein_id="ADU50490.1"
FT                   /translation="MSMEMLDMFFAPMREELVRLGFTELRTPEEVDAAMAEAGDDDVTL
FT                   VVVNSMCGCAGGIARPAVAMALEHERRPQRWLTVFASQDREATARMREYFTGQPPSSPS
FT                   IALLKGRQLVYMLHRSDIENRTAEEVAADLKAAFDRFCA"
FT   gene            425821..426312
FT                   /locus_tag="Tmar_0368"
FT   CDS_pept        425821..426312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0368"
FT                   /product="OsmC family protein"
FT                   /note="COGs: COG1765 redox protein regulator of disulfide
FT                   bond formation; InterPro IPR003718; KEGG: nhl:Nhal_0862
FT                   OsmC family protein; PFAM: OsmC family protein; SPTR: OsmC
FT                   family protein; PFAM: OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50491"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG74"
FT                   /protein_id="ADU50491.1"
FT                   /translation="MRHGTVRWQGGSRYVGANDLGLEVPFQGAPREGERREAPSPKDLV
FT                   LLGLGGCTAVDVVEILHKMRQPLGSLAIDLEAEEPDEHPKVFTQVRLVYRLEGHGLDPE
FT                   RAVRAVALSQQKYCGVSAMIGRTAAIHYAVEVNGQRVYEGTAGVGAATGEGVDGGGTPR
FT                   "
FT   gene            complement(426552..427442)
FT                   /locus_tag="Tmar_0369"
FT   CDS_pept        complement(426552..427442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0369"
FT                   /product="protein of unknown function DUF81"
FT                   /note="COGs: COG0730 permease; InterPro IPR002781; KEGG:
FT                   stp:Strop_3155 hypothetical protein; PFAM: protein of
FT                   unknown function DUF81; SPTR: Putative uncharacterized
FT                   protein; PFAM: Sulfite exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50492"
FT                   /db_xref="GOA:E6SG75"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG75"
FT                   /protein_id="ADU50492.1"
FT                   /translation="MHRLLVFALVGLIAQLVDGALGMAYGVTSSSLLLLYGLAPAAASA
FT                   SVHLAETVTTALSGFAHWRLGNLHRPTIRGLVIPGAIGAFTGAVLLSSLPAQRVRPVVA
FT                   GFLLMLGVYILVRFALAAVPRAQRPPRVRLRYVVPLGFVAGLLDATGGGGWGPIATPAL
FT                   MVRGNLPPHQVVGSVSIAEFVVAVSATLGFTLTLGWEAVAWAQVAALVAGGAVAAPLAA
FT                   WMARKLPAQVLGVMVGTAVLLVNLRTLFGAAGITGLARPVGYAVVAAVCLGLLVQVTVR
FT                   SRRAPVSQVQHPATD"
FT   sig_peptide     complement(427365..427442)
FT                   /locus_tag="Tmar_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428050..431787
FT                   /locus_tag="Tmar_0370"
FT   CDS_pept        428050..431787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0370"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0587 DNA polymerase III alpha subunit;
FT                   InterPro IPR006162: IPR003141: IPR004805: IPR004013: IPR
FT                   011708: IPR004365; KEGG: hmo:HM1_0084 DNA polymerase III
FT                   alpha subunit, putative; PFAM: DNA polymerase III alpha
FT                   subunit; PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; PRIAM: DNA-directed DNA polymerase;
FT                   SMART: phosphoesterase PHP domain protein; SPTR: DNA
FT                   polymerase iii alpha subunit, putative; TIGRFAM: DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain; Bacterial
FT                   DNA polymerase III alpha subunit; OB-fold nucleic acid
FT                   binding domain; TIGRFAM: DNA-directed DNA polymerase III
FT                   (polc)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50493"
FT                   /db_xref="GOA:E6SG76"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG76"
FT                   /protein_id="ADU50493.1"
FT                   /translation="MQPFVHLHVHSEYSLLDGAARVGELAARAAELGMPALALTDHGVM
FT                   YGAIDFYKACKKHGIKPIIGCELYLARRTRHDREPKVDDQSYHLLALAQNETGYRNLIK
FT                   IVSRAYAEGFYYKPRADKELLAEHSEGLIVTSGCIGSEIPRLLLEGREEEALKAVRWYL
FT                   EVFGDRFYFEIQDHGIPEERRAYARILELARRFDVPVVATNDVHYLHKDDAAAHEVLLC
FT                   IQTGKTLDDPHRMRFDGAEFYLKSPEEMAALFRDVPEALANTVQLAERCQLEFEFGRFL
FT                   LPHYEVPEGHDAASYLRYLCETKLPERYPDAGSEVWDRLNHELAVITRMGYPAYFLIVW
FT                   DFVDYARRNGIAVGPGRGSAAGSLVAYVLGITDIDPLRYNLLFERFLNPERVTMPDIDI
FT                   DFDDHRRDEVIDYVVRKYGRDRVAQIITFGRMLARAVIRDVGRVMGLPYGEVDKIAKMV
FT                   PAQLGITLDQALEASPELKQAYEQQPVVRQLVDMARKLEGMPRHASVHAAGVVIGRDPL
FT                   MEHVPLQRMQDGSTVTQFPMTTLEELGLLKMDFLGLRTLHVIQETEAIINTTGARDVLA
FT                   GESGGGGAEEPGAAPRFRVRDIPLDDPATFEAMSRGDTAAMFQVESSGFTQMLRSLRPS
FT                   SIEDLIAAVALFRPGPLGSGMVDDFIKRKHGQVPVEYPHPWLEPILKETYGTIVYQEQV
FT                   MQIASVMAGFTLGEADLLRRAMGKKKPEEMQKQREKFLAGAEAKGVDRKLAEHIFDLME
FT                   YFAGYGFNKSHSAAYGYLAYVTAYLKTHYPAPYMAATLSSVMSNSDRVAEYIGECRRLG
FT                   IPVLPPDINESQALFTVVPDPRAPGGQAIRFGLAAVKNVGFGAIESIVSAREQGGPFRS
FT                   LDDFCRRVDLRQVNRRALESLIKAGAFDSLGHPRARLLAGLEEVMERAQRWQKERETGQ
FT                   VSLLDLTAALVGAGGGSGAPGAAGAAAGAGAPEGFGSRAGGGRRRGKGAAPGGGAGASG
FT                   RTGAGAADPGGAGGLGPAGAGNGHDPARAAASLWGDEATELPPVEEWPPNRKLAMEKEV
FT                   LGLYLSGHPLAHYQRELARRVTATTRQLAEREDGARVQVGGLVQGVRRITTRSGELMAF
FT                   VQLEDLEGSVEVVVFPRTYGEAAEALQEDAVIVVRGRVDRREEEEPPKVVAEEIWPLVT
FT                   GKRLVVALPGGGPDAVEGVLARVRGACQRHPGTSPVVLVFPGREHALQVDAQYWVTPRA
FT                   ELFQDLARVVGDNGFYLDDH"
FT   gene            431815..432333
FT                   /locus_tag="Tmar_0371"
FT   CDS_pept        431815..432333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0371"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="COGs: COG1267 Phosphatidylglycerophosphatase A and
FT                   related protein; InterPro IPR007686; KEGG: gym:GYMC10_4936
FT                   phosphatidylglycerophosphatase A; PFAM:
FT                   phosphatidylglycerophosphatase A; SPTR:
FT                   Phosphatidylglycerophosphatase A; PFAM:
FT                   Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50494"
FT                   /db_xref="GOA:E6SG77"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG77"
FT                   /protein_id="ADU50494.1"
FT                   /translation="MAESVPKISAPVRLRADHRAEVIRRLERRGVTIRDIAEIVRSIQE
FT                   KYVPGITLEQCEASVEAVIAKREVQHALLTGIALDEAAEQGLLEEPLLSILRTDEPLYG
FT                   VDEVLALAITNVYGSIGLTNFGYLDKVKLGVIERLNNEKSQGRVQTFLDDLVAGIAAAA
FT                   AARIAHNEP"
FT   gene            432469..433761
FT                   /locus_tag="Tmar_0372"
FT   CDS_pept        432469..433761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0372"
FT                   /product="Domain of unknown function DUF2520"
FT                   /note="InterPro IPR018931; KEGG: dgr:Dgri_GH10507 GH10507
FT                   gene product from transcript GH10507-RA; PFAM: Domain of
FT                   unknown function DUF2520; SPTR: GH10507; PFAM: Domain of
FT                   unknown function (DUF2520)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50495"
FT                   /db_xref="GOA:E6SG78"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG78"
FT                   /protein_id="ADU50495.1"
FT                   /translation="MAEGAPAPAVLLIGPGRAGRALALGWHAAGVPVPWVVGRREEPAR
FT                   DLARAVGGRALSWEGLLDRGLPGPWPPVVVLAVPDRAVEPAAEALAGRLAAVPPGRRPR
FT                   YALHLSGALGLGPLASLERLGLAVEVFHPLLPLAGEPLPSGAAGPAGGRPGGPAGGLPA
FT                   TPPGGRPATPPGGPARRDPLAGAYVTVVYAPGQGRAPVGPALARALGATAVPWPGATGR
FT                   QLALYHAAATLAANGVTALLWAAEELLRHAGYPGVGGPAAGPAGSTGGGCPAGGGPAPS
FT                   ATAAATAPAGAAAAVPSGPAAAAPSGPAGRGDPARPPEGAGARAPLLALAGTALRAVAE
FT                   RGPLAALTGPITRGDAVTVARHLEALEALAPEAGSAGGLDPGPAGRYRLAAALVLAAAS
FT                   RAGAPRSGLDAVARLLGRRGDGPDGTGIGPG"
FT   sig_peptide     432469..432537
FT                   /locus_tag="Tmar_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433888..434838
FT                   /locus_tag="Tmar_0373"
FT   CDS_pept        433888..434838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0373"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="COGs: COG0413 Ketopantoate hydroxymethyltransferase;
FT                   InterPro IPR003700; KEGG: drm:Dred_0160
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase; PRIAM:
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; SPTR:
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; TIGRFAM:
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase; TIGRFAM:
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50496"
FT                   /db_xref="GOA:E6SG79"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG79"
FT                   /protein_id="ADU50496.1"
FT                   /translation="MNAGETAQGEGATARAAGPGSSATPASGRVTVRTVLESKQQGRPL
FT                   VMVTAYDYPFARLADAAGVDMILVGDSLGNVVLGYPTTVSVTLDDMVHHTRAVRRGVQR
FT                   ALLVADMPFLTFHLSVEEALRAAGRLVQEGGAEAVKLEGAGRVVEVVDRLTEAGIPVVG
FT                   HLGLLPQRVHALGGYRVQGRDEEEARRLLDDAVALEQAGCFALVLEMVPRELAALVSRR
FT                   LRIPTIGIGAGPDCDGQVLVLHDLLGLTQGRVPRFARRYAELGRLALEALQRYAADVRS
FT                   RAFPTDEHSYHMAAGVAERLQGPAGEEGEAPYGGS"
FT   gene            434879..435763
FT                   /locus_tag="Tmar_0374"
FT   CDS_pept        434879..435763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0374"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COGs: COG0414 Panthothenate synthetase; InterPro
FT                   IPR003721: IPR004821; KEGG: rca:Rcas_0333
FT                   pantoate--beta-alanine ligase; PFAM: Pantoate-beta-alanine
FT                   ligase; SPTR: Pantothenate synthetase; TIGRFAM:
FT                   pantoate/beta-alanine ligase; cytidyltransferase-related
FT                   domain protein; PFAM: Pantoate-beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50497"
FT                   /db_xref="GOA:E6SG80"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG80"
FT                   /protein_id="ADU50497.1"
FT                   /translation="MELVQDIAALRERIARWRREDPDGRVGFVPTMGYLHEGHLSLIRR
FT                   ARAECRRVVVSVFVNPLQFGPQEDFARYPRDLERDLRLAAGAGADLLFHPPVEAMYPHG
FT                   DPGVFVDVGDLARRWEGARRPGHFRGVVTVVTKLFHLVQPDRAYFGQKDAQQAVIVRRM
FT                   VADLNFPLEVVVCPTVREPDGLAMSSRNVYLDEDQRRAAPILYRALQAARRRLEAGERS
FT                   GPALVEAMEAVLGGQPLIDPEYAAVVDAATLEPLERVEGEVLLLVAARLGSTRLIDNLW
FT                   LVVEGDRVRDRWT"
FT   gene            436226..437398
FT                   /locus_tag="Tmar_0375"
FT   CDS_pept        436226..437398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0375"
FT                   /product="sporulation protein YhbH"
FT                   /note="COGs: COG2718 conserved hypothetical protein;
FT                   InterPro IPR014230: IPR006698; KEGG: sth:STH719
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF444; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   sporulation protein YhbH; PFAM: Protein of unknown function
FT                   (DUF444); TIGRFAM: sporulation protein YhbH"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50498"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG81"
FT                   /protein_id="ADU50498.1"
FT                   /translation="MPRGAIDWSLHRKGPVDQARHQEKVRAAIRENLADLIADDSLLTT
FT                   DGRRVVKVPVRSLREYRFRFSTRRNPQVGQGRGGSRKGDVLARQPGDPGGQGDPHAAGH
FT                   EPGMDYYETEVTLDELEAVLFEELELPNLQPRRQAVLDAQRPRFTEITRAGPLSRADLR
FT                   RALKENLKRHARQGQARLGPFHREDLRYRSWRDDPRPRTRAVVIAMRDVSGSMGESKKA
FT                   MSRTFFFWMNRFLESRYRDVQRVFITHHTEAQEVDEERFFHLGESGGTRVSSAYRLALE
FT                   IVAERYPPADWNLYAVHFSDGDNWGESDNGLCVQLVQELVEQASLFAYGEINESGYRSP
FT                   LWTAFERVRHPRFVRVKMTRREDIYPALRAIFRPNPADGAAGSETGGEGP"
FT   gene            437395..438657
FT                   /locus_tag="Tmar_0376"
FT   CDS_pept        437395..438657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0376"
FT                   /product="SpoVR family protein"
FT                   /note="COGs: COG2719 conserved hypothetical protein;
FT                   InterPro IPR007390; KEGG: tro:trd_A0873 stage V sporulation
FT                   protein R; PFAM: SpoVR family protein; SPTR: Stage V
FT                   sporulation protein R; PFAM: SpoVR like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50499"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG82"
FT                   /protein_id="ADU50499.1"
FT                   /translation="MTVAGITAAGPGADRLLPHLERIWAAARELGFDPLPIHFEVVPAP
FT                   VVYEVAAYGLPGRFTHWSHGKAYHLLKTRHDYGLHRVYELVIHAEPCQAFLLESNTFLE
FT                   NLFVAAHVVGHADFFHHNVFFRRAGRDMADLAAVHAERVRRYEYDHGVEAVERVLDAAL
FT                   ALEPHTDPWLRDADAIPPLRPDEPCEDVLLFIQHHAPDLEDWERDLLAMVRAERLYFWP
FT                   QVRTKVMNEGWACIAHTRILRRLDLSDGDYTEFARLHASIQAASPFAYNPYAVGYHTWE
FT                   RVLATRGWDEARFILDTEDDVAFLRNHLDRDVVEACNLYIYARQGDRWVVLEDDWEKVR
FT                   DLLVLSRVRGGFPLIAVVDGNYRGRGELLLRHIFDGRELDLDEARQALAHVERLWRRPV
FT                   HLETRADGRDVVLSVAAGDKG"
FT   gene            438664..440583
FT                   /locus_tag="Tmar_0377"
FT   CDS_pept        438664..440583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0377"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="COGs: COG2766 Putative Ser protein kinase; InterPro
FT                   IPR013153: IPR016230: IPR010650; KEGG: sth:STH788 serine
FT                   protein kinase; PFAM: PrkA AAA domain protein; PrkA serine
FT                   kinase; SMART: PrkA AAA domain protein; SPTR: Serine
FT                   protein kinase; PFAM: PrkA AAA domain; PrkA serine protein
FT                   kinase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50500"
FT                   /db_xref="GOA:E6SG83"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG83"
FT                   /protein_id="ADU50500.1"
FT                   /translation="MGTNLHELLRRHREDEARLGWEGTFADYLEIVRQRPQVARLSHAR
FT                   LFDMLKAAGVTEAQEDGDGGPRPRQIHFFDGQLFGLEEPLNQLYDYLESAARRLEVRKR
FT                   ILLLMGPVGGGKSTIVALLKRGLERYTRTDEGAVYALKGCPMHEEPLHLIPEPLRPTVS
FT                   RQLGVHIEGSLCPVCRYRLEHEFGGDVERFPVQRIVFSEAGRVGIGTFTPSDEKSQDIA
FT                   ELVGSIDLSTVGEYGTESHPLAYRFDGELNVANRGLMEFVELLKAQTEFLYALLTLSQE
FT                   QSIKTGRFAMIYADEVVIGHTNEAEYQAFVKNQRNEALIDRMILIKVPYNLRLSEEVKI
FT                   YRKLLAESDLQGVHIAPHTLEVAAMFAILTRLEPPKHPNLTLMKKLRLYDGQPVEGFSP
FT                   RDVREMREGAEREGMTGVSPRYVINCLSSAVIRAENNCLGPLAALRALRDGLDHHTGLT
FT                   KEQRERYLNLIHETRREYDEIAKNEVNRAFVYSFEETARNLFNNYLDHIEAYCHKTKLR
FT                   DPITEEERDPDEKLMRSIEEQIGVPESAKKAFREEILLRLSALARRGQKFDYTSHDRLR
FT                   EALEKKLFSDLRNVVKITTSATHPDEEQLKRINQVVQRLCERQGYCPACANEVVRYVGQ
FT                   LLGR"
FT   gene            complement(440717..441367)
FT                   /locus_tag="Tmar_0378"
FT   CDS_pept        complement(440717..441367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drt:Dret_1526 TspO and MBR like protein; SPTR:
FT                   Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50501"
FT                   /db_xref="GOA:E6SG84"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG84"
FT                   /protein_id="ADU50501.1"
FT                   /translation="MTAHGGLLAIPLHELTEAGLLAAGFALHSIGIPLTTVALFTLLTA
FT                   WAAQTDAGWLVAGGLAAAATLAGHALVLGLGRWWGWRGIAAAQQRWGSMQRVAERVDRL
FT                   ARSPSGWAVLTAWRWLGPGFAQAFWVLCTLPRWDRTLAALLAYLALHDVVWSFAWTYAL
FT                   VVLHLRAPAVAVWLDRLAWALLAGTLIWTLASRRRGRRPAAGSSRWGGAPAPR"
FT   gene            complement(441676..441882)
FT                   /locus_tag="Tmar_0379"
FT   CDS_pept        complement(441676..441882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0379"
FT                   /product="protein of unknown function DUF1657"
FT                   /note="InterPro IPR012452; KEGG: bpf:BpOF4_14985
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1657; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1657)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50502"
FT                   /db_xref="InterPro:IPR012452"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG85"
FT                   /protein_id="ADU50502.1"
FT                   /translation="MTVGSQMQQTLASAESILADLKSYQLETQDQQAKQLFQNLANQME
FT                   QTVNGLKQRLQQIQQQEPQYRQK"
FT   gene            441976..443025
FT                   /locus_tag="Tmar_0380"
FT   CDS_pept        441976..443025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0380"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="COGs: COG0205 6-phosphofructokinase; InterPro
FT                   IPR000023: IPR015912: IPR012828: IPR012003; KEGG:
FT                   sth:STH837 6-phosphofructokinase; PFAM:
FT                   phosphofructokinase; SPTR: 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: Phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50503"
FT                   /db_xref="GOA:E6SG86"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG86"
FT                   /protein_id="ADU50503.1"
FT                   /translation="MEGSGEDAAGGSIAVRPQPVEALGKGEGSRVKRIGLLTSGGDAPG
FT                   MNAAVRAVVRRALAAGCVAVGVQEGYAGLIEGWMEELDHRAVGDIIHRGGTILRTARSE
FT                   AFRTPEGQERALEQLRRHAIDGLVAIGGDGTLRGALALHRRGFPVVGIPATIDNDLAGT
FT                   DVTIGFDTAVNTVLEAINRVRDTATAHGRTFVIEVMGRHSGQIALMAGLAGGAESILVP
FT                   EVPYDLDDVCARLLRGRQRGKRHSIIVVAEGAARGFEVAQAIEARTGLETRVTVLGHIQ
FT                   RGGTPSGRDRLVASILGAAAVEVLLQGQSGVMVGVRGDGWVATPIDQILATPRPLPEGW
FT                   IQLAEVLAR"
FT   gene            443048..444901
FT                   /locus_tag="Tmar_0381"
FT   CDS_pept        443048..444901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0381"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="COGs: COG0469 Pyruvate kinase; InterPro IPR015793:
FT                   IPR001697: IPR015794: IPR008279; KEGG: adg:Adeg_0440
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; PEP-utilising protein mobile region;
FT                   SPTR: Pyruvate kinase; TIGRFAM: pyruvate kinase; PFAM:
FT                   Pyruvate kinase, barrel domain; PEP-utilising enzyme,
FT                   mobile domain; Pyruvate kinase, alpha/beta domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50504"
FT                   /db_xref="GOA:E6SG87"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG87"
FT                   /protein_id="ADU50504.1"
FT                   /translation="MEFRRTKIVCTLGPSTDDPAVLRRLLQAGMDVARINLSHGTAADH
FT                   RRRVETLRAVAQEMGRHDVGILFDTRGPEVRVGALPGGALDLAAGQRVALVAAGHGEAG
FT                   AAPDGGPGGPAPAGSSASAGPVAAPGAAPAGCPVIPVSYSRVATSVGPGDRILLDDGNL
FT                   VLTVEDVDGVYVYCRVDAGGRLLQGKKATLPAESLDLPYLSEADRDDVRLGIELGIDFI
FT                   AASFVRSAADVHALRRVIEEAGGDQWVIAKIENRLGVERLDEILASADGIMVARGDLGV
FT                   ELPVEDIPLLQKQIIQAANRAGKPVITATQMLESMVRHPRPTRAESTDVANAIFDGTDA
FT                   VMLSAETAAGDYPVEAVEIMARIARRTETALDYGRRLARLAGQEHRTVTDAVSYASCTA
FT                   AESLGAAAILTATQSGYTSRMISRHRPRQPIVALTPSQRVARKLSLVWGVRALVIEPRD
FT                   SVDGLIDRALQGAVDGGFVRPGDLVVITAGVPVGQPGTTNMLQVHTVGEAVLRGTGVGQ
FT                   GSHTGPVRIVRDPEAAGPFHGGEVLVALSTDRDFVPLIEKAGALITEEGGLTSHAAIVG
FT                   LHRGIPTIVGAAGALETLKDGETVTVDARRGLVYRGWARVG"
FT   gene            445101..446204
FT                   /locus_tag="Tmar_0382"
FT   CDS_pept        445101..446204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0382"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002744: IPR019591; KEGG:
FT                   tte:TTE0119 chromosome partitioning ATPase; PFAM:
FT                   ATPase-like, ParA/MinD; protein of unknown function DUF59;
FT                   SPTR: ATPases involved in chromosome partitioning; PFAM:
FT                   ParA/MinD ATPase like; Domain of unknown function DUF59;
FT                   ATPase MipZ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50505"
FT                   /db_xref="GOA:E6SG88"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG88"
FT                   /protein_id="ADU50505.1"
FT                   /translation="MSEVTREQVLSALAQVKDPELNRNLVELNMVRDLQIEGGRVEVEI
FT                   ALTVRGCPLRYEIKKDVESKLQAIPGVTETVVHLGAMTDEERQQLIEKFRQPRQPKSRI
FT                   MADDSQTVILAISSGKGGVGKSTVTANLAAALRALGYKVGVLDADIYGFSIPGMLGIEG
FT                   RKPVAFNKAIVPIPAHGMQVMSMGFFVEADTPLIWRGPMLMGAVEQFLADVLWDDLDFF
FT                   LIDLPPGTGDVPLSIMQKLPRAQIVVVTTPQPASVTVAQRTGIMARKVQHEVLGVIENM
FT                   SYLVCSKCGQRHEIFGRGGGRELAEKLGTRLLGQLPIQEELREAADAGKPVALFAPDSQ
FT                   VARAFLELAGRIAELTLPAERVAAASR"
FT   gene            446576..447553
FT                   /locus_tag="Tmar_0383"
FT   CDS_pept        446576..447553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0383"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; KEGG: aac:Aaci_2807
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Prolyl oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50506"
FT                   /db_xref="GOA:E6SG89"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG89"
FT                   /protein_id="ADU50506.1"
FT                   /translation="MRGASGGLGAGTGRMPAARRWVGRGLALLVLLAAAACVAISWQVG
FT                   LGLIHPDREPVTTDPSSRGLAFEDVQFTSRDGVRLEGWFLPAAGGVASRTVIFAHGYGK
FT                   NRLQDDVPALDVAAALVRQGFNVLMFDFRNSGESGGDRTTVGQEEVQDLAAAVEWVRRT
FT                   HGADQAVGLLGWSMGAVTAILTAGGVEPVQAVVADAPFADLRVYLEENLSHWTGLPEFP
FT                   FNWLIRTLLPPLVDVHPDRVRPVEAVTRMAPTPLLLIHGTADTVIGPQHSRQLQLVAQR
FT                   SGVPVELWEVEGAGHVKAYATAPEAYLERVVTFFDTHLPARGGR"
FT   sig_peptide     446576..446680
FT                   /locus_tag="Tmar_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            447861..449081
FT                   /locus_tag="Tmar_0384"
FT   CDS_pept        447861..449081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0384"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COGs: COG0527 Aspartokinase; InterPro IPR018042:
FT                   IPR005260: IPR001341: IPR001048: IPR 002912; KEGG:
FT                   adg:Adeg_0884 aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; SPTR: Aspartokinase; TIGRFAM: aspartate
FT                   kinase; aspartate kinase, monofunctional class; PFAM: Amino
FT                   acid kinase family; ACT domain; TIGRFAM: aspartate kinase,
FT                   monofunctional class; aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50507"
FT                   /db_xref="GOA:E6SG90"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG90"
FT                   /protein_id="ADU50507.1"
FT                   /translation="MSLWVWKFGGSSVAGPDRIRHVARRVAEARREGHDLVVVVSAMGD
FT                   TTDDLIALARQLHPEPPARELDALMATGEQASAALLAMALDALGVPARSFTGWQAGIQT
FT                   EGPHGSAQVRAIAPERLREALKAGFVPVVAGFQGLSAEGHVTTLGRGGSDTTAVALAAA
FT                   LQAERCEIFSDVEGVFTADPRVVPDARLLPVISYDEMMELARLGAQVLHHRAVTCAQHN
FT                   GLIIHARSTFSDHPGTRVVPADTIEPDRPVSGVTSDRHVARLALVSVPNVPGIAHRVFS
FT                   ALAEAGINVDMISQSVARNGHQDIAFTISDGHLAVARRILEPVVRELPAERLVVDDRIA
FT                   KVSAVGAGMVTQPGVAATMFGALAGAGINIEMISTSEISISCLVAREQVDDAVRAVHAA
FT                   FGLGAER"
FT   gene            complement(449422..449967)
FT                   /locus_tag="Tmar_0385"
FT   CDS_pept        complement(449422..449967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0385"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020084: IPR000086; KEGG: bcb:BCB4264_A3077
FT                   phosphohydrolase; PFAM: NUDIX hydrolase; SPTR:
FT                   Phosphohydrolase (MutT/nudix family protein); PFAM: NUDIX
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50508"
FT                   /db_xref="GOA:E6SG91"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG91"
FT                   /protein_id="ADU50508.1"
FT                   /translation="MTTPTPRHVFEVFTLGFLVRDGQVLLLERRKPPNAGRWNAPGGKL
FT                   EAGEDPIQGVVREFAEETGLVLQDPVLRAILCFHELDGRWRPQMIYTFLARRATGDLLA
FT                   SDEGRLAWWPVEKVLRDPRVVGNIPLFLPRMLEAEPPFVFIAAYRGERLESYRVAPLLS
FT                   PPVAVAPTPGGSGPQRGG"
FT   gene            complement(450094..451194)
FT                   /locus_tag="Tmar_0386"
FT   CDS_pept        complement(450094..451194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0386"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COGs: COG2514 ring-cleavage extradiol dioxygenase;
FT                   InterPro IPR004360; KEGG: tro:trd_1850 glyoxalase family
FT                   protein; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; SPTR: Glyoxalase family protein; PFAM:
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50509"
FT                   /db_xref="GOA:E6SG92"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG92"
FT                   /protein_id="ADU50509.1"
FT                   /translation="MNHSPTPQAALPADIRLGPVYLRVRQLARVLPFYRDLLGLVPSPA
FT                   PGVAGSTAGAASQGGAGTPGGAAAGDAGRVGTADHAGGLGRTGDAGVPEGSQSPAGPPR
FT                   PVASAPGNGSSHPPVWLAAAAGGPPLLCLEESPGAPPRPPRTTGLYHVALLYPGRADLA
FT                   RAFLRLVQGRWRFQGFADHGVSEAIYLADPEGNGLELYADRPRDQWPRRNGGIAMYTAP
FT                   LDLEDLVAAAGGTRPDAGPDGAGDPPRGPVVGHVHLQVSRLQTVEAFYCGVLGFEVTQR
FT                   DFPGALFVAAGGYHHHLGLNVWAGEGAPPPPPGAAGLAGFTIQLPTAADLKAVLDRARA
FT                   AGHEAEPSPRGWVLRDPDGIPVFLTT"
FT   sig_peptide     complement(451168..451194)
FT                   /locus_tag="Tmar_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            451426..453255
FT                   /locus_tag="Tmar_0387"
FT   CDS_pept        451426..453255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0387"
FT                   /product="thymidylate synthase complementing protein ThyX"
FT                   /note="COGs: COG1351 alternative thymidylate synthase;
FT                   InterPro IPR003669; KEGG: bts:Btus_2355 thymidylate
FT                   synthase complementing protein ThyX; PFAM: thymidylate
FT                   synthase complementing protein ThyX; SPTR: Thymidylate
FT                   synthase complementing protein ThyX; PFAM: Thymidylate
FT                   synthase complementing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50510"
FT                   /db_xref="GOA:E6SG93"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG93"
FT                   /protein_id="ADU50510.1"
FT                   /translation="MPTASSRYTPRQRALLARYVSNLDGNVYAIYNLPEEVVAVIFAYV
FT                   SRSPRSFRENLLRLMEDPELDLLAGLPAQPQAVPAPGLDQVAAAAEPDADGGPAGVAVL
FT                   PPGAGAGDLAGSAAPEAAAAEGAATAAGSVAIAAEKARKFHEKWVVGYGHASVAELAKA
FT                   AVGIEGISRLASARLETANPWLSFIEYSQRYQMPARGAYVVPPELEAAGDPELLAAFHR
FT                   VQDVTYGAYEELFRGLVAYLERAEPARAGETPKARRSRLEKQAFEDARYALTLAVQTNL
FT                   GMVGNGRALRDAIVRLLSDPYEETTRLALAIRAEVTKVLPTLVRYAEPNPRIRAGEAAV
FT                   ARGVDEALRRYRDVRAVASDPVLLLDWTGRGAGNGAPAGGPGPVPPASDGGRRAPAPTT
FT                   PDEQAALDVILGAWLAEFGSGGWPETADVLARMTPAEKIALYARAVEGLGPHDPPPDAL
FT                   KFVRYRVEFTVSEANWHQLLRHSRRMHFAAQAPGIEHGITVPPRVQEAGLAPVLMRAVD
FT                   AAERLFFRLVRDGLPLAAHYVVTNAHRRRVQAEFDLWQLYHLITLRGKPEAQWDIRRTV
FT                   HELARRVMAVHPNLVRCVPRLMAVLEGPGAGRP"
FT   gene            453367..453453
FT                   /locus_tag="Tmar_R0027"
FT   tRNA            453367..453453
FT                   /locus_tag="Tmar_R0027"
FT                   /product="tRNA-Leu"
FT   gene            453669..454565
FT                   /locus_tag="Tmar_0388"
FT   CDS_pept        453669..454565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0388"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107; KEGG:
FT                   gwc:GWCH70_0387 band 7 protein; PFAM: band 7 protein;
FT                   SMART: band 7 protein; SPTR: Band 7 protein; PFAM: SPFH
FT                   domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50511"
FT                   /db_xref="GOA:E6SG94"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG94"
FT                   /protein_id="ADU50511.1"
FT                   /translation="MKETRAWALPGIVGLVLALALGGAAVYLFIRGVSALESGAVPVLG
FT                   HGGVDVTAGVLALIAAIIVASGMLIVQPNYSRSVVFLGRYLGTLREPGWWWTVPLTSQP
FT                   AVSLRVRNFESEKIKVNDLRGNPIQIAAVVVWRVVDAARALFEVDKYEEFVKIQSETAL
FT                   RHIASQYPYDTFEDHSATSLRENTDIVSQALAQELQERLAVAGVEVLDARLTHLAYAPE
FT                   IAHAMLQRQQAEAVVAARAKIVEGAVGMVQMALAELQRHGVVELDDERRAAMINNLMVA
FT                   IVGERAAQPVINTGTLY"
FT   sig_peptide     453669..453773
FT                   /locus_tag="Tmar_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            454736..455065
FT                   /locus_tag="Tmar_0389"
FT   CDS_pept        454736..455065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0389"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4877 conserved hypothetical protein; KEGG:
FT                   msv:Mesil_0344 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50512"
FT                   /db_xref="GOA:E6SG95"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG95"
FT                   /protein_id="ADU50512.1"
FT                   /translation="MQPGSGAAVRRPAGMTPASGREREVTLVPEKKRFLLRIDPVIYDA
FT                   IQRWAADEWRSVNGQIEYLLREALRRAGRLPAPVRGGRAQQDSGPPAGDSEGEGGSPPP
FT                   GTRGR"
FT   gene            complement(455197..455964)
FT                   /locus_tag="Tmar_0390"
FT   CDS_pept        complement(455197..455964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0390"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347: IPR002198: IPR020904;
FT                   KEGG: rxy:Rxyl_0373 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50513"
FT                   /db_xref="GOA:E6SG96"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG96"
FT                   /protein_id="ADU50513.1"
FT                   /translation="MEAKGATFLVTGGGSGLGAATAELLAESGAHVIIADINRQAGEAV
FT                   AGKIGERARFVPTDVTDPDSVQQAVRTAVESFGGLHGAVNCAGIAIAEKVLGREGPHDL
FT                   DRFRRVIEVNLVGTFNVIRLAAAVMAQQEPNAEGERGVIINTASVAAFDGQIGQPAYSA
FT                   SKGGVAAMTLPIARELARYGIRVVAIAPGIFDTPMMAGLPEPARKSLEQQVPFPQRLGR
FT                   PREYALLVRHIIENPMLNGEVIRLDGALRMGPR"
FT   sig_peptide     complement(455887..455964)
FT                   /locus_tag="Tmar_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(456059..457219)
FT                   /locus_tag="Tmar_0391"
FT   CDS_pept        complement(456059..457219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0391"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR020613: IPR002155: IPR020616: IPR020617; KEGG:
FT                   rxy:Rxyl_2360 acetyl-CoA C-acyltransferase; PFAM:
FT                   Thiolase-like; PRIAM: Acetyl-CoA C-acyltransferase; SPTR:
FT                   Acetyl-CoA C-acyltransferase; TIGRFAM: acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase, C-terminal domain;
FT                   Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50514"
FT                   /db_xref="GOA:E6SG97"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG97"
FT                   /protein_id="ADU50514.1"
FT                   /translation="MGEPVLIGGVRTAFGRRDGVHRATRPDKLLSLALRGLVERTGLDP
FT                   AAVDDVITGCVTQTGEQGANVGRLGVLLAGFPVRVPAVSLNRMCGSSQQAIHFAAQAVA
FT                   AGDARYVIAAGVESMTRVPMFSDIRGGFETLNPELRERYELIHQGESAERIAERWGITR
FT                   QEADAFSAESHRRASAAARAGKNREIVPVEGLDAEGNPVTVTRDEGIRDRIDPARMAAL
FT                   PTVFRPEGRGIVTAGNSSQISDGASAVLVADREAALADGLRPKARFRARVVVGDDPTMQ
FT                   LTAVIPATRLALQRAGLTLRDIDWIEINEAFATVVLAWAREFDPDMERVNPWGGAIAHG
FT                   HPLGATGAGLMAKMLAGLEATGGQFGLQVMCIGHGMATATIIERLD"
FT   gene            457459..458679
FT                   /locus_tag="Tmar_0392"
FT   CDS_pept        457459..458679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0392"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="InterPro IPR003346; KEGG: pth:PTH_2396 transposase
FT                   and inactivated derivatives; PFAM: transposase
FT                   IS116/IS110/IS902 family protein; SPTR: Transposase and
FT                   inactivated derivatives; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50515"
FT                   /db_xref="GOA:E6SG98"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG98"
FT                   /protein_id="ADU50515.1"
FT                   /translation="MLRVGIDQASQHHDVCLASAGQAPSYLRVPNDADGLEELLAAIRR
FT                   REPDPAQVHVAIEGSGQGLFVAALLATGFQVYPVNPKAVDRYRDRLSPAGSKDDRRDAL
FT                   VLAEILRTDRHRLQPLRLESDTLRQLRVVYSHHQTLVEERTRLLNQLIACLRTYYPRAL
FT                   ELFADLGRPVAWTFLRTFPTPAHFARARRSRIEKLLRQHRYPGVAAKTAELLELARKPQ
FT                   LPADPATVALWARRMLFLVDQLEAVGRELEACHQQLEALVQAHPDGDLFRSVKGIGTVL
FT                   AAGVITVFGEDRQAVPSVRPVQCRSGTAPVTVRSGKTVRVRFRRACNKQARNTLQLLAQ
FT                   QLVLHHAWAREIYQAHRDRGRHYHEALRIVAHHALRVLFAMWRDRQPYDPTRFEAARRQ
FT                   RQEPKAA"
FT   gene            complement(458932..460601)
FT                   /pseudo
FT                   /locus_tag="Tmar_0393"
FT   gene            complement(460760..462400)
FT                   /locus_tag="Tmar_0394"
FT   CDS_pept        complement(460760..462400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0394"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020845:
FT                   IPR000873; KEGG: sti:Sthe_2920 AMP-dependent synthetase and
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   AMP-dependent synthetase and ligase; PFAM: AMP-binding
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50516"
FT                   /db_xref="GOA:E6SG99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6SG99"
FT                   /protein_id="ADU50516.1"
FT                   /translation="MLQGLMMDFPLTLLTIFRRAEALFGHREIVTRLPDKSFHRYTYRD
FT                   FTQRARRLAVALQELGVGRGDRVATLMWNQYQHLEAYFGIPAAGAVLHTLNLRLHPSEL
FT                   AYIVQHAGDKVLIVDRTLLPLYQQFKDHVQLEHVIVVGGSVPAAAGPDGGTLLDYEELL
FT                   AAADPSRYREPDLDEREAAAMCYTSGTTGRPKGVLYSHRALVLHSLGTALPDGVGIGEA
FT                   DCCLPVVPMFHANAWGMPFTATMVGAKQVFPGPHLDPVSLLEDFAQERVTVTAGVPTIW
FT                   LGILQELDKNPGRWDLSSLRAMLIGGSAAPKGMIRGFQERHGLRVVHGWGMTETSPVGT
FT                   ISRLPADLAGAPADVQYEVRAKQGRPLPLVEIRARNEQGIVPWDGQTMGELEIRGPWIA
FT                   AAYYNAPEAADRWTDDGWLRTGDIVTIDPRGFVEIKDRDKDLVKSGGEWISSVALENEL
FT                   MAHPAVAEAAVIAVHHPKWQERPLAVVVLKEGHTATKEELIEFLRPKFAKWWLPDDVVF
FT                   VPEIPRTSTGKFLKAALRERFRDHLVAGG"
FT   sig_peptide     complement(462335..462400)
FT                   /locus_tag="Tmar_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(462382..463526)
FT                   /pseudo
FT                   /locus_tag="Tmar_0395"
FT   gene            complement(463724..464737)
FT                   /locus_tag="Tmar_0396"
FT   CDS_pept        complement(463724..464737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0396"
FT                   /product="esterase"
FT                   /note="COGs: COG0627 esterase; InterPro IPR000801; KEGG:
FT                   ttr:Tter_0425 putative esterase; PFAM: esterase; SPTR:
FT                   Putative esterase; PFAM: Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50517"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA0"
FT                   /protein_id="ADU50517.1"
FT                   /translation="MHRSLYPPFQAVEYRHRSRVLEGNPWDDPVERSLWVLVPPDGLPA
FT                   GPVPCIWVLSGFGGTGPRLLNYDPWEENLPERLGRLYAEGRIGPAVFALPDCFTFLGGS
FT                   QYLNSPAVGRYEDYLVQELVPLVEQHYRVRAHGVVGKSSGGYGAFIQAARHPELFRACA
FT                   CHSGDMAFEYCYLPDFPKFLRHLDQLGGLDAYLEAYRQMRARGQGPGGPWHASLNVLAM
FT                   AACYSPDPEAPYGIALPVDLETGALRPEVWERWLALDPVRLAPRVAGALQSLRLLYVDC
FT                   GRQDEFNLLWGARQLHRLLQQLGIPHVYEEFDGGHFGTAHRYDVSLPLLYRALAEA"
FT   gene            464908..466074
FT                   /locus_tag="Tmar_0397"
FT   CDS_pept        464908..466074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0397"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro IPR002328: IPR013154:
FT                   IPR013149; KEGG: tye:THEYE_A0455 sorbitol dehydrogenase;
FT                   PFAM: Alcohol dehydrogenase GroES domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; SPTR: Sorbitol
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES-like
FT                   domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50518"
FT                   /db_xref="GOA:E6SGA1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA1"
FT                   /protein_id="ADU50518.1"
FT                   /translation="MLQGYLAGIRRLTLRQVPVPEPGPGEVVVRIRRALTCGTDLKTFR
FT                   RGHARLPVPGPFGHEASGVIHAVGEGVQRFRPGDPVMWVPTAPCGACPPCRRGQENLCQ
FT                   RLFEPERMALGAYAEFIRLPAPIVARHLFPKPEHLTFEQAAFLEPLSCVVRGWRRLGRP
FT                   EEVVVIGTGTIGLLHVMVARALQVPRIVAVGRRPAGLELARQAGATETLAADAQDAAPQ
FT                   VRALFGGEGPAAVIEATGRAEGWQAAAQWVRPGGRVLLFGGLAGGTWVHFEAFRLHYEE
FT                   VDLIGSFHYTPADVRESYDLLARGRLPVEMLITHRRPLAELPAVFQALDRGEAIKVALI
FT                   PDGDEPADGTDPGADAAGASLGGGQDPAAGARPPQGGTPRDAAELGAG"
FT   gene            466166..467491
FT                   /locus_tag="Tmar_0398"
FT   CDS_pept        466166..467491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0398"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR013154: IPR013149; KEGG: tye:THEYE_A1024
FT                   sorbitol dehydrogenase; PFAM: Alcohol dehydrogenase GroES
FT                   domain protein; Alcohol dehydrogenase zinc-binding domain
FT                   protein; SPTR: Sorbitol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50519"
FT                   /db_xref="GOA:E6SGA2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA2"
FT                   /protein_id="ADU50519.1"
FT                   /translation="MAESAASRAPAGPVLPERMRAARLDARGRVEIAEMPVPRPGPGEA
FT                   LVRLRACGICSSDLLDWYVAGKARGGPFVFGHEPAGEIVAFGPGTQPPPGLEVGSRVFV
FT                   HHHAPCMACAACRRGDYVHCPVWRRPGLIPGGMAEYAVVAPQVLQHDTLPLPEGAGWEV
FT                   GVLVEPVACAVHALRRAGFEPGWRVAVIGAGFMGQALGLVARAWGAAERAVVDRLPGRL
FT                   AWAARRWATLVIDTGDEGRPGAVAGGAGGGPGMEPAATADGHAGERAAGNRGGGTPAGT
FT                   GRAGTGPGAVAAATGGGGGGRATPVPWLRPGPGADAQAVARMLEDRWGEGADLVLVTPA
FT                   GEEPLRLGIACARPGGTVVMFAPTAPGCDPAIPGYDVFFREIRLVPSYSAGPGDTRDAL
FT                   ALLAAGQVPAAELVTHRYPLADVATAYRQVKDPAALKVMVEL"
FT   gene            467564..468169
FT                   /locus_tag="Tmar_0399"
FT   CDS_pept        467564..468169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0399"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR013096; KEGG: aeh:Mlg_1167 cupin 2
FT                   domain-containing protein; PFAM: Cupin 2 conserved barrel
FT                   domain protein; SPTR: Cupin 2, conserved barrel domain
FT                   protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50520"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA3"
FT                   /protein_id="ADU50520.1"
FT                   /translation="MDERAAAAVPAVATPPAPEGGEPAGRSQGEAAPAGGLPAVNRPLT
FT                   AEEFARLRVRRFDPATFRWEGIPDQVYQGPADPALGFRDVIRRTLVPGGATPAAFEVRY
FT                   FEVAPGGYSRLELHQHVHAVLILRGEGEVQVGDQVYTVRPFDLVYVPPETPHQFRHRGG
FT                   EGDEPFGFLCVVDAQRDRPRPLEPRAGGHGSRPGASPR"
FT   gene            complement(468333..469829)
FT                   /locus_tag="Tmar_0400"
FT   CDS_pept        complement(468333..469829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lma:LmjF35.0290 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50521"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA4"
FT                   /protein_id="ADU50521.1"
FT                   /translation="MHILVRHRWRFEVDPDGAPGWAAVLECLGHRVYLGDDHRHAAVDS
FT                   ALHGRVVILRVVGSGRDRGTAGTAPKTTAGGLPGRTAPAALATLLAGVLQQSGATVVLG
FT                   DAGSPAPAAPGATGTAARIAADVLLTLHLDDIALRARVATAGRHPWPAWRLGRHLARGL
FT                   WRAGCVPVQQRHWPGPAPALILHNPLAPGKPAWAASSTAVPGVDAMGALVVAPRVAATV
FT                   HLPEGWPAEMVATAVYRGLTAFFGGPTHAVVPWPAASPAPATARHHPATAGCPHAAGSD
FT                   PHAGPPAGSSPRTGPEHRPGGEGDAAPDEPAEAAASALAAARAEAESAEGRVAAEGQAT
FT                   AEEGAPPAEETAAGPESAPPDPVPVDRDTRETGTEAGATPVEPAARRAAPPAGPAGATS
FT                   APARTPRRRLARGRMPVPPRAVPGLPPGALPPGARAGYLFAPSRPGGGVSPAPPPPRPE
FT                   TGMPDPDRPAAGSSRPGRFGRGAVPSFATGRAPGSLQPFR"
FT   gene            complement(470051..470716)
FT                   /locus_tag="Tmar_0401"
FT   CDS_pept        complement(470051..470716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_4048 protein of unknown function
FT                   DUF214; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50522"
FT                   /db_xref="GOA:E6SGA5"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA5"
FT                   /protein_id="ADU50522.1"
FT                   /translation="MRRPPEVQPGRLRSDGCLPGDRRVRPRPVWLRRRLVMLAKSRAAG
FT                   RAGANPTRSRAKELTVVSRVPTASTPRVVTAGLIAGLVQIATVYVLQPILGTQRGVFSR
FT                   FVADGLGIGDGRIMAQAAMSAGGLAALLVAAVLWALVYRAIAPAGNAVTGMAFGLAVWV
FT                   AGALVVLPLLSAVGAAPSPGFLGTGFSGARSALVAAIAHLVYGGVLGGLLAVPRQAEV"
FT   sig_peptide     complement(470570..470716)
FT                   /locus_tag="Tmar_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            470794..472209
FT                   /locus_tag="Tmar_0402"
FT   CDS_pept        470794..472209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0402"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="COGs: COG1612 Uncharacterized protein required for
FT                   cytochrome oxidase assembly; InterPro IPR003780; KEGG:
FT                   sti:Sthe_3102 cytochrome oxidase assembly; PFAM: cytochrome
FT                   oxidase assembly; SPTR: Cytochrome oxidase assembly; PFAM:
FT                   Cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50523"
FT                   /db_xref="GOA:E6SGA6"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA6"
FT                   /protein_id="ADU50523.1"
FT                   /translation="MARKNRASGETAVEDGGRPAGRRTPSTGAVRGDAARGRDSRPAPA
FT                   GRRAHRGLRALAATATITLFLVVVAGALVSATGSGEGCGRSWPLCGSPVWTVAAVIEFS
FT                   HRIVSGVAALAVVALAAVAPRRLGGRRDARWLAVVAIAFLFLQAGLGAGVVLWGQPDAV
FT                   LALHFGISLVSFASVALLSLRVWYATGTPVPVDADPAQRTGAGSRDADGNGTAAAPVAG
FT                   RAASPGLPGSGPTAPAFPAPWRRAIWFLLAYTYVVVYTGAYVRHTNTSLACPSWPACGG
FT                   PWEGPAAIQMVHRLAAGVLLVALVVMAVLARRGATGRDRSAPLRVPATGTGPGDPAGSL
FT                   PPGWVRGLSLAAGLAVLQALSGGYVVLSRLDLAATMLHSSLITLMFAVLCHLGLEALGP
FT                   RWSLASYGAPGLALGSPGPGLGGGGHGGRILPPEPAGRGSAPAPAGGTSPAGAGPFMAG
FT                   VGGSPGGRRGALS"
FT   gene            complement(472325..473266)
FT                   /locus_tag="Tmar_0403"
FT   CDS_pept        complement(472325..473266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0403"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="COGs: COG0109 Polyprenyltransferase (cytochrome
FT                   oxidase assembly factor); InterPro IPR000537: IPR006369;
FT                   KEGG: tro:trd_A0395 protoheme IX farnesyltransferase (heme
FT                   O synthase) (HemeB farnesyltransferase); PFAM: UbiA
FT                   prenyltransferase; SPTR: Protoheme IX farnesyltransferase
FT                   (Heme O synthase) (HemeB farnesyltransferase); TIGRFAM:
FT                   protoheme IX farnesyltransferase; PFAM: UbiA
FT                   prenyltransferase family; TIGRFAM: protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50524"
FT                   /db_xref="GOA:E6SGA7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA7"
FT                   /protein_id="ADU50524.1"
FT                   /translation="MSMPNSAVLSRALPASRNGVLRDYLTLMKPGVMLLVLVTTAASMW
FT                   VALGEAPHPWTLLVTLAGTMLAGGAAATLNHVLDRDMDAAMPRTSRRPIAAGRVHPGRA
FT                   TAFAVVLAMLSFALLYTQVNPLTAYIAAGGIAFYVGVYTAWLKRRTPQNIVIGGAAGAV
FT                   GPLIGWAAATGRLDVAAVVMFLIVFFWTPPHFWALAIALRDEYAQAKVPMLPVVAGVDA
FT                   TLRQIYFYTWVTVAVTLAMAPLGVLSWVYTAAAVVLGVRYLRLTRGLMAETSDARARAL
FT                   YGYSIVYLFSLFAAMVLDVTVQQLAGHLLGRV"
FT   sig_peptide     complement(473120..473266)
FT                   /locus_tag="Tmar_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            473881..474735
FT                   /locus_tag="Tmar_0404"
FT   CDS_pept        473881..474735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0404"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="COGs: COG1622 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 2; InterPro IPR002429: IPR001505:
FT                   IPR014222; KEGG: sus:Acid_5589 cytochrome c oxidase,
FT                   subunit II; PFAM: cytochrome c oxidase subunit II; SPTR:
FT                   Cytochrome c oxidase subunit 2; TIGRFAM: cytochrome c
FT                   oxidase, subunit II; PFAM: Cytochrome C oxidase subunit II,
FT                   periplasmic domain; TIGRFAM: cytochrome c oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50525"
FT                   /db_xref="GOA:E6SGA8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA8"
FT                   /protein_id="ADU50525.1"
FT                   /translation="MHQVTERENRRAGAVVTLLIGLVLVAGVASTVYATKRWWLPPLVS
FT                   ATAAPIDRMFNLLMVSIGIVFVLTQGALAWFVWKAARNPRALYWHENKRLESTWTVATA
FT                   VILTAFIVMGYQIWLSVHTPPAAAAEKTAVVEVWGQQFYWTARYPGPDGQFGKTDPQYV
FT                   DFKSNPFGIDPNDPAGQDDIVVDGSKGPIVMPAGYKVTVQLHSRDVIHSFFVPQLRVKL
FT                   DAVPGQVNELYVEPTEPGTYEIACAELCGVGHFAMRGEIQVLPESEWQSWLAEHAGEHG
FT                   AAQ"
FT   sig_peptide     473881..473982
FT                   /locus_tag="Tmar_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            474771..476549
FT                   /locus_tag="Tmar_0405"
FT   CDS_pept        474771..476549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0405"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG0843 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 1; InterPro IPR000883: IPR014241; KEGG:
FT                   phe:Phep_0295 cytochrome-c oxidase; PFAM: cytochrome c
FT                   oxidase subunit I; SPTR: Cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: Cytochrome C and
FT                   Quinol oxidase polypeptide I; TIGRFAM: cytochrome c
FT                   oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50526"
FT                   /db_xref="GOA:E6SGA9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGA9"
FT                   /protein_id="ADU50526.1"
FT                   /translation="MAHGGTQAALAGHATHAGHHHEPQSFWRRYIFSTDHKIIAIQYLL
FT                   TSLVMAAVGGFLAMLMRVQLGWPGRQWPLLEALMPNAFKGGRMDPDFYYGAVTMHGTIM
FT                   VFFFLTTALSGGFANFLIPLQIGARDMAFPVLNMISYWLFPVAIVFALASFFVQGGAPG
FT                   SGWTAYPPLSDREPLGQTLWLISVFILMLAFLAGGINYITTTLNLRTKGMSMSRLPLTV
FT                   WTLFVTALVGLFAFPALMAAALMLIFDRVGGTHFFDPAGGGDPILWQHLFWFFGHPEVY
FT                   IVILPAMGIVSEVLATHARKPVFGYRYMVGSTLAIAGLSFIVWGHHMFASGMSPTLGSM
FT                   FMATTLAIAIPSAVKTFNWLATIYRSKMRFTTAALYAVGFVSLFITGGLTGIILGNPST
FT                   DLYFHDTYFVVGHFHFIMGAAALFGVFAGLYHWFPKMFGRMMNERLGKIHFWLTFLGIY
FT                   GTFFPMHFLGTAGMPRRIYSWEAYQFLGDVATLNHIISISAFVLGAAQLIFAFNLFYSM
FT                   FRGPKAERNPWQANTLEWWAPSPPPHGNWDEAEPVVYRWPYEYSPKYAPEGVDHIPQWL
FT                   PEPAVATAGRDGAGAR"
FT   gene            476619..477329
FT                   /locus_tag="Tmar_0406"
FT   CDS_pept        476619..477329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0406"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: sus:Acid_5591
FT                   cytochrome c oxidase, subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; SPTR: Cytochrome c oxidase, subunit
FT                   III; PFAM: Cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50527"
FT                   /db_xref="GOA:E6SGB0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGB0"
FT                   /protein_id="ADU50527.1"
FT                   /translation="MPTTTRKPPRTRHRLRRQGAAARPPVPVIAGRRVDTPGRIPPNGR
FT                   GGGGGWGGGPGDDEARARAATMATWMVVAAVTLMFMGFTSTYVARSAEPGWARQDLPPL
FT                   LWWNTAVLLASSVTMELARRRARKGLVAGARRALGVTTLLGLAFVAGQVAAWAQWLAAG
FT                   VVASGSTHAAFFYLLSGVHAAHVAGGLGALLYGMWRLGRPGTPAQMAASMTNIATYWHF
FT                   VDVLWLYLFALLLW"
FT   gene            477346..477990
FT                   /locus_tag="Tmar_0407"
FT   CDS_pept        477346..477990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0407"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="COGs: COG1845 Heme/copper-type cytochrome/quinol
FT                   oxidase subunit 3; InterPro IPR000298; KEGG: svo:SVI_0007
FT                   cytochrome c oxidase subunit III; PFAM: cytochrome c
FT                   oxidase subunit III; SPTR: Cytochrome c oxidase subunit
FT                   III; PFAM: Cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50528"
FT                   /db_xref="GOA:E6SGB1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGB1"
FT                   /protein_id="ADU50528.1"
FT                   /translation="MSTIEATQHPLAADQEAVLRSEWGGGRSPFATPHAKLGMWIFLAS
FT                   DVLVFATLLTAYGVARLKAGTWPDRTHIFEGLWLVTLMTFILISSSSTMAAAVGAARRG
FT                   DQKAAVRFLLLTILGGLFFLGSQAFEWTSLIREGARLMSNPWGVPQFSASFFVITGFHG
FT                   FHVLTGLIYLAVITLNAMRGRYSGLGVEVAGLYWHFVDLVWVFIFTLFYLI"
FT   gene            478119..478421
FT                   /locus_tag="Tmar_0408"
FT   CDS_pept        478119..478421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0408"
FT                   /product="cytochrome c oxidase subunit IV"
FT                   /note="KEGG: met:M446_3894 cytochrome c oxidase subunit IV;
FT                   SPTR: Cytochrome c oxidase subunit IV; TIGRFAM: caa(3)-type
FT                   oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50529"
FT                   /db_xref="GOA:E6SGB2"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGB2"
FT                   /protein_id="ADU50529.1"
FT                   /translation="MSGTAHSAVEHGHEHDHGNRLYFLTWLWLLLITVLEVGVVLVHMP
FT                   RAILVAVLLLMTVLKSGLIVANFMHLRFEKLNMIYIILTPMIFALIMWYGVALDY"
FT   gene            478555..478788
FT                   /locus_tag="Tmar_0409"
FT   CDS_pept        478555..478788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dan:Dana_GF22505 GF22505 gene product from
FT                   transcript GF22505-RA; SPTR: GF22505"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50530"
FT                   /db_xref="GOA:E6SGI4"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGI4"
FT                   /protein_id="ADU50530.1"
FT                   /translation="MSVIPGLPWYLASHWTSGGQVPKAFFLIMILVTYGLIALLGIGAY
FT                   RLLRGGPAGTGGGDEGPGGRVGGRDGSAGRSG"
FT   gene            complement(479074..479985)
FT                   /locus_tag="Tmar_0410"
FT   CDS_pept        complement(479074..479985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0410"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014044; KEGG: pth:PTH_1322
FT                   hypothetical protein; PFAM: SCP-like extracellular; SPTR:
FT                   Uncharacterized protein; PFAM: Cysteine-rich secretory
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50531"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGI5"
FT                   /protein_id="ADU50531.1"
FT                   /translation="MVSPRIRRRIAGAAILAALAMAVPAAPAMAAWRNPYPGDPVLRPA
FT                   GSPAASPAAAGRTGALGLQAGGTAGFPAGEGTGGGVTPEFTGRGPGVFGWYYQWKLQRA
FT                   QLRRGTAADPAATPDGTGAGTPAGSSTGGPHGGRGVPTPSTPRPSAPPSQPTEAPRLEP
FT                   APSPRDAAASLTAEERRLVELVNLERRNRGLPELAVDPDLTRLARLKARDIQQQGSFSH
FT                   VSPTYGSPYAMEIAAGIRARVMGAENLAMARDVNAAHRMLMASQGHRANILHPDHDRIG
FT                   VAVVPVRYGVLVVQLFLGARYR"
FT   sig_peptide     complement(479896..479985)
FT                   /locus_tag="Tmar_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(480261..481910)
FT                   /locus_tag="Tmar_0411"
FT   CDS_pept        complement(480261..481910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2275 peptidase C14, caspase catalytic
FT                   subunit P20; SPTR: Peptidase C14, caspase catalytic subunit
FT                   p20"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50532"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGI6"
FT                   /protein_id="ADU50532.1"
FT                   /translation="MVGLARAAEQATLLLGEPAEDVWLLCSRAGDGTVTVQGSLPPPPD
FT                   PGRVRALWAGWGPPPAKGSGAAPGNQRRPWLVAHSPGDLRIWIYVPRDPAAPQGPGGRG
FT                   GSWWFTRPLHGMNPLSVAAAFAAGTGAVYLPYLAGPGPNAAAPELRVLSFRRRWRDEPA
FT                   GSLPGAVELLEAAVWEDERQGGPRLVLLWRDAGGACHWALWRRVARSGWAREGSGSLGT
FT                   AACHGEPPQLSPLPGGGARALASWNPRGLGPGVGGADDGGAAPAHPSVAGVAWSDLVRG
FT                   DFPPAGMPRFMPVRWTGGDGASGGQAEVAASAVAGPVAVVGWWASGGADLVLLLRATGG
FT                   AGVDGAVEGWLLAADGACRRLGRVAAPIRWLGWARVAVAWEEPVIPCRMPLRTGPHGVP
FT                   QPWPVPHTWMEALRVHGAGGWPAAPGLAPSLLHPSPDTPLPAGPTAGGPLTAGQPAGLL
FT                   PAPETSPARRRERPDSLERPSSLGSNDPGGRPAAPTAATQADGPAARPLAGPPPTGPVR
FT                   PPAPRSPRGTPPAPASPRRPPRWRTVPRPDGS"
FT   gene            482219..482857
FT                   /locus_tag="Tmar_0412"
FT   CDS_pept        482219..482857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_1321 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50533"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGI7"
FT                   /protein_id="ADU50533.1"
FT                   /translation="MQDVVQDGQDQVVPGPCDPTYGCPDPTEIVCIETLKVYDFCFQVE
FT                   RRENVCFNLPHACAGARPTDQVVCNVIGVECRELSRSADPENPGFADVTLLVTVTLEFK
FT                   IVRNDTLVCRFEDSFSFLKTVLLCAPEGTEVQCESTGSRCGPCVVVNGRVCCHVDVCLL
FT                   IQSKAWVKLLVPSYGFCVPAPCVAIPKPPLVCPPDNLFPPQCTPLVDRA"
FT   gene            complement(482960..483997)
FT                   /locus_tag="Tmar_0413"
FT   CDS_pept        complement(482960..483997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0413"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0438 Glycosyltransferase; KEGG: gka:GK0871
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50534"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGI8"
FT                   /protein_id="ADU50534.1"
FT                   /translation="MHILMLTATFFASGQTAHVIHLARGLRRRGLGVDLLLTHAGPGAP
FT                   RRRDYLRLLHAAGVRVMAIPRQPAGVDRMEPPAGRYDVVHVQSSWSFEHGRRLAARLDV
FT                   PLVITCHGLSLNQLAYRPALSAAARLICVGPRIAGNLAPYRDKIVVIGNGADLERFRPG
FT                   VREPQFTILYAGRVDRWKRAGVLALCAAVDRLPGDTRFWVAANVRLPSRRAEHLGWVTD
FT                   VHRWMGRAHVVVGTGCAIREAMAAGAACLILGREYHGVVTPELVASMDFPDFSGLGRHQ
FT                   GPPSPAALYADLMRLYQDRQWLGELMAFGREYAERHFDLDAMVAATLDVYAAAIASHRR
FT                   RAGAR"
FT   sig_peptide     complement(483950..483997)
FT                   /locus_tag="Tmar_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            484263..484913
FT                   /locus_tag="Tmar_0414"
FT   CDS_pept        484263..484913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0414"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284: IPR007627: IPR013249; KEGG: sth:STH2677 RNA
FT                   polymerase ECF-type sigma factor; PFAM: sigma-70 region 2
FT                   domain protein; Sigma-70 region 4 type 2; SPTR: RNA
FT                   polymerase ECF-type sigma factor; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: Sigma-70, region 4;
FT                   Sigma-70 region 2; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50535"
FT                   /db_xref="GOA:E6SGI9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGI9"
FT                   /protein_id="ADU50535.1"
FT                   /translation="MPDRHDGRQRTGGADPSGVAAWSDEALVQRAREGDLDAFTALVER
FT                   YQVAVYNLCLRLTNQPADAADAAQEVFLRVYTNLRRFQGRGPFRSWVYRIAVNTCRDEL
FT                   RRRRRRPVPALAPPGPDAHPLPAGDDGDPARAVVGREVQAAIQDALGRLPEVFRTVVVL
FT                   RDVEGLSYEEVAAVLGVSIGTVKSRVHRGRVMLRDWLAAAGWLAGRGKGGDGP"
FT   gene            484910..486283
FT                   /locus_tag="Tmar_0415"
FT   CDS_pept        484910..486283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hoh:Hoch_3106 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50536"
FT                   /db_xref="GOA:E6SGJ0"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ0"
FT                   /protein_id="ADU50536.1"
FT                   /translation="MIGGFGHVDRWLSDWLDGTLPGPRRQAVEGHLAACARCRARAEAM
FT                   RETVRQLRSLTPVPPPPDLVARVRARLAQDAATAPGAAGPSHARGAVPGPAPEGPATDR
FT                   PVATAAGADRPAEEATRRPMARLWRWVQRRPGWRPAMAGGALVVLLVWAAGRWLGGTGG
FT                   AVRQAVAPELASVPETAARAGGWDAAQENGSGAGANAAGAAPDTAPGATAGAAEALGSQ
FT                   ASSAMRPAAASGRLLIRTGRLDLVVPDVAAAYREAEAIARRYGGFVQDARLDRTGAVEA
FT                   ASLTLRVPDQRLETVMDELAALAQRGRVAGHSIEAQDISSQYIDVKARLETLQAQEARL
FT                   RQLASRSAGIDELLRVEQELWRVRGEIEQLEGQVRFWDQAVQLATIEVGLRAVEATPPE
FT                   PAGSLRERAARAFLRSLHGLGQLVQAAIVGLAALVPYLAVVGAAAGAWLGWRRRHSRP"
FT   gene            complement(486387..487745)
FT                   /locus_tag="Tmar_0416"
FT   CDS_pept        complement(486387..487745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aac:Aaci_1480 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50537"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ1"
FT                   /protein_id="ADU50537.1"
FT                   /translation="MMPGRETAARRATVRELSHAAVPAWVQLGHAVIRLPSLWEPDQRT
FT                   LALPGAVLDAFGFDRGQAVYVFPADGGQRLVVGPLVGIWVTPAMLRSWKRGVRLLSQEV
FT                   RGAGGIPFFFDLKGVDRAGGRIRGWTWQGGRLRPVTIPLPDVIYNRATFPDPGPRAAAR
FT                   SLRRALWEEDAIPFVNLASGFPKWETYQALRFFADTRPLVPETVRLEAPAELAAFLSRH
FT                   RLVFVKADGGSHGTEVVRLRAVAGGWWIEGQVGRQRLRSRAADPAQVVEVLSRWIAGGV
FT                   WVVQQGIQLPRLNGRRWDLRVEVKKDGTGTWTVPLIVVRLGHPATVTTNISRGGTPFEL
FT                   EAFRRRFGPLPALAGLKAKATRVAVRVALALEARFGPLGEIGVDVGLDPQGRPWVFEAN
FT                   AKPQYGPSPRPEQARGLMAYAVQLALHAWAGREGGVNRPHPVASLQTFAGWAG"
FT   gene            complement(487742..489112)
FT                   /locus_tag="Tmar_0417"
FT   CDS_pept        complement(487742..489112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_2930 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50538"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ2"
FT                   /protein_id="ADU50538.1"
FT                   /translation="MDRFEVRVTVRENPAERVVMLSPLLVERLGLPQDRPCTVRFGTRR
FT                   VTGQLRGEPGLGDHQVALSASLAEALGLPAGTPLTVWREGTATLACGPLIAYVTSRSVL
FT                   RALRSGADDPAIAQMATAAREAGAVLLLAGPEDILWNRSAVRAERVEVPAGGPPRLAGG
FT                   VYPLPRVILYPTAVGAGPRPQELAPRARALGCTLLSHRKIRKLETYHVLHRVPAVRSLL
FT                   AYTERLTPDSLARAMRRFSDLYLKPDDLSRGRGVHRLTRRRAGGWLLTHRDAQGNVERL
FT                   LPDADAVRAAVRPLLRGPRVYLLQEGLPLATYLGNRFDLRVLVQKNGVGRWTVSGVVAR
FT                   IAPLGSAITSPRSGGQVALPEQVLQHAFGGRATAVRDSVAEAALATARAIDTALGPVYE
FT                   LGIDLGVLQDGTVRLIEVNGMPLKVSLQRLGDPGAEQRIQRFPVHYAAWLDIEGNRP"
FT   gene            complement(489127..490605)
FT                   /locus_tag="Tmar_0418"
FT   CDS_pept        complement(489127..490605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tjr:TherJR_1104 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50539"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ3"
FT                   /protein_id="ADU50539.1"
FT                   /translation="MATLGGRLVPIPTGGRRGARPVVATPVVLQRPDAVNLVLRGGHRM
FT                   ERVRVVPLHGSAPERVVHLGHGERAAPLRYDGANRTLALPPAWMGELGLTPDQEVHVRP
FT                   RDGGQRLRLGPLVGLWVTRAVIRQWTPSLRVLMQEARAAGAIPVVFDLDGIDRRRGRVA
FT                   GWVERGGKPARAVLPLPDVIYNRATYPNLRRRARARELRRQLIAVDRIPFVNTAAGFPK
FT                   WETYEALRFFRATRELVPATIRFGDRKTFAGFLRRYPVAFLKADGGSAGGQVLRIQAAR
FT                   GGWRVQGRNQRMQIQQRFGHLDDLHAFLTRLTEDGQWVLQEGIPLPQLEGRPWDVRLEA
FT                   KKNGQGEWEVPFIFVRWGPPAAVVTNEAQGADIFLLEDFRTRFAGLKVLRDLDAVATRV
FT                   GRLVAMALEARYGLQGEVGVDFGLDRQGRPKVFEANAKSTHAPVPGQTVPQARWPMQYA
FT                   VWLAGRAWAGRETGLALPIRSRLTVGGGDEDAAP"
FT   gene            complement(490653..492038)
FT                   /locus_tag="Tmar_0419"
FT   CDS_pept        complement(490653..492038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_0326 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50540"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ4"
FT                   /protein_id="ADU50540.1"
FT                   /translation="MVRLLVRVEIEAGRAAPVRVARGLLSALQRPPGRHVLRFGTRHVR
FT                   VRLDEDAGLPPGRVAVPAAVAERLALPGGGRMAMQPVDAGLELGPLVGLMVARGVLARL
FT                   RAEGVGRPFTAYARHARELGAVLCLFSPADGQVDAKAITGYRPEERRGGRWHLTEARFP
FT                   VPRVILRRVFSDEGPESDPLTARGPEMGCTVLRIGRLTHLEGLQLAATDGDLAPRIPWT
FT                   RRLGPDTLAEALAAFPDLFVKPDVPSGGAGVYRLTRQDRGWRLMAAAEDRTGTQELPDP
FT                   RAVQAALAALAAGPTAFVVQEALPLATYLGNPFDVFALVQPDARGHWDVSALLARVAAP
FT                   GCVLTSPGAGGRVAPAEAALRHAFPTRWPQVCDELGRVARAAARAVDAGAGPRFELGVQ
FT                   LALLPDGAVRLLQVEGQPRLDDTLLLWDAYAAQRLYRCPIHRAVGLALEWARAPLSPAA
FT                   PPA"
FT   gene            492185..493270
FT                   /locus_tag="Tmar_0420"
FT   CDS_pept        492185..493270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0420"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR003739: IPR007197; KEGG: gwc:GWCH70_1757 lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein; PRIAM: Lysine 2,3-aminomutase; SPTR: Lysine
FT                   2,3-aminomutase; TIGRFAM: lysine 2,3-aminomutase YodO
FT                   family protein; PFAM: Radical SAM superfamily; TIGRFAM:
FT                   KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50541"
FT                   /db_xref="GOA:E6SGJ5"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ5"
FT                   /protein_id="ADU50541.1"
FT                   /translation="MGRYRTDIREIEQLAAEERQRLRPVTETYVFRVNDYYLSLIDWDD
FT                   PDDPIRRIVIPSEVELAEYGSLDPSDEESNYVAPGCQHKYGPTALLLVSKVCGAYCRFC
FT                   FRKRLFREDVEEHHVSMDVEPGLRYIAAHPEITNVLLTGGDPLMLSPRRLDQILTRLRA
FT                   IPHVKVIRIGTKIPAFEPMRVTDNPELLEVLRRHSRADARIHFSLHFNHPREMTEEALR
FT                   CIIALQEVGVTLVNQTPLLRRVNDDPAVLAELLERLTWWGIAPYYIFQNRPVAGNADFV
FT                   VPLREGYRIVEQAKARVSGYAKRVRYVMSHATGKIEILAVEGERIYLKYHQARNPEDYG
FT                   RFLVCRLTDDAAWFDDLQPVA"
FT   gene            493427..494812
FT                   /locus_tag="Tmar_0421"
FT   CDS_pept        493427..494812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_0515 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50542"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ6"
FT                   /protein_id="ADU50542.1"
FT                   /translation="MLEAVRIRPCSATGLLVGPDAQATIGIRGRRHVTLCHGNCREVVG
FT                   AWRDPAVPPGEIWLPRGVVDRLLAVPGIPYDVRWDGRELRLGPVVAVIVPQRSLAPSPD
FT                   RWADWAAAYDRVRGLLFVTDRAHLDLERGRASGYYLRPDPRGGQWQWGRFPLPEAAYRR
FT                   AALPAALYEQLPQRGTRLFDTECADKWTVYRWLSARPAVAPYLPWTVPVERLEDLPALV
FT                   RCRGRLMLKRREGCRGRGLLAVWGDGSAGFWVQRRDEPAPRHVPGDRELIACLRREFGP
FT                   HRYLAQQAVDLPERAGRRMDLRVIMQRDARGAWRCTGGAARFGKPGHIASNFVWEGGFG
FT                   CAPDRGLRLALGLDARAARRLWDGVREAALRVCQALDAYGEFGDLGLDMAVDRAGCIWL
FT                   LEVNCGLQVHRLAAFDGGAEAVRRVRQTPLLYARHLAGWPAVEPRAPSFLRSRAAGAGA
FT                   VRP"
FT   gene            494931..498113
FT                   /locus_tag="Tmar_0422"
FT   CDS_pept        494931..498113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0422"
FT                   /product="DNA polymerase I"
FT                   /note="COGs: COG0749 DNA polymerase I - 3'-5' exonuclease
FT                   and polymerase domains; InterPro IPR002298: IPR002421:
FT                   IPR008918: IPR001098: IPR 018320: IPR020046: IPR020047;
FT                   KEGG: sth:STH848 DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 5'-3' exonuclease, N-terminal resolvase-like
FT                   domain; 5'-3' exonuclease, SAM-fold domain; SMART: 5'-3'
FT                   exonuclease; Helix-hairpin-helix domain protein class 2;
FT                   DNA-directed DNA polymerase; SPTR: DNA polymerase I;
FT                   TIGRFAM: DNA polymerase I; PFAM: 5'-3' exonuclease,
FT                   C-terminal SAM fold; 5'-3' exonuclease, N-terminal
FT                   resolvase-like domain; DNA polymerase family A; TIGRFAM:
FT                   DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50543"
FT                   /db_xref="GOA:E6SGJ7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ7"
FT                   /protein_id="ADU50543.1"
FT                   /translation="MCPSSARPDTKLVLIDGHSLMYRAFFALPPLATADGVPTNAVYGF
FT                   LTMLLRLLEEVAPQYIGVAFDRGLPAFRVERFPAYKGHRPEQPDELRPQFPLVKDVLAA
FT                   MGVATVEHEGFEADDLLGTLAHRARAAGVDRVLLVTGDRDVLQLVGDGVEVLLTRKGIS
FT                   DLQRYDEARIREEMGIAPAQFLDVKALMGDPSDNIPGVPGIGEKTALKLIQQFGDLETV
FT                   LARPEAAGGKKLPGLLRQYADQARLSRELARIRTDAPVEFDPERFARRPPDPAVLRPLL
FT                   LRLEFRSLVDRLGLQAGRSTAGTRASGETGPGDGQDPNREGQAVERGERHRRPAAPAPP
FT                   VPAPEAAEAAGAGAEPEWPPVDTLPDPAAVARWLEERVAGPQGGAVATREGPPADAVRG
FT                   SRQGAGAGQPEAPPAEDGPAGEPVTVVAVLAPAPSGPPSRAEAGDDPPTSATSGAAGGG
FT                   PQLGGIGLAAAGRAAAWVAAGATGGGGATPGPDQSAGADHRTLAAALLRRSLAGFDLKP
FT                   LYRWLLRSQEAEAGRPRSPAESAGRGPGDAGAGGEAGAAPAAGGAALRPAPRATVLPAP
FT                   ASDLKLAAYLLDPVRNRYYLVDVARQFFGWELEEGPADRPDDPACRTTQLLGRDAALCA
FT                   RLRPAVEAELAARGLERVYREIELPLVPVLAAMEEAGIAVDRRQLEELGRLFTRRSQEL
FT                   AEQIYQLAGETFNINSTQQLGQILFERLGLPVVKKTKTGYSTDAEVLETLAARHPIAEL
FT                   VLEYRSLVKLQGTYVDGLAEHIGPDGRVHTTFQQTVAATGRLSSTQPNLQNIPIRDEPG
FT                   RSLRRAFVAPPGHRLVAADYSQIELRVLAHYSGDEGLLEAFARGQDVHARTASEIFGVP
FT                   LEQVTPEQRRVAKAVNFGLAYGQTDYGLARALRIDRADARRFMDRYFERYPGVKRYMEE
FT                   TIRRARQHGEVTTLLGRRRPVPEIRHRVYHIRQNAERVAINTPIQGTAADIMKLAMIRV
FT                   YRALAGEGLRARIVLQVHDELLVEAPEDEVPAVAALLRREMEGAFPLAVPLVVDVKAGT
FT                   NWYEMEAVGAGA"
FT   sig_peptide     494931..495002
FT                   /locus_tag="Tmar_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            498106..499212
FT                   /locus_tag="Tmar_0423"
FT   CDS_pept        498106..499212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0423"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterPro IPR000214: IPR012319: IPR015887: IPR000191: IPR
FT                   015886: IPR010663: IPR020629; KEGG: mta:Moth_1840
FT                   formamidopyrimidine-DNA glycosylase / DNA-(apurinic or
FT                   apyrimidinic site) lyase; PFAM: DNA glycosylase/AP lyase,
FT                   H2TH DNA-binding; Formamidopyrimidine-DNA glycosylase
FT                   catalytic domain protein; PRIAM: DNA-formamidopyrimidine
FT                   glycosylase; SPTR: Formamidopyrimidine-DNA glycosylase;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain; Zinc
FT                   finger found in FPG and IleRS; TIGRFAM:
FT                   formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50544"
FT                   /db_xref="GOA:E6SGJ8"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ8"
FT                   /protein_id="ADU50544.1"
FT                   /translation="MPELPEVETVRRDLERHLEGAWIAGVRVLRPDVVVGATPPALERA
FT                   IVGARFRRFARRGKYLLLELEEPAAGAAGGTALAAGRGAAGAAVGGASEVNAGVPGTPE
FT                   PAGRGQPAGPARPATPRPPRCRWLVIHLRMTGRLTLARCGEPLLPHTHLILDVAGAAPW
FT                   DQLRFSDPRRFGRVYLLSKSPFSRRAVSGRARDTADRETELRHREDALPEGLRTLGPEP
FT                   LSRRFTAAELARRLAGRRAPVKSLLLDQRAVAGVGNIYADEALFRARIHPARPAGELSP
FT                   AEVARLVRALRRVLREAVAAGGTTFSDYRDGLGREGRFARRLAAYGRQGEPCLRCGTPI
FT                   ATLRLGGRTAHFCPRCQPVRTGGDHGQT"
FT   gene            complement(499267..499800)
FT                   /locus_tag="Tmar_0424"
FT   CDS_pept        complement(499267..499800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0424"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: cms:CMS_1843 translation initiation factor
FT                   IF-2; SPTR: Translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50545"
FT                   /db_xref="GOA:E6SGJ9"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGJ9"
FT                   /protein_id="ADU50545.1"
FT                   /translation="MTPRKPGNHGRQRAQAAGRASPGAGRGGPGRPGRPVAPEPAAPER
FT                   DDLTAAGAPASFTDDHRWIDQLEELADGQARAMGIRPQVEFEVPGIRVVADIGEPAPGP
FT                   AAYGAPEATRPAPGAGGPASPPGGDGHGAGPYGGTAGEYGRVPGRRKPRGLAVGAEGND
FT                   PDAPGGGAGRRRSP"
FT   sig_peptide     complement(499753..499800)
FT                   /locus_tag="Tmar_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(500161..501036)
FT                   /locus_tag="Tmar_0425"
FT   CDS_pept        complement(500161..501036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0425"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="COGs: COG3773 Cell wall hydrolyses involved in spore
FT                   germination; InterPro IPR002482: IPR018392: IPR011105;
FT                   KEGG: mta:Moth_0054 cell wall hydrolase, SleB; PFAM: cell
FT                   wall hydrolase SleB; Peptidoglycan-binding lysin domain;
FT                   SMART: Peptidoglycan-binding LysM; SPTR: Cell wall
FT                   hydrolase, SleB; PFAM: Cell Wall Hydrolase; LysM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50546"
FT                   /db_xref="GOA:E6SGK0"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK0"
FT                   /protein_id="ADU50546.1"
FT                   /translation="MAKRRWQRMLAGLTVGLAMAALAVMGSTARAAAAQGGPAFVTHYV
FT                   QRGETVWQIARRYGVPMADIVALNRLPSASVVWAGTYLAIPSVDRYDIYTVRYGDTLYT
FT                   IARAYGLTAAALKEANALATDLLLPGQRLIVPLGGGTAGSAAGSSAPAPAPSPAPASSR
FT                   GVTGGAGVQVSDYELRLLAQMVQAEAGGEPYVGKVAVAAVILNRVKSPLFPDTVAGVLF
FT                   EPYQFEPVLNGTFWQEPSAEAWQAAIDAVNGWDPTGGALYFWNPAKSGYQPFLETRPSA
FT                   GWIGNHRFAY"
FT   sig_peptide     complement(500938..501036)
FT                   /locus_tag="Tmar_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(501301..501927)
FT                   /locus_tag="Tmar_0426"
FT   CDS_pept        complement(501301..501927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0426"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="COGs: COG3773 Cell wall hydrolyses involved in spore
FT                   germination; InterPro IPR011105; KEGG: chy:CHY_1756
FT                   putative spore cortex-lytic enzyme; PFAM: cell wall
FT                   hydrolase SleB; SPTR: Putative spore cortex-lytic enzyme;
FT                   PFAM: Cell Wall Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50547"
FT                   /db_xref="GOA:E6SGK1"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK1"
FT                   /protein_id="ADU50547.1"
FT                   /translation="MRATAMEQAARPARMPAGRAGRGRWHGLPLVAAGLVLAFVLSGPA
FT                   AALAGASGPEAAGPKAAGDGAAQARTQATAVTPRALRAVHPPMRLSPREMRLLAQMIEA
FT                   EAAAEPYAGKVAVGAVILNRVRSPLFPDTVEEVIFEPWQFEPILNGWFWQEPGAASWRA
FT                   ARDAARGVDPTGGALYFWNPAKSGYQPHLESRPSAGWIGNHRFAY"
FT   sig_peptide     complement(501775..501927)
FT                   /locus_tag="Tmar_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            502346..502543
FT                   /locus_tag="Tmar_0427"
FT   CDS_pept        502346..502543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH850 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50548"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK2"
FT                   /protein_id="ADU50548.1"
FT                   /translation="MVVALEFDEQKKLEAAVQRLRQNLGVTGELAIKPLEGGRWRLTIS
FT                   SEKPLRESSIDKLGGRRVDL"
FT   gene            502540..503187
FT                   /locus_tag="Tmar_0428"
FT   CDS_pept        502540..503187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0428"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: mta:Moth_1838 dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; PRIAM: Dephospho-CoA kinase; SPTR:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50549"
FT                   /db_xref="GOA:E6SGK3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK3"
FT                   /protein_id="ADU50549.1"
FT                   /translation="MKPVLIGLTGGIGSGKSAVARMLVELGAAVVDADAIAREVVEPGQ
FT                   PALTRLVEAFGEDILTPSGELDRRALGRRVFRDEQARQVLERIVHPAIRRRTWERIGAL
FT                   LAQGRHPAVVWDVPLLFEVGAEGLVDQVWVVTAPRHVRLERLRRRDPDLSVEELERRMA
FT                   AQMPLEEKAARAHVVIDNSGDLETTRRQVQAAWRRFVIGSAPGPDAPGGGPA"
FT   gene            503204..503833
FT                   /locus_tag="Tmar_0429"
FT   CDS_pept        503204..503833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0429"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="COGs: COG0741 Soluble lytic murein transglycosylase
FT                   and related regulatory protein (some contain LysM/invasin
FT                   domains); InterPro IPR000189: IPR008258; KEGG:
FT                   mta:Moth_1837 lytic transglycosylase, catalytic; PFAM:
FT                   Lytic transglycosylase catalytic; SPTR: Lytic
FT                   transglycosylase, catalytic; PFAM: Transglycosylase SLT
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50550"
FT                   /db_xref="GOA:E6SGK4"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK4"
FT                   /protein_id="ADU50550.1"
FT                   /translation="MTGVDLILGGGWPWLRWGAIALLAALVALAGFYAAYPVPMAELIG
FT                   QEAAACGVDPLLVAAVVRRESGFEPRAVSDRGARGLMQIMPETGAWVAGQMGLPAFHPD
FT                   RLFEPEYNLRLGCWYLAYLLERFHGDPVVALAAYNGGEGTVADWIARGRWHPQRGVSAI
FT                   PYPETRRFVAGVLRDYRVYQWLYRRLPDFWGQVRQLAAGALAGVRE"
FT   sig_peptide     503204..503266
FT                   /locus_tag="Tmar_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            503910..503996
FT                   /locus_tag="Tmar_R0028"
FT   tRNA            503910..503996
FT                   /locus_tag="Tmar_R0028"
FT                   /product="tRNA-Leu"
FT   gene            504136..504221
FT                   /locus_tag="Tmar_R0029"
FT   tRNA            504136..504221
FT                   /locus_tag="Tmar_R0029"
FT                   /product="tRNA-Leu"
FT   gene            504466..505224
FT                   /locus_tag="Tmar_0430"
FT   CDS_pept        504466..505224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0430"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="COGs: COG1985 Pyrimidine reductase riboflavin
FT                   biosynthesis; InterPro IPR002734; KEGG: ttr:Tter_0996
FT                   bifunctional deaminase-reductase domain protein; PFAM:
FT                   bifunctional deaminase-reductase domain protein; SPTR:
FT                   Bifunctional deaminase-reductase domain protein; PFAM: RibD
FT                   C-terminal domain; TIGRFAM: riboflavin-specific deaminase
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50551"
FT                   /db_xref="GOA:E6SGK5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK5"
FT                   /protein_id="ADU50551.1"
FT                   /translation="MQQLFPEARPWPDPLTVYDDLDLPEGPPHRPYVLINMVTTVDGKV
FT                   TMGRGTVKEPIGSKVDHALMARLRAPVDAVLRGAGTVRAYDVPPRVPDEYAERRQARGL
FT                   PAQPLPVVITGSCDLPLDARFFREAPRRPLVLTRRAAPAEKVEAVRQVADVAFAGEEKV
FT                   EMRAALALLRERYGIRRLLSEGGPAVNFAMLEAGVVDELFWTVAPKIVGYAEDKTMVMG
FT                   PHPLEPRIRLSLASAFFHEGELFLRYHVLD"
FT   gene            complement(505232..507079)
FT                   /locus_tag="Tmar_0431"
FT   CDS_pept        complement(505232..507079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0431"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR000489: IPR006390; KEGG: chy:CHY_2383 dihydropteroate
FT                   synthase; PFAM: dihydropteroate synthase DHPS; PRIAM:
FT                   Dihydropteroate synthase; SPTR: Dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: Pterin binding
FT                   enzyme; TIGRFAM: dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50552"
FT                   /db_xref="GOA:E6SGK6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK6"
FT                   /protein_id="ADU50552.1"
FT                   /translation="MRLVEQWRRALERARRGQLAVLRQPWHRPVPGGTVAPYLVKVLCA
FT                   DEGRLAAWGTRYGLPARGICHHGRIPHYDLWGPLAEQAWAELAPATLGDGAGASRPGAA
FT                   DGQETGRVAPSARSRLSGPPRPSPAPAPGPVTQPGQGGTRAMPLVPEPDAVVAVHRGPW
FT                   HAGPIAARLVRAGWPGATALDDLWRHTFEIAPLRPEVARRLAHQAAARTGFATWRPYAG
FT                   AASLLVAGSVTELGELAGRWLRQEPERPAGRALARALQSLPFTAAAMSRGDGPAALGVA
FT                   GPVPLARQPLRVDFRGRSLVFGERTLIMGVLNVTPDSFSDGGRYNAPDRAVRRALEMVA
FT                   EGADLIDVGAESANIAASKPELEEELARLMPVVERLVREVDVPISIDTYKAPVAEAALQ
FT                   AGAHIINDISGLHADPGLAAVCARYGAGVVVMHLQGHPRSLAREPRYDDVVLDIARYLQ
FT                   EGVARALAAGVRPEAIVVDPGIGVGKRTRHNLEILENLGAFRSLGYPVLLGASRTSVIG
FT                   NVLETPIGDRLEGTLATTALAVVHGADMVRVHDVRANARVARMADALVRGWDEPADGWP
FT                   FDAVTGHQRRPLRELGRLPAAEGEREPRTPGAGSSAARS"
FT   gene            507419..508162
FT                   /locus_tag="Tmar_0432"
FT   CDS_pept        507419..508162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0432"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347: IPR002198: IPR020904;
FT                   KEGG: pjd:Pjdr2_5361 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50553"
FT                   /db_xref="GOA:E6SGK7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK7"
FT                   /protein_id="ADU50553.1"
FT                   /translation="MRLRGEVAVVTGAGRGIGRAVALRLAAEGASVGVLDVDAAAARAT
FT                   AEAIAQQGGRALPLEADVASGEAVARAMARVAEELDPPTILINNAGIGGFVPLDHPEAE
FT                   ATWHRVLAVNLTGAYLCVRHVVPYMKRAGRGAIVQIASTRALMSEPDSEPYAATKGGLL
FT                   ALTHALAISLGRYGIRVNAVSPGWIDTGHEPVSEADHAQHPAGRVGRPEDVAAACAFLV
FT                   SPEAGFITGQNLVVDGGMTVKMIYL"
FT   gene            complement(508165..509448)
FT                   /locus_tag="Tmar_0433"
FT   CDS_pept        complement(508165..509448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0433"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="COGs: COG3858 glycosyl hydrolase; InterPro
FT                   IPR011583: IPR001223; KEGG: dhd:Dhaf_0072 glycoside
FT                   hydrolase family 18; PFAM: glycoside hydrolase family 18;
FT                   SMART: chitinase II; SPTR: Putative uncharacterized
FT                   protein; PFAM: Glycosyl hydrolases family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50554"
FT                   /db_xref="GOA:E6SGK8"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK8"
FT                   /protein_id="ADU50554.1"
FT                   /translation="MIQWPGPSPAPGPAGRPPGSQAGKPPRAGEGAKEQGRLGCPRHRH
FT                   PAPRPARPRPRRPRTALALLLLVALVLPACGGSGPAGPPAKPGGDGGDRGNRILGRDPV
FT                   VYGFYTEPEPGMPGSFATMVRRARDLDVIVPFWFRLAERGDGTIEAYAAPSPERRRQVI
FT                   REAHRRNLKVELIVHNLLYGPGDRSAATARRFLRDPRAQDRAVGGMLDLIRQEGYDGVH
FT                   LDLETVPPEERHRLTAFVRKVREALPQGKLLSIAVFPRNRDVRDDPNTGAYDYAALGRA
FT                   VDYFILMTYSEHRADTPPGPLASLDYVDRMVRYALRYVPRDKVIVGLGAFGFDWGGGGF
FT                   PRYLDHAQAVRLARDRGVAVRWDDRARVPFFTYTADDGTSHTVYFENARSWGEKLNLVQ
FT                   RHGVRGVAIWRLGMEDAAAWRQIALRLR"
FT   gene            complement(509472..510206)
FT                   /locus_tag="Tmar_0434"
FT   CDS_pept        complement(509472..510206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0434"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="COGs: COG0860 N-acetylmuramoyl-L-alanine amidase;
FT                   InterPro IPR002508; KEGG: bts:Btus_1777 cell wall
FT                   hydrolase/autolysin; PFAM: cell wall hydrolase/autolysin;
FT                   SMART: cell wall hydrolase/autolysin; SPTR: Cell wall
FT                   hydrolase/autolysin; PFAM: N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50555"
FT                   /db_xref="GOA:E6SGK9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGK9"
FT                   /protein_id="ADU50555.1"
FT                   /translation="MQRRTPPAPATWTQAAALAALAALVLVLFSPRALAPPPGARAHPV
FT                   IVLDPGHGGIDGGTHLDGRILEKDLTLQLAQAMAPLLEASGFRVVLTRTADYALAPGDD
FT                   DASVRRDLEERLRIAREARAAALVSLHVNAARDSRQRGPIVFYQIGDEPGRRLARAIQD
FT                   RLNAVFPPAARNEALPADFFLLARAGRPAVLVEFAFLTNPADRAILLRPQGRGLLAAAA
FT                   VQGLVGGLAELGIRAHGVPGRR"
FT   sig_peptide     complement(510102..510206)
FT                   /locus_tag="Tmar_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            510600..511565
FT                   /locus_tag="Tmar_0435"
FT   CDS_pept        510600..511565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce3649 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50556"
FT                   /db_xref="GOA:E6SGL0"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL0"
FT                   /protein_id="ADU50556.1"
FT                   /translation="MTGEQGRQTPQLPDQDRATGRGSTAREPGAGRPGPAEPDPNPGLL
FT                   LVGPAAVPAGRADRRKGREGPPGLPADRQDGAEPGQRRPWGGRFLRRRPPAAPVPVALQ
FT                   PGSGPGERPAPAGAWDRPDPGGPPEVPDTAAAPDTGGVEEDELPPPVDPAPLGWFLLGV
FT                   VYALTAVYSAVPAQHSTLFGAGPAGAGRMAVALAVVPYALAGLYTGLTAAGRGWLYPVT
FT                   FAAWPLLLERLALYLFGMAGRWMLAGFPAGWREAVPLAAALSFTRETLAPYATPAYMAW
FT                   GLGSLALTASVHAGVRLAAGRWGRWRTGRARHGAPGAAGA"
FT   gene            511596..511991
FT                   /locus_tag="Tmar_0436"
FT   CDS_pept        511596..511991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmo:HM1_2664 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50557"
FT                   /db_xref="GOA:E6SGL1"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL1"
FT                   /protein_id="ADU50557.1"
FT                   /translation="MEPPKRFPHPEQDEPGGPGEPFGPGRLPADGFDPEEEFDSPEEVD
FT                   AVFRSQRRLVMARVVWLILLVLGVPIANAWWPLWWNGWAGVPVTPAWAVAAGGGLVALW
FT                   LLGVQHARMADRVERAMLGRRREDDDV"
FT   gene            511984..513786
FT                   /locus_tag="Tmar_0437"
FT   CDS_pept        511984..513786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0437"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG4147 symporter; InterPro IPR001734; KEGG:
FT                   hmo:HM1_2663 na+/solute symporter; PFAM: Na+/solute
FT                   symporter; SPTR: Na+/solute symporter; PFAM: Sodium:solute
FT                   symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50558"
FT                   /db_xref="GOA:E6SGL2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL2"
FT                   /protein_id="ADU50558.1"
FT                   /translation="MSSPATVWLTLALLFSSLVLGSLARRYIQTTVDFYLAGRRIGYLA
FT                   NASAICGDYFSAASFLGVAAAVYAVGYDGLLYGLGFGAGFLPVLLFVAAPLRRSGAFTL
FT                   PSFCGLRFASRAARLTAVALVLVIVTLYLVPQMIAAGSTWTMLVGYGLPGITPYATGVT
FT                   AAAVIMTAYVVLGGMRATTWNQVVQFGVLLSAVVTVLVLAYVRGFRYLDALAELGRQPV
FT                   AAENRLHPGLAAGFLHPGLRFDLFDQISLLLSLVFGTAGLPHIMHRYFTSPTGAQARRA
FT                   TAWVLGLVTLFYVLTGAVGVAARAMLPGGPAGGGGGTVVEPGSAGRQAAAEGAPPVGVP
FT                   PLDAGAGEGAVAGTGMAEVPEVALRDPDMVVPALAWRVGGDAVLALVAAGAFAAIYSTI
FT                   GGLLIAAAAAIGHDLYEELTGGGPEQRRVLVGRLTAAGTGGAALAVGLAFGRWGPGGQE
FT                   PGLFAQMVTWAFAVAASGFFPVLTLGIWWRGMTAAGAVAAMVAGGGGSLALILWGVGQQ
FT                   LGWWPAPAAASGLDAVPATFPTAVTLPLGFAAGVAGTLLDRCRRRHPIDESRLDDLWTR
FT                   MHGTAAERQAERLARIALAQRWRG"
FT   sig_peptide     511984..512055
FT                   /locus_tag="Tmar_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(513844..514743)
FT                   /locus_tag="Tmar_0438"
FT   CDS_pept        complement(513844..514743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0438"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="COGs: COG3279 Response regulator of the LytR/AlgR
FT                   family; InterPro IPR001789: IPR007492; KEGG: dae:Dtox_3773
FT                   two component transcriptional regulator, LytTR family;
FT                   PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; SMART: response regulator receiver; SPTR: Two
FT                   component transcriptional regulator, LytTR family; PFAM:
FT                   Response regulator receiver domain; LytTr DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50559"
FT                   /db_xref="GOA:E6SGL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL3"
FT                   /protein_id="ADU50559.1"
FT                   /translation="MSGVTVPQAGIRLRALIVDDEAPARQELRYLLAGRDDVEVVGEAA
FT                   TAAEALQLAASLPYAVVFVDVRMPDISGLELAQALHTLPEGQRPHVVVVTAYEEYAVEA
FT                   FAIGIADYLLKPVSPERLELALERVKRRIFRHPGPVPGGEAAGVPWVHTDSPPAPRRGA
FT                   GGTAGTTGPFPPATAASFPDAYPGDVHVRIPVHTAFKTLLLPPADVYYIAAVHGSLRVK
FT                   TYEREFQARGTLKEMERRLRGRGFFRAHRHYLVNLERVSELIPDFKGAFELVLTDRQGT
FT                   RIPVSRRRAHHLRRLLVL"
FT   gene            complement(514802..516100)
FT                   /locus_tag="Tmar_0439"
FT   CDS_pept        complement(514802..516100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0439"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="COGs: COG3275 Putative regulator of cell autolysis;
FT                   InterPro IPR004358: IPR005467: IPR003018: IPR003594: IPR
FT                   010559; KEGG: adg:Adeg_1762 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region; GAF
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; GAF domain
FT                   protein; SPTR: Signal transduction histidine kinase, LytS;
FT                   PFAM: Histidine kinase; Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50560"
FT                   /db_xref="GOA:E6SGL4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL4"
FT                   /protein_id="ADU50560.1"
FT                   /translation="MAGLGAVTAAAGYWWGSHAGWVAAALAGAAVTFGVAAGGAVLRRG
FT                   GLAERAEPDTGCWPPSPDLVTRTLPHLRHGLQPGTAQRVAEIVRCLTGADAVALSDRER
FT                   VLALAGAAARHHESCPPLAGTPAGSVVASGRPRTVAGEDGAGCPLGGTGCGCPLRSAVM
FT                   VPLQVRRRTVGTLQLLFTVPARPSRRTVDLARSVAQVLSLELELAWLAQQADLAAQARL
FT                   DALRAQINPHFLFNVLNTIIVKSRSDPEQARRLLVRLADFFRYAMRSRGHFASLSEEFA
FT                   FVRAYLFLEQARYEGRLRVRYQIDPQALAATVPVLTIQPLVENAVKHGIAPKPDGGLVE
FT                   LRIEADPLTLRLRITVADDGVGMDAHRLRQALERQSRGIGLANIRERLERLYGDQARCR
FT                   IQSQPGRGTRVQIELPLQAAAPTEVGEPGGTRT"
FT   sig_peptide     complement(516020..516100)
FT                   /locus_tag="Tmar_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(516367..518169)
FT                   /locus_tag="Tmar_0440"
FT   CDS_pept        complement(516367..518169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0440"
FT                   /product="putative sodium symporter protein"
FT                   /note="COGs: COG4147 symporter; InterPro IPR001734:
FT                   IPR018247: IPR019899: IPR019900; KEGG: sth:STH2322 Ssf
FT                   family Na+/solute symporter; PFAM: Na+/solute symporter;
FT                   SPTR: Ssf family Na+/solute symporter; TIGRFAM: putative
FT                   sodium symporter protein; SSS sodium solute transporter
FT                   superfamily; PFAM: Sodium:solute symporter family; TIGRFAM:
FT                   probable sodium:solute symporter, VC_2705 subfamily;
FT                   transporter, SSS family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50561"
FT                   /db_xref="GOA:E6SGL5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL5"
FT                   /protein_id="ADU50561.1"
FT                   /translation="MSTQTRSGRRISMGGVWLLYTVCFGLLVTVLGLLESAGVMGQRAI
FT                   GYVFLATTFLIYAAIGIWSRTRVLDEYYVAGRSIPAIYNGMATAADWMSGASFISMAGI
FT                   LYALGYDGMAYIMGWTGGYVLLALLLAPYLRKFGKYTIPDFIGDRFQSNATRVVAVIAT
FT                   VIISGTYLIAQITGVGIVMSRFLQIDISVGVFLGLLGVLFCSFLGGMRAITWTQVAQYI
FT                   VLIVAYLIPITLLAHQQTGVPLPQLMQGQALQQVTALEPQHGITKPFVEPFNETGGMFQ
FT                   FLALTLSLMVGTAGLPHVLVRFYTVPNVRQARWSVGWALLFIFLLYFTAPAYAAFVRWE
FT                   ILQNVAGRAIDQLPAWVQAWAKTGLINLAAADANANGILEAVELDRVMNTDIVVLAAPE
FT                   IAGLPYVFAGLVAAGGLAAALSTADGLLIAVSAAISHDLYYKVLNPNASTAQRLMLSRI
FT                   MVLIVAAVGAWIATYRLALIAQIVAWAFSLAAASLFPVLVLGIWWKRANAKGAMAGIIS
FT                   GLAVTLAYMVANYTTQGAFNILGISHTAAGIFGMPVNFLVAYLVSRATEEPAPEIQEFV
FT                   SSLRYPKQLVAAEISAAAPEPATD"
FT   sig_peptide     complement(518059..518169)
FT                   /locus_tag="Tmar_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(518212..518508)
FT                   /locus_tag="Tmar_0441"
FT   CDS_pept        complement(518212..518508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0441"
FT                   /product="putative solute symporter protein"
FT                   /note="COGs: COG4327 membrane protein; InterPro IPR019886;
FT                   KEGG: sth:STH2323 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: putative solute symporter
FT                   protein; TIGRFAM: probable solute:sodium symporter small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50562"
FT                   /db_xref="GOA:E6SGL6"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL6"
FT                   /protein_id="ADU50562.1"
FT                   /translation="MDAGLQQDVARHARMEIAARVEGHYRENVRLIKRLLLVWFLVSYG
FT                   AALVVEALNRITFLGFPFGYYMAAQGSIAVFVVLIFIYARKMEEIDRRYGVDE"
FT   sig_peptide     complement(518368..518508)
FT                   /locus_tag="Tmar_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            518824..520791
FT                   /locus_tag="Tmar_0442"
FT   CDS_pept        518824..520791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0442"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="COGs: COG0365 Acyl-coenzyme A synthetase/AMP-(fatty)
FT                   acid ligase; InterPro IPR020845: IPR011904: IPR000873;
FT                   KEGG: tro:trd_0711 acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: Acetate--CoA ligase; TIGRFAM:
FT                   acetate/CoA ligase; PFAM: Domain of unknown function
FT                   (DUF3448); AMP-binding enzyme; TIGRFAM: acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50563"
FT                   /db_xref="GOA:E6SGL7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL7"
FT                   /protein_id="ADU50563.1"
FT                   /translation="MTEPQGRPIDALLKEERRFAPPEAFRARAHVRDESVYEEAERDPE
FT                   GYWARWAEELEWFEKWDRVLEWNPPHARWFVNGKINASVNCVDRHIRGPRRNKAAIIWE
FT                   GEPGDTRTLTYFDLHREVNRFANVLKSLGVKKGDRVTLYLPMIPELPIAMLACARIGAP
FT                   HSVVFAGFSPQALASRMEDAGSRFLVTCDGFYRRGKVVPLKAQADEAIRLLAGKQDVEA
FT                   VVVVRRTGDEVPFTPGRDRWWHELMEQAERLCPPEPMDAEDMLFMMYTSGTTGRPKGIV
FT                   HTTGGYLTGAYATTKWVFDLQEDDVYWCMADIGWITGHSYIVYGPLANGATVVMYEGAP
FT                   DWPDKDRPWVIVEKYGVTVFYTAPTAIRAFAADGPEYPRRHDLSSLRLLGSVGEPINPE
FT                   AWMWYHEHIGGGRCPIVDTWWQTETGAIMITPLPGVTVTKPGSATRPFPGIKAAVLDDQ
FT                   GNPVPPGQGGGYLAILRPWPSMLRGIWGDEQRYVNTYWSKWGRDVYYPGDGAKIDEDGY
FT                   FWVLGRVDDVMNVAGHRLSTMEIESALVSHPAVAEAAVIAAPHELKGQVPVGFVILEAG
FT                   RQGSPELEAELKEHVAKVISPIARPDRVLFVPDLPKTRSGKIMRRLLRDIVEGRELGDT
FT                   TTLRDPDVPEQLRQMYAGRS"
FT   gene            521059..524250
FT                   /locus_tag="Tmar_0443"
FT   CDS_pept        521059..524250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0443"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="InterPro IPR011260: IPR007630; KEGG: ttr:Tter_0596
FT                   sigma-70 region 4 domain protein; PFAM: sigma-70 region 4
FT                   domain protein; RNA polymerase alpha subunit domain
FT                   protein; SPTR: RNA polymerase sigma factor; PFAM: Bacterial
FT                   RNA polymerase, alpha chain C terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50564"
FT                   /db_xref="GOA:E6SGL8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL8"
FT                   /protein_id="ADU50564.1"
FT                   /translation="MELAPNAPAPVPPEASDAGAPGEHPGTAPGGAEGILGPAPRGGRA
FT                   AAGSSGTDAGGSVPGEESRSGRPRSGTSLAAIPLSLLAIPPRVRLALQQRGYDTVGDLA
FT                   RQPDTRLLATRGMGTRGLLSLVTELARVMADPAYQEDLLARAGRYDPGRFPDAVRNLAI
FT                   DDLGLSQRAYRALRRAGVQTVGQLLELGEAGLRRLRGLGPRSLDEICHRLDALQSGRPL
FT                   PPPGVGAGDPLAPELMDDPAPIAVLLLPRRVATALQRAGLHTVGAVAGFSQGGLRRLRG
FT                   LGESGVAAILDGFRRYRQERSQRDAAPRDLEDWLRELVEPLADREREVLALRYGLLGAE
FT                   PHDLAAIAARWQTTRQWVSVVQGRALRRARARARLDRFAPLVAAVQAAATRCGAAGPAE
FT                   LAEALRQEGTVAVPESADQAVRLVGLLVQVTPGLRRVAGSTWATLEVAQRLPEAARRLE
FT                   AYLAETGRPASLAELAGYLAEHMPDAPASPEAMARAVLATQGAFGRFPGGLYGLASWRV
FT                   GRRVRARDYVYQALERHGRPLHYAELTRLVNQLLPEGRKMPPTHVLTILSSGEPFRRFD
FT                   RGIYGLTHWEREPERNLAGLCRDALAERGEPATLNQVVEAVQQQRRYPRRTVARALNED
FT                   PAVLRYGRDRFGLSAWLAADPQAAGAVRAPAYGPRPTNLVAVRGLLTELLAGHVYDTAQ
FT                   LTAYLGRWRQRSQARQIIAYLHAVGWLTGIDDAWAATPLNEAWVRAGSEPAQLAALALA
FT                   DPAFAHALVLHEAFRRLDAADGPDGTGAGEGPDAAGAGDGPSARTAAGAVPGAFTPAQA
FT                   ARWLAQRIRRAADARGVEPGPGFRSLLRRQWLVTAWFDPWVALLADGRHSPGPGGEGAA
FT                   AAPDGDEPAAVAGTARSRTGTSRAVLWDHAARRLWPARPVHLPAAWLQTPATAWALLAD
FT                   AVAARQGGAAVDLEALAEWCREQGVAANPAQVEAELFALGLWPVQEGPRLRLYMPYRLV
FT                   VPPEGLRLPGLPAEGALLDAAAEVLRQAGVLTGLPAGWPAPPAAEVYGVPPLGAGGPAE
FT                   AAAHGEAGGLRAGDR"
FT   gene            524363..525553
FT                   /locus_tag="Tmar_0444"
FT   CDS_pept        524363..525553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0444"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /note="COGs: COG0166 Glucose-6-phosphate isomerase;
FT                   InterPro IPR011857: IPR001347: IPR019490; KEGG:
FT                   rmr:Rmar_1238 bifunctional phosphoglucose/phosphomannose
FT                   isomerase; PFAM: Bifunctional
FT                   glucose-6-phosphate/mannose-6-phosphate isomerase-like;
FT                   sugar isomerase (SIS); SPTR: Bifunctional
FT                   phosphoglucose/phosphomannose isomerase; TIGRFAM:
FT                   bifunctional phosphoglucose/phosphomannose isomerase; PFAM:
FT                   Bacterial phospho-glucose isomerase C-terminal region; SIS
FT                   domain; TIGRFAM: bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50565"
FT                   /db_xref="GOA:E6SGL9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGL9"
FT                   /protein_id="ADU50565.1"
FT                   /translation="MDGTNPRTGAGPVVRGGPEPVAGAAGGPVDWQALRRYDVAGMLGA
FT                   VAAFPHQLEEAYRLGREAANLPRPLAERPRAVIVAGLGGSAIGGDFVAAVLEPEAPVPV
FT                   MVHRDYGLPGWVGPQDLVFAVSYSGATEETLSAYAAARRRGAAVVAVASGGPLLEQAAA
FT                   DEAAGAPVRRVAVPGGLAPRAALGYLMLPVLYLTCAWTGVGDPSAQVEEAVAVLRRQAR
FT                   ELEPNGPEGPAQTLAQRMLDRPLFLYGAGRLGQAAAYRWQCQLNENAKLLAHAHAFPEL
FT                   DHNEVMGWEGAPQPRDGDQRRPLSILLQAPADHPRNRARMEITAELVGDRAEWVTVTAQ
FT                   GQGRLAQLLSLSYLGDFVSVYAALLRGLDPSSIASIQRLKERLAALPAGDGTGPDR"
FT   gene            525726..526853
FT                   /locus_tag="Tmar_0445"
FT   CDS_pept        525726..526853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_0586 collagen triple helix repeat
FT                   protein; SPTR: Collagen triple helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50566"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM0"
FT                   /protein_id="ADU50566.1"
FT                   /translation="MPFPLKADRRGPGKPRWGGWLAGLLLVALVAAWAGAGFAGPWRGT
FT                   GRAPGRWVFRDDLGQRVLLPAPPRRVACSGRDLCDLVQALLGDAAVTVLPPGAEEQALR
FT                   PGLADLVLLPEVTRRPGLAGRLRARGWPAATLRWRDVTQLPDATLRLAAWLNRVDRGRE
FT                   LAATYARRLAGVEAAVAAIPPAQRPPVLVLAWDRPPVWAGAGSPAAILVERAGGRLVTG
FT                   GAAENAARWPAGPAGRLAGGRARWGAGDAAGAGPAGGDGGRGAARPSGGHARPGAVWLA
FT                   GSLGGRAAAWLAGEEAWRAASWPAGTRVVTSLLTPAVPPGGPEAATALYLPPAQLLGAG
FT                   PEALQGLERLAAWLHPGRTGDAGEPLRMVPLPVAP"
FT   sig_peptide     525726..525827
FT                   /locus_tag="Tmar_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(526863..527591)
FT                   /locus_tag="Tmar_0446"
FT   CDS_pept        complement(526863..527591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0446"
FT                   /product="thiamine pyrophosphokinase"
FT                   /note="COGs: COG1564 Thiamine pyrophosphokinase; InterPro
FT                   IPR006282: IPR007371; KEGG: sth:STH1052 thiamin
FT                   pyrophosphokinase; PFAM: Thiamin pyrophosphokinase
FT                   catalytic domain-containing protein; SPTR: Thiamin
FT                   pyrophosphokinase; TIGRFAM: thiamine pyrophosphokinase;
FT                   PFAM: Thiamin pyrophosphokinase, vitamin B1 binding domain;
FT                   Thiamin pyrophosphokinase, catalytic domain; TIGRFAM:
FT                   thiamine pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50567"
FT                   /db_xref="GOA:E6SGM1"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM1"
FT                   /protein_id="ADU50567.1"
FT                   /translation="MSTPVSQPAPGTPPDFGFLPPPEPPYALVVAGGDLDEPALAEETA
FT                   RLARGASLCVAADGGLRLLRAVGIWPGVLVGDFDTLTPDEVEAARAAGVTVRAFPPAKD
FT                   FTDAELALDVARRQLGRAPLYVVGGVGDRIDHTLANLLLAARWWTEGHPVTVLAGPAHV
FT                   RPLAGPGEVRFRGAPGQTVSLIPLTPQMTGVDTEGLVYPLAGATLTWGNAYAVSNALVG
FT                   EEGAFRARTGMGLVVLQRRA"
FT   gene            527802..528191
FT                   /locus_tag="Tmar_0447"
FT   CDS_pept        527802..528191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0447"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="InterPro IPR003646: IPR013247; KEGG: sth:STH1029
FT                   putative N-acetylmuramoyl-L-alanine amidase; PFAM: SH3 type
FT                   3 domain protein; SMART: SH3 domain protein; SPTR:
FT                   N-acetylmuramoyl-L-alanine amidase; PFAM: Bacterial SH3
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50568"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM2"
FT                   /protein_id="ADU50568.1"
FT                   /translation="MSRIRDLAAALREQERPLLDQYRQLVEAATTETERRLAQMMYNYQ
FT                   RFQLQSLELFQDRVPERFQCFGVITHDDVNVRQRPSGKSQTLTRVGRGTPVIVMAFDGF
FT                   WAEVQLVGGATGYVFKDYVRCEVGG"
FT   gene            complement(528343..528912)
FT                   /locus_tag="Tmar_0448"
FT   CDS_pept        complement(528343..528912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0448"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR001367; KEGG: aac:Aaci_2011 manganese
FT                   transport transcriptional regulator; PFAM: iron dependent
FT                   repressor; SMART: iron dependent repressor; SPTR: Iron
FT                   (Metal) dependent repressor, DtxR family; PFAM: Iron
FT                   dependent repressor, metal binding and dimerisation domain;
FT                   Iron dependent repressor, N-terminal DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50569"
FT                   /db_xref="GOA:E6SGM3"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM3"
FT                   /protein_id="ADU50569.1"
FT                   /translation="MRYIDGGGNEVTGVRPTPSMEDYLETIYELIRSKGYARVSDIALA
FT                   LNLQPSSVTRMVQRLDEQNYVTYERYRGLVLTERGEAIGRAMRQRHETLATFLRLLGVH
FT                   DEAVVQQDVEGIEHHVSRQTLERIERFVAFARANPAWMNQLHAAMQPGADGDAPGRAAP
FT                   RPDGDGPAGAASGEAQAGPARAGPGP"
FT   gene            complement(529133..529537)
FT                   /locus_tag="Tmar_0449"
FT   CDS_pept        complement(529133..529537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0449"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="InterPro IPR000923; KEGG: tro:trd_0373 halocyanin
FT                   precursor-like protein; PFAM: blue (type 1) copper domain
FT                   protein; SPTR: Halocyanin-like protein; PFAM: Copper
FT                   binding proteins, plastocyanin/azurin family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50570"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM4"
FT                   /protein_id="ADU50570.1"
FT                   /translation="MKRARRSRLVVVALMLLALPVLAACGGGGGGGGSNQGNGDQAAGN
FT                   KITVTAQNMSFDQTEITLKKGQTYTIELVNNDSVQHDLVSEQLGLEVGLTDPGQSNSVE
FT                   FTPQQTGDFEFICSVPGHSATMKGTIRVTE"
FT   sig_peptide     complement(529406..529537)
FT                   /locus_tag="Tmar_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(529822..531075)
FT                   /locus_tag="Tmar_0450"
FT   CDS_pept        complement(529822..531075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0450"
FT                   /product="peptidase M28"
FT                   /note="InterPro IPR007484; KEGG: sth:STH1635 hypothetical
FT                   protein; PFAM: peptidase M28; SPTR: Putative
FT                   uncharacterized protein; PFAM: Peptidase family M28"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50571"
FT                   /db_xref="GOA:E6SGM5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM5"
FT                   /protein_id="ADU50571.1"
FT                   /translation="MKVPDAEIPVPDPWPDLEALCRLPHRGTATPEEGRAARWLAAVLQ
FT                   ERGYEVDVQPFTAPRHTLYLGPGWIGLGLAALALGGARWSGPAWGYAVMAAVAVLALLP
FT                   LVGELALWPAGSRLSLGVVVPRGRSQNVVARLPRHGAPRGDAVAGPPLHVVVTAHYDTQ
FT                   WGSWLFAPRFLPFLQAFFVAGYAAFAAVPVLLAARALGAAPAAPLAAAGALAAAVAGFL
FT                   LVSWLAGRPVNGANDNGSGVAVALALARRWAQAPLPGIELTVALTGAEETGMRGMAALL
FT                   DHPWFPRHAPRGVVVVNVDNVGAGRLHYLTAEGMLRPVRYDRWLVERARELAAALPAGM
FT                   LTPGPRPLLPTDALVPAARGIPAITFLGAGPRGRIPHYHWHTDRLEHVDRAHLVQVAGV
FT                   LWSYLEHLARAASRPPAA"
FT   gene            complement(531088..532833)
FT                   /locus_tag="Tmar_0451"
FT   CDS_pept        complement(531088..532833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0451"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COGs: COG0400 esterase; InterPro IPR004360:
FT                   IPR003140; KEGG: rlt:Rleg2_0282 glyoxalase/bleomycin
FT                   resistance protein/dioxygenase; PFAM: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase;
FT                   phospholipase/Carboxylesterase; SPTR: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase; PFAM:
FT                   Phospholipase/Carboxylesterase; Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50572"
FT                   /db_xref="GOA:E6SGM6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM6"
FT                   /protein_id="ADU50572.1"
FT                   /translation="MASDPRTPGDPVGGIHHVTMIAGDPQANVDFYGGVLGMRLVKITV
FT                   NFDDPGTYHFYFGDDVGRPGTLLTFFPIPGAAPGRRGAGQVTAVALAVPPGSLGFWEER
FT                   LQAFGVPCRRHQGPLGQPALAFADPDGLALALLEDATLAGDGASWPGWGGGPVPAAHAI
FT                   RRVAGVTLTVRELEPTARVLEALGYRPVPADGGAPGGAAVPPASQAGGSTRQAGAPVTG
FT                   EGAPALRRLWGVNGGRTTHWVEVVADPAARRGTMGAGVVHHVAFRTPTDQAQEDWRRRV
FT                   GRLGLAVTPVQDRRYFRSIYFREPGGVLFEIATDPPGFLIDEDRDTLGRALRLPPWLEP
FT                   VRPSLEQQLPPLHHPADFAELRFIHRFVPPPGETPAGAPGTAADEPAGILLLLHGTGGD
FT                   ENDLLPLGRYLDPRAALLSPRGQVLEEGMPRFFRRLAPGVLDPEDLAARADGMARFVAA
FT                   AARRYGFDPRRVVAVGYSNGANLAAALLLRHPGLLAGAVLFRPMEVPVASPPAGALAGV
FT                   PVLVAAGRQDAVVPADSSRALAQRLEEAGARVTLHWAEAGHGLQEEELRRARDWLVERK
FT                   EARTR"
FT   gene            complement(533079..534227)
FT                   /locus_tag="Tmar_0452"
FT   CDS_pept        complement(533079..534227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH1605 hypothetical protein; SPTR:
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50573"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM7"
FT                   /protein_id="ADU50573.1"
FT                   /translation="MSVRHGRARHLFASGNTGHGFRSYFENVAWPEPRRVFVLKGGPGT
FT                   GKSAVIRLVADGLMERGVAVELFHCPSDPASLDGVNAPDLGLAVVDGTPPHAVEPPLPG
FT                   LVGRLLSLEATANRDLLASRRDHIAATGRRVRQRFHLAHRYLALALGALQLYEDFYDHA
FT                   GALDRAALDHSAHEIEAALFEGQRLVRAGRRGRVRRLFASAVTPDGPRHFLDSLLDPLP
FT                   RRVFIRGNPGTGCATLVERVAEAALRRGLDIEAYSCGLHGRRLDHVIIPELGAAVVHNA
FT                   YPHTYEPKAGDLVIDTAAFVDVDALERYREEMEVAQALFGQAFDQGIWYLRRALMAHQE
FT                   LEQVYATPELRTQVEAYTREILAEADALLEEQSRTREGQRLA"
FT   gene            534538..535185
FT                   /locus_tag="Tmar_0453"
FT   CDS_pept        534538..535185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0453"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="COGs: COG0789 transcriptional regulator protein;
FT                   InterPro IPR000551; KEGG: aac:Aaci_1572 transcriptional
FT                   regulator, MerR family; PFAM: regulatory protein MerR;
FT                   SMART: regulatory protein MerR; SPTR: Transcriptional
FT                   regulator, MerR family; PFAM: MerR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50574"
FT                   /db_xref="GOA:E6SGM8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM8"
FT                   /protein_id="ADU50574.1"
FT                   /translation="MSRHRNLPLYSIGAVSNLTGLSERRIRYYEQAGLVRPARTAGNQR
FT                   RYSQADVERLLEIKGLLQQGLHLDDIRRRLLERRRREAIMGPPDVPVALAAVAADPWPL
FT                   PVSGRGGRGAEPGLPRIDRLFRGPAPAVPGVGTARTLYPALDPAVLYQARRHQRPRDGR
FT                   PWDRLPRPGRDARDARDGKEGGAGGDGLRSPQGPGRRGTPGEGAGHDGPAAG"
FT   gene            535166..536485
FT                   /locus_tag="Tmar_0454"
FT   CDS_pept        535166..536485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0454"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="COGs: COG0174 Glutamine synthetase; InterPro
FT                   IPR008146; KEGG: mta:Moth_1294 L-glutamine synthetase;
FT                   PFAM: glutamine synthetase catalytic region; SPTR:
FT                   Glutamine synthetase; PFAM: Glutamine synthetase, catalytic
FT                   domain; Glutamine synthetase, beta-Grasp domain; TIGRFAM:
FT                   glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50575"
FT                   /db_xref="GOA:E6SGM9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGM9"
FT                   /protein_id="ADU50575.1"
FT                   /translation="MGRPPAEPVPPDEPARRLAAQGVQLVQLVYADVLGVQKGLTLPVL
FT                   QAGAAWAGGVRVDGASLEGFIRVEEREMRLRAGGEEVFVLPWTPAEARVAAVPAAIDTR
FT                   DGRPFDGCPRERLLRAVRRLDELGVAVELAFEMEFYLLRRRRGRPEVRVPDRAGYLDLS
FT                   VRDAGEPVRQEIALALEGMGIVVESVHHAVGPAQHEIDLGWQPPVAAADHLMVAKRAVY
FT                   AVAERHGMHATFLPKPRTGSHGSGLHVRMRVRPLPGAAWSRPAVTRHWLAGLLHHARSL
FT                   CAVTNPLVNSYKRLVPGFEAPVYVVWGRDTHAPLARLVAGWEAGELEWRAPDPCCHPYL
FT                   ALAALLRAGADGIERRLEPPPPLEENVFELDPAEIAARGLEPLPGSLGEALDDMRVSGL
FT                   IRDALGEYLFTRYLEAKRMEWDIYRVQVHQWELDQYLPVF"
FT   gene            complement(536624..536914)
FT                   /locus_tag="Tmar_0455"
FT   CDS_pept        complement(536624..536914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:536876..536878,aa:Sec)
FT                   /locus_tag="Tmar_0455"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109; KEGG: bcg:BCG9842_B1149
FT                   glutaredoxin family protein; PFAM: glutaredoxin; SPTR:
FT                   Glutaredoxin family protein; manually curated; PFAM:
FT                   Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50576"
FT                   /db_xref="GOA:E6SGN0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN0"
FT                   /protein_id="ADU50576.1"
FT                   /translation="MPRKVELYMQPGUADCRHAEEFLRQLGVEFTAYDVRQDPAAYDRL
FT                   VNQYQSRVTATVVIDGKVFRGFGRHREAIERALKGEGDGEAAGAGNGDGDR"
FT   gene            complement(536969..537421)
FT                   /locus_tag="Tmar_0456"
FT   CDS_pept        complement(536969..537421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0456"
FT                   /product="protein of unknown function DUF192"
FT                   /note="COGs: COG1430 conserved hypothetical protein;
FT                   InterPro IPR003795; KEGG: gem:GM21_3209 protein of unknown
FT                   function DUF192; PFAM: protein of unknown function DUF192;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ACR, COG1430"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50577"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN1"
FT                   /protein_id="ADU50577.1"
FT                   /translation="MHWGVDQDAGREPDRPIAWSPRRPPGPGPVRVINLTRGTVLGDRI
FT                   TVAASWRARARGLLGRPALAPGEGLVLWPCRWVHGLGMAFAIDVVHVDRQGRVVAAYRL
FT                   DPGRVGPPVWRGQAVLELPAGTIAATGTRTGDRLQWMVSAAGDVTV"
FT   gene            537980..539368
FT                   /locus_tag="Tmar_0457"
FT   CDS_pept        537980..539368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0457"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   bbe:BBR47_20870 hypothetical protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: Conserved hypothetical membrane
FT                   protein; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50578"
FT                   /db_xref="GOA:E6SGN2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN2"
FT                   /protein_id="ADU50578.1"
FT                   /translation="MLEFRKPAGTELVPGTRSIPGSVPGNEPRRYGRAWPGPVGGRTVT
FT                   YLDPAATVVGAPVWPVWLLRGLEAAVVFVVVYNLAVYVGGLRNPRPVPRTTPRTRFAVL
FT                   IPAHNEEAVIGPLIESLGRQAYPRHLYDVFVVADNCTDGTAAAARAAGAHVWERFDDQR
FT                   RGKQYAVAYALERIASLGRRYDAVVMFDADNLVEPNFLQVMNDHLAAGEKIIQAYVDAK
FT                   NPDDSWVSAAFAFSFWMSNRWRLQARHNWGLCGALAGTGMCIAWDVLERVGWDVHTLTE
FT                   DLEFSAKALLHGYVTTFARETRIYDEKVTGFVASCRQRVRWARGNVQVMLIHAPRLLWA
FT                   GLRQLDPVKFEFVFDLTRPLHLVLTTVVSALSLAAGPELARWGWVPLPDWPVRLTALFA
FT                   VVGPLLVLVLDRLPLRPYRFIPLLPIFQYSWIVLVLWALLTPRNRQWVPTVHTRAMRLG
FT                   ELSR"
FT   gene            539669..541612
FT                   /locus_tag="Tmar_0458"
FT   CDS_pept        539669..541612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0458"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterPro IPR003439:
FT                   IPR017940: IPR017871: IPR003593: IPR 001140; KEGG:
FT                   tai:Taci_1285 ABC transporter related protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter; ABC transporter transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50579"
FT                   /db_xref="GOA:E6SGN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN3"
FT                   /protein_id="ADU50579.1"
FT                   /translation="MPGAWAAYRHLLRPYRGQTALAVVLLLARSGLDLGIPQILRWLLD
FT                   VAIPARDLGLLASGALVSLALVAGRAAVHYAAVYVSFDLTQRVVHDLRVRLFRHIASLP
FT                   LAFFHRERQGAVVSRLTTDVGAIERFVQAVFARLAGEFGGVLAVVATVIALQPALGMGL
FT                   ALLLPAAGAWFYLQTVRIRRLSREIQAQAGRLGARATEVVGAIATVKAYGGEPHEAARF
FT                   AAASQRYRSLNMERRRFIGRMESGADLMGNLGLLALFFIGGYLAIRGVLSPGRLAALVL
FT                   YLRMMLAPVRSLVNFHLILQEGLAAMERVQEILALPAEGARAEGAFPAEERQGALGSAE
FT                   PGHARPAATAGARQPSGSPGVAVLAPAWGAGVCPGPGVTAGAGAAAGAALEFAGIWFRY
FT                   QPGGPPVLKGVDLRVAPGERVALVGRSGAGKTTLLQLVPRFYDPERGAVYLDGRDVRDY
FT                   DLDGLRRQVAWVMQDPVLFAGTVAENIAYGCPDATPEAIRRAAELANAAAFIEALPQGY
FT                   DTPVGERGVRLSGGQRQRIAIARALLRRPRLLLLDEATSFQDAESEERIHEALDLLAAG
FT                   GCTCVVVAHRLSTALRADRIVVMDAGRVVETGTHAQLLAHGGLYARLYRTFFAPRRVAA
FT                   GGPGSGVPPAGP"
FT   sig_peptide     539669..539761
FT                   /locus_tag="Tmar_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(541663..542100)
FT                   /locus_tag="Tmar_0459"
FT   CDS_pept        complement(541663..542100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0459"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="InterPro IPR013538; KEGG: gym:GYMC10_5499 activator
FT                   of HSP90 ATPase 1 family protein; PFAM: Activator of Hsp90
FT                   ATPase 1 family protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Activator of Hsp90 ATPase homolog 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50580"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN4"
FT                   /protein_id="ADU50580.1"
FT                   /translation="MTVAAGDPGRSLPDIRHTLVLAAPVDRVWNAVATAQGMSAWLMPN
FT                   DLQPGLGSTFHLQTPFGPVPCRVTAFDPPYRLAFTWGSDWHVTITLEPAGSATRLTLVH
FT                   SGWKAGHVAPESGEPHEVIRERMDRGWATGVLPRLRALVES"
FT   gene            542310..542783
FT                   /locus_tag="Tmar_0460"
FT   CDS_pept        542310..542783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0460"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro IPR006684:
FT                   IPR006683; KEGG: tte:TTE1814 thioesterase; PFAM:
FT                   thioesterase superfamily protein; SPTR: Predicted
FT                   thioesterase; PFAM: Thioesterase superfamily; TIGRFAM:
FT                   acyl-CoA thioester hydrolase, YbgC/YbaW family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50581"
FT                   /db_xref="GOA:E6SGN5"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN5"
FT                   /protein_id="ADU50581.1"
FT                   /translation="MTCCTLRFRVRYGETDRMGRAYYARYFDWFTDGRTELIRRMGLSY
FT                   RQMEDQGVFLPVLEATCRYLRPVDYDDDLELEVRLQRLTPTRMDFAYRLRTAGGGPAVA
FT                   EGETRHAFIDGRGKPVNLRKARPELWRQLEVLQPEGQALAGREAPLPQEEPAR"
FT   gene            542780..543277
FT                   /locus_tag="Tmar_0461"
FT   CDS_pept        542780..543277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgu:100231619 similar to Zinc finger protein
FT                   281; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50582"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN6"
FT                   /protein_id="ADU50582.1"
FT                   /translation="MTTRQRLVAELQRLESADPSLAGMARRLEPLLELLDAVDAGAALD
FT                   VWVEFAGGHAVVADVASWFRGLVRDAAGPGLGFEGHAGELVLLLHHIQQVRREHPTGGV
FT                   RVLLATGESAWFRAVRPGHSGLSRPAGRPDPPPSGLPPAIPEEASPKIGRGDGVVDKDP
FT                   AR"
FT   gene            543386..545305
FT                   /locus_tag="Tmar_0462"
FT   CDS_pept        543386..545305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0462"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="COGs: COG0038 Chloride channel protein EriC;
FT                   InterPro IPR001807: IPR000644; KEGG: ddf:DEFDS_1948
FT                   chloride channel protein, CIC family; PFAM: Cl- channel
FT                   voltage-gated family protein; CBS domain containing
FT                   protein; SMART: CBS domain containing protein; SPTR:
FT                   Related to chloride channel protein; PFAM: CBS domain;
FT                   Voltage gated chloride channel"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50583"
FT                   /db_xref="GOA:E6SGN7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN7"
FT                   /protein_id="ADU50583.1"
FT                   /translation="MAGRAGPATRDTSKSPGGWRTRILDRLPGLSAGRPPAVVLAALVG
FT                   AAGGAFAVFFRELVDASQAFFFGWVRGVLAPLLGPYAVLWIPALGGLLVGPLVYFLARE
FT                   AKGHGVPEVMEAVALRGGRIRPRVILVKAIASAVTIGSGGSTGREGPIVQMGSAIGSVV
FT                   GQGLRLSERTVKTLVACGAAAGIAATFNAPIAGVIFAHEVILGEFAGATFTLIVIASVV
FT                   AAAVAHGLAGNQPAFLVPPYELRHPVEFLFYAVLGVLAGAAGVLFIRTLSWFEDRFDGW
FT                   KGVPPYAKAAVGGVLVGAVGLLVPEVLGVGHGTMDAILRSEGLPGGPPGVPAGARIAAW
FT                   AGRAPAGGDPGLAVLVLAGLFLFKLLATSLTLGSGGSGGIMSPSLFLGATLGAAVGTLA
FT                   HGALPSLTAMPGAYALVGMGAVLAATTQAPIQAILIVFEMTRDYRIILALMMACVVAVL
FT                   VSTALSADSVYTIKLRRRGIRLRAGRDVTVLQRIPVQEAMTAKPVVVRRDWPLARVIRV
FT                   MQSSRHNGFPVVDENGHLVGVITLADIRNTYPDEPERRLAVAVEQAMTPNPVVAYPDES
FT                   LAQVLERLGRYDVGRLPVVARGDPRQLLGVITRSDVIKAYNRRVLQQVPGTAGRGMASL
FT                   AGPA"
FT   sig_peptide     543386..543541
FT                   /locus_tag="Tmar_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            545354..546211
FT                   /locus_tag="Tmar_0463"
FT   CDS_pept        545354..546211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0463"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771: IPR011289; KEGG: chy:CHY_0128
FT                   fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II; PRIAM:
FT                   Fructose-bisphosphate aldolase; SPTR:
FT                   Fructose-1,6-bisphosphate aldolase, class II; TIGRFAM:
FT                   fructose-1,6-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: Fructose-bisphosphate
FT                   aldolase class-II; TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-1,6-bisphosphate aldolase, class II, various
FT                   bacterial and amitochondriate protist"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50584"
FT                   /db_xref="GOA:E6SGN8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN8"
FT                   /protein_id="ADU50584.1"
FT                   /translation="MPLVTGIELLEDARRRDYAVGAFNVNNMEIIQAIIAAAEEERSPV
FT                   ILQASQGAIKYAGIRYIRALVLAAAEEAKVPVCLHLDHGPSFEQVMECLRYGFTSVMFD
FT                   GSHLPYEENVRLTAKAVEAAHAVGVSVEGELGKIGGVEEEIRVEDWDVVLTDPEVVPDF
FT                   VERTGVDYLAVAIGTKHGFYKGEPKLDFERLARIHQLMPDLPLVLHGGSGIPEEHIRRA
FT                   IPLGVRKINIDTELRAAFVGKAREVMAAKPEEIDPRKILGPAREAMKEKVKEKMRLFGS
FT                   SGKA"
FT   gene            546423..547415
FT                   /locus_tag="Tmar_0464"
FT   CDS_pept        546423..547415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0464"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="COGs: COG1494 Fructose-1
FT                   6-bisphosphatase/sedoheptulose 1 7-bisphosphatase and
FT                   related protein; InterPro IPR004464; KEGG: chy:CHY_0787
FT                   fructose 1,6-bisphosphatase II; PFAM: GlpX family protein;
FT                   PRIAM: Fructose-bisphosphatase; SPTR:
FT                   Fructose-1,6-bisphosphatase, class II; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II; PFAM: Bacterial
FT                   fructose-1,6-bisphosphatase, glpX-encoded; TIGRFAM:
FT                   fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50585"
FT                   /db_xref="GOA:E6SGN9"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGN9"
FT                   /protein_id="ADU50585.1"
FT                   /translation="MERELTLELVRVTEAAALAAARWMGRGDKNAADGAAVDAMRAVFD
FT                   TVDIRGTVVIGEGEMDEAPMLYIGEQVGSGQGPEVDVAVDPLEGTNLVAKGLPGAIAVL
FT                   AVAPRGCLLHAPDMYMEKIAVGPAAAGTIDIERPIEENLQAVARALNKRVQDVTVILLD
FT                   RPRHADLVARIRRAGARIRMISDGDVSAAIATALEGTGIDLMVGIGGAPEGVLAAAALY
FT                   CLGGELQGRLWPEDDEDRERMRAMGIDEARVLRIEDLVRGEDVIFAATGITSGEMLKGV
FT                   QFTSRGAFTHSVAMRYRTGTVRFVEAWHRLERKPVIGPLVGGTGPGAAG"
FT   gene            547527..548066
FT                   /locus_tag="Tmar_0465"
FT   CDS_pept        547527..548066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0465"
FT                   /product="putative GAF sensor protein"
FT                   /note="COGs: COG1956 GAF domain-containing protein;
FT                   InterPro IPR003018; KEGG: tro:trd_1660 GAF domain protein;
FT                   PFAM: GAF domain protein; SMART: GAF domain protein; SPTR:
FT                   GAF domain protein; PFAM: GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50586"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP0"
FT                   /protein_id="ADU50586.1"
FT                   /translation="MADVHRDEPAAGAAALDDQRARTLAWLREEAARGRGFRELAQAVC
FT                   SHLYRAYPHYSWVGVYMIEGDRLKLWAWDGPQPTQHVEIPLNAGLCGWAASTGQLANVP
FT                   DVRKDPRYLQCFLSCQSEIVVPIARGGKVYGEIDIDSDRLAAFGAEEETFLQEACAILA
FT                   ERAAADAEVQAAGAGR"
FT   gene            548201..548719
FT                   /locus_tag="Tmar_0466"
FT   CDS_pept        548201..548719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0466"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="COGs: COG0693 Putative intracellular
FT                   protease/amidase; InterPro IPR006286: IPR002818; KEGG:
FT                   tte:TTE0986 putative intracellular protease/amidase; PFAM:
FT                   ThiJ/PfpI domain-containing protein; SPTR: Putative
FT                   intracellular protease/amidase; TIGRFAM: intracellular
FT                   protease, PfpI family; PFAM: DJ-1/PfpI family; TIGRFAM:
FT                   intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50587"
FT                   /db_xref="GOA:E6SGP1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP1"
FT                   /protein_id="ADU50587.1"
FT                   /translation="MAAKRIAILVDDLYEDLELWYPYYRLREAGHQVELIGSERERAYT
FT                   SKHHYPAKAVKSIAEVRSEDYDGVVIPGGYAPDKMRRDERMVRFVREIHDQGKLVAAIC
FT                   HAGWMLVSADILRGRKATSVRAIRDDMRNAGCQWVDEPVVVDGNLVTSRTPDDLPAYMK
FT                   AILAKLGEA"
FT   gene            549052..550212
FT                   /locus_tag="Tmar_0467"
FT   CDS_pept        549052..550212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0467"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="COGs: COG0725 ABC-type molybdate transport system
FT                   periplasmic component; InterPro IPR017975: IPR005950:
FT                   IPR006059; KEGG: gct:GC56T3_0789 molybdenum ABC
FT                   transporter, periplasmic molybdate-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein; TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; LysR substrate binding domain;
FT                   TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50588"
FT                   /db_xref="GOA:E6SGP2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP2"
FT                   /protein_id="ADU50588.1"
FT                   /translation="MQRESPRVMRGGTPDGVRAVARAMVPTVPRGVVGAALRGTSRGAA
FT                   LRATCRVAARALAAGLAALVLLSGCGGGPVRPEEPAGGAGGAGAGGAGAGPRAEPALAE
FT                   AGAGRGRGETVILVAAAASLQDALQDAAEAFRRVHPAIRVQFTFGSSGALAAQVEAGAP
FT                   VDLFVAAGRDPVDRLVRRGLADPGAVRVVAGNRLVLVVPAGRPMPGRSVTGRVGAGRPT
FT                   GGGTGSGAGTGPGAGSGQGAGSGAGMAPEAGLWMNLAGDGIRRIALGDPAHVPAGRYGR
FT                   QVLEHLGLWARVQPKLVLDQDVRQVLQHVAAGAADAGIVYATDAATAKGVAVVAEAPPG
FT                   SHEPIVYPLVVPRTAVHPEAARALADWLAGAEGQAIFARYGFLPPP"
FT   sig_peptide     549052..549156
FT                   /locus_tag="Tmar_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            550347..551042
FT                   /locus_tag="Tmar_0468"
FT   CDS_pept        550347..551042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0468"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG4149 ABC-type molybdate transport system
FT                   permease component; InterPro IPR000515: IPR011867; KEGG:
FT                   smt:Smal_2227 molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Molybdate ABC transporter,
FT                   inner membrane subunit; TIGRFAM: molybdate ABC transporter,
FT                   inner membrane subunit; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component; TIGRFAM:
FT                   molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50589"
FT                   /db_xref="GOA:E6SGP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP3"
FT                   /protein_id="ADU50589.1"
FT                   /translation="MVGDGWTDALRVSLGVVTAATVLVVAAGLPLAVALARPGWRGRGL
FT                   VEVLVTLPLALPPAVLGFYLLELLGWDGPLGWLARRLWGQTLIFTPAAAVLAAAVVGLP
FT                   LFVQPARAALEAVSAEVREAAAIDGAVGWRLVRHVILPAAWPGVATGILLAFARSLGEF
FT                   GATLMVAGNIPGRTQTLPLAIYSAVQAGREDVAGRLALLLTGVAALSLWAGSGWRRWGT
FT                   GSGQGGWVR"
FT   sig_peptide     550347..550454
FT                   /locus_tag="Tmar_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            551039..552433
FT                   /locus_tag="Tmar_0469"
FT   CDS_pept        551039..552433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0469"
FT                   /product="transcriptional regulator of molybdate
FT                   metabolism, XRE family"
FT                   /note="COGs: COG1910 Periplasmic molybdate-binding
FT                   protein/domain; InterPro IPR001387; KEGG: ava:Ava_4042
FT                   molybdate metabolism transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: Transcriptional Regulator of
FT                   molybdate metabolism, XRE family protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50590"
FT                   /db_xref="GOA:E6SGP4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP4"
FT                   /protein_id="ADU50590.1"
FT                   /translation="MSSPGPMEPRGEPARRPRGAAGDPSGSVVNGLRAARLRLGLSQQE
FT                   LAARAGVTRQAVSAIEGGQAAPSLGVALRLARALGCRVEDLFWLDDPEPEVEVELVGTG
FT                   AEDPEPQGAPASRPAGPGGSAWSGGPGHAGLDASGGRCLVARIGGRWVAHRLRGDAAFS
FT                   SDLIPAGARLVGPASDEPAGPAQPGRAPGEPPAAPPPALTRWRARLLESPEDLARGVLI
FT                   AGCAPELSLWARALATGHRGVHLHRIEANSHRAVQLLRAGTVHAAGVHLPGPAGEPDNL
FT                   PFLQDLLGDLDVVVVRLGVWEEGLVVAPGNPLGIRDVADLARPGVVVVNREPGAGSRLL
FT                   LERCLAEAGVPAGAVAGFDRHARSHLEVARAVARGTAHAGVSTAPVAAAFGLGFVPLRA
FT                   VAYDLVFPRTVLDEPAVQALLGTLGDAWVRRQLAALGGFDTAATGTVTARLSRAHGPRV
FT                   PAIGSL"
FT   gene            552430..553713
FT                   /locus_tag="Tmar_0470"
FT   CDS_pept        552430..553713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0470"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: gct:GC56T3_2283 sporulation protein,
FT                   polysaccharide deacetylase family; PFAM: polysaccharide
FT                   deacetylase; SPTR: Polysaccharide deacetylase; PFAM:
FT                   Polysaccharide deacetylase; TIGRFAM: probable sporulation
FT                   protein, polysaccharide deacetylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50591"
FT                   /db_xref="GOA:E6SGP5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP5"
FT                   /protein_id="ADU50591.1"
FT                   /translation="MSGRDGWTAGVDPARAGDGAGPGTRKGAPGRACGGGRPAGRGPAR
FT                   GAWSMAGTGSARYRWRRAGAWLLLVAAAVALGRAGWSPARLLPWTGRADGLPARVAPGV
FT                   WVGPVPAGGWPRDRVQVWLEALARQTGMPPEDARFDPANRAVIPGVAGLELDVPASLEA
FT                   ILRAPRDSRVALRFRAVPPRQDLDDFPGHPVYHGNRRKQAVTFLVNVAWGEEFLPAMFA
FT                   ALEKGGARVTFFPTGRWAQGHPDLVAEMARRGHELGSHGFSDTLDLERQPAAGVLADLR
FT                   RGVEAVARAAGLDPAAVRFYSTHRGVRTAAVEQAAAEAGVRLIYWSLDTVDWTKPAPAA
FT                   MARRIVTGARPGDLILMHPTAVTVEALPAMIRGLRQRGLAIVPLGQLLSPLPGDDGQPA
FT                   FRPLGPAGPVLAATRGALGAVLAPAGHP"
FT   gene            554006..555052
FT                   /locus_tag="Tmar_0471"
FT   CDS_pept        554006..555052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0471"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593; KEGG:
FT                   ate:Athe_2366 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50592"
FT                   /db_xref="GOA:E6SGP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP6"
FT                   /protein_id="ADU50592.1"
FT                   /translation="MIEVSHVSKRFGEHRAVTDLTFTVQRGEIVGLLGPNGAGKTTTMR
FT                   LITGYMPPSAGTIRVAGFDTWEEPLEVKRRVGYLPENPPVYPDMTVASYLLFVAALKGV
FT                   PRHRRRAEAQEAAERTGVAHVWTRLIGNLSRGYRQRVGLAQALVGKPDVLILDEPTVGL
FT                   DPAQIVEIRQLIRSLAGEHTVILSSHILPEVRQTCQRVLIMNHGRLVAQDTPEGLTRAL
FT                   AGGTTLRLAVKGPAQEVARRLRELDGVEAVRFLDGDEPAGTGAAGGGDESVVRLELTSR
FT                   SKDLREAVFFAMAAERWPILEMRPLEMSLEEIFMQLVTEEQAPAGSSSRAGAGAGGGDR
FT                   RRAAGARR"
FT   gene            555058..555777
FT                   /locus_tag="Tmar_0472"
FT   CDS_pept        555058..555777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0472"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: hor:Hore_13000 ABC-2 type transporter; SPTR:
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50593"
FT                   /db_xref="GOA:E6SGP7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP7"
FT                   /protein_id="ADU50593.1"
FT                   /translation="MGWHGLLALWRKDVLSFWLSPLWWVVAAVFLALTGWYYLAVVASF
FT                   QAPDLRFLLDHMVVLLLFVVPALTMRLWAEEQQRGTAELLLTAPVTLNQAVLAKFLAVL
FT                   TLLTVLLLVTGIYPAVTAAYGAVEWPTLLVGYLGVWLVAAVFAAAGLLASTLSDSQVIA
FT                   AVAGFGILLALYMLDWAAGSVGGTAGDVLRAASVWENLSDFINGVLDTRRLVYFASLIF
FT                   GFLFLAVRNVERRTWAA"
FT   sig_peptide     555058..555141
FT                   /locus_tag="Tmar_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            555967..557478
FT                   /locus_tag="Tmar_0473"
FT   CDS_pept        555967..557478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0473"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="COGs: COG3225 ABC-type uncharacterized transport
FT                   system involved in gliding motility auxiliary component;
FT                   InterPro IPR019196; KEGG: hor:Hore_12990 hypothetical
FT                   protein; PFAM: ABC-type uncharacterised transport system;
FT                   SPTR: Putative uncharacterized protein; PFAM: ABC-type
FT                   uncharacterized transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50594"
FT                   /db_xref="GOA:E6SGP8"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP8"
FT                   /protein_id="ADU50594.1"
FT                   /translation="MADRADAHRRRVLWRGTNTAVLTVAVLALLVLANVFAGRYSWRYD
FT                   ATQQKIYSLSPSTYEVLAGLKQDATLYGFLQSGSTEGETLRKIMEQYDRASDRIRLQVI
FT                   DPEREPSVARRYEVDTYNTVVVEVGDDYRKIDPLSLFGYGAGGGIEIRAEQAITRALLE
FT                   LTGRGGKKVYFLTGHGEGNPDTQLTTLGRLLEGEALAVETLNLAQAGRVPGDAAVVAIA
FT                   GPTRDLLPEERQRLEEYVRQGGRLLVLYGPVPGGQRLQQLEQLLASVGVEAAADVVVDP
FT                   QRAFLGQDPLSPVPELGTHAIVEPLQRGDLVLVLPGARSVQPRQGAQLTTTELLHTSDA
FT                   AWGETNLQSRAVQRDDRDRPGPLTLALAVEGQPGAAGQDQAKADDRGQGKSQGEGANQD
FT                   QAGGAPEESAAAGPRPVAVVVGSAAFVANDYLDRVPGNRDFVVNAVNWLVGSEQRLTIR
FT                   PKELAATPIVLTPRAVVGIFYGLVLGFPALVALTGLAIWWRRRHA"
FT   sig_peptide     555967..556077
FT                   /locus_tag="Tmar_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            557475..558713
FT                   /locus_tag="Tmar_0474"
FT   CDS_pept        557475..558713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hor:Hore_12980 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50595"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGP9"
FT                   /protein_id="ADU50595.1"
FT                   /translation="MSAGRRRGRNPVRQAFLGLFLLVVAAGLAVYAWATRGQQPAGEGD
FT                   AAGGSTVVWDAGDATVREVLVEGKHGRILLRPGPPPELVVSPDAPFGGQGPMAADTIEG
FT                   LLSSRRWWIHDPGPYPVAEEYATTIADGLRKLTAQRLVAEGVAERDLAQYGLDRPATRV
FT                   TVRFTGQDGAKVLELGAQSPLTGGGTYARVAGEDKVYLLAPGLADTLTMAPDQLRETMF
FT                   VPFNADRVQRVELQWGDDRLVFVRQEGGTNWSMEHNGRRVGTQDGSQLSELWFALHQWR
FT                   AAAFVTDQGDDPAVRKRHGLDEPYGRIRLEFQPAPGQKSGPYLEIRAGATAAEGGRYVA
FT                   TSEGPWVYRLDPDDLSYFEDQVLPGLKKPATDAKPNGGQGSDQGSGQNAQPSRSQGGEG
FT                   GEGGSGGGQGGGS"
FT   sig_peptide     557475..557570
FT                   /locus_tag="Tmar_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            559110..559712
FT                   /locus_tag="Tmar_0475"
FT   CDS_pept        559110..559712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0475"
FT                   /product="regulatory protein TetR"
FT                   /note="InterPro IPR001647; KEGG: bts:Btus_0118
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; SPTR: Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50596"
FT                   /db_xref="GOA:E6SGQ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGQ0"
FT                   /protein_id="ADU50596.1"
FT                   /translation="MAGREQEILDAARKLFRQKGYYATTMQDIAEAVGLQKASLYHYIR
FT                   SKEALLLQVAGETMRLFHAELDRIEAAGGSYAEQLAAAIRAHVRVVAEHQETLTVLFRE
FT                   SHALPPEHAEKVRGETRRYTRRLTDLIARGVAAGEFRPVDPGAACLAILGACNWMYRWY
FT                   SAEGRLSPQEIADQFVQVILHGLVLPRGGPAGTPAGV"
FT   gene            559896..560702
FT                   /locus_tag="Tmar_0476"
FT   CDS_pept        559896..560702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0476"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="COGs: COG2086 Electron transfer flavoprotein beta
FT                   subunit; InterPro IPR012255: IPR014730; KEGG:
FT                   svi:Svir_28260 electron transfer flavoprotein, beta
FT                   subunit; PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; SPTR: Protein fixA; electron transfer
FT                   flavoprotein beta-subunit (Beta-ETF); PFAM: Electron
FT                   transfer flavoprotein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50597"
FT                   /db_xref="GOA:E6SGQ1"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGQ1"
FT                   /protein_id="ADU50597.1"
FT                   /translation="MGWNVVVLLKPILDPELPARKFRVAADGRRPERGDAPVVINPFDQ
FT                   NALELALQLKDKGAADTVTVISAGGPEATDGLRKALALKADRAVRVDLDGLDLPDPTVT
FT                   ARVLAAAVRKVGGADLVLAGRQAGDWDQGQVGYLLAEELGWPCAALVQQLEPAGDGLRL
FT                   VREAPAGREVLEAQVPLVITVTNDDSNVLRLPKVRDVMMANRKPIDQWTVADLGLDAAA
FT                   LAGEAASEVLALRIPERKTECEMIQGDDPAAVAATLVQRLRELKVL"
FT   gene            560730..561686
FT                   /locus_tag="Tmar_0477"
FT   CDS_pept        560730..561686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0477"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="COGs: COG2025 Electron transfer flavoprotein alpha
FT                   subunit; InterPro IPR001308: IPR014730: IPR014731; KEGG:
FT                   bts:Btus_0429 electron transfer flavoprotein
FT                   alpha/beta-subunit; PFAM: Electron transfer flavoprotein
FT                   alpha subunit ; Electron transfer flavoprotein
FT                   alpha/beta-subunit; SPTR: Electron transfer flavoprotein
FT                   alpha subunit; PFAM: Electron transfer flavoprotein domain;
FT                   Electron transfer flavoprotein FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50598"
FT                   /db_xref="GOA:E6SGW7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGW7"
FT                   /protein_id="ADU50598.1"
FT                   /translation="MILVVQWNGKGLTQGTAELLGGARQLAGDGPVAVAVLGPGAREAA
FT                   AEAGAYGAEAYAAEGDLESYGGEAYVATLAAACQTLQPQVVLMPADPRGREVAPRLAAR
FT                   LGGAAVTDVIEARRDGDRIVWSRPVFGGKAVADVVLQRAPQVATVRPGSFPAAEKAGSS
FT                   PAEVRELAVSGTDRPLRRVEVRAEAQGGVRLEEARIVVSGGRGLGGPEPFKDLEELARL
FT                   LGGAVGASLAAVDEGWAPPERQVGQTGKIIAPDLYIAIGISGASQHLAGIAGAKTVVAI
FT                   NKDPEAPIFEVARLGVPMEYQKVLPHLIEEVRKLKAG"
FT   gene            561956..564091
FT                   /locus_tag="Tmar_0478"
FT   CDS_pept        561956..564091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0478"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR017896: IPR017900: IPR004017; KEGG: sth:STH623 putative
FT                   iron-sulfur cluster-binding protein; PFAM: protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; SPTR: Putative iron-sulfur cluster-binding
FT                   protein; PFAM: Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50599"
FT                   /db_xref="GOA:E6SGW8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGW8"
FT                   /protein_id="ADU50599.1"
FT                   /translation="MPEAMPAVAEATREVQWNVPDAFVWIMYISMVVALAVMAYGVWQR
FT                   VRIWMAGKPEVRWDRPGQRLRRVLVHALGQGRLLKQRLPGIAHALLFYAFIVLFVGTLV
FT                   VMIHHDLGIPILRGRFYLYFHSLALDVFGALATVGLAVFFWRRYGLRPGQLEKGKRADF
FT                   LLLLGLLVIMVTGFVLEGIRLVVTGDPWAFWSPFGYLTGLALAAVLPAEGALRAVHAGT
FT                   WLLHMLTWHAWLAALPYSKAFHLVTGPLNIFFSNLDAKGEPKPMDLEDETASLGARTVL
FT                   DFTWKQLLDLDACTECGRCEAACPAFAEGKPLSPKRVILDLRDHVRAHRDDLLRAKAAQ
FT                   LAGDQETYESIVEHLPILAGGVIKEETLWACTTCRACEEACPVFIEHVPTILDMRRYLA
FT                   MEKAEMPETLASAMESLETRQHPYRGASADRTDWYKDLPVKTMAELDDPEEIEYLYWVG
FT                   CAGAFDERVQKVARAVARVMDRAGIKFAVLGPEEQCTGDPARRSGNEYHYAMLAQANVE
FT                   TLNGYKVKRIVTHCPHCLQQLKHEYKRFGGHYEVIHHSELVFKLMEEGKLELARELHRS
FT                   LQVTYHDPCYLGRYNDVYDAPRQVLDGLGTRRVEMARSRERSFCCGAGGAHMWYEDKSG
FT                   GKINRNRAEEAVRTGADVVVTGCPFCLAMMETGIKGVAGAEERGVRVRDFVELVEEALA
FT                   DPAGAVAGGEAGGAAGT"
FT   sig_peptide     561956..562057
FT                   /locus_tag="Tmar_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            564249..566117
FT                   /locus_tag="Tmar_0479"
FT   CDS_pept        564249..566117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0479"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020845:
FT                   IPR000873; KEGG: gka:GK2690 long chain acyl-CoA synthetase;
FT                   PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   Long-chain-fatty-acid--CoA ligase (Long-chain acyl-CoA
FT                   synthetase); PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50600"
FT                   /db_xref="GOA:E6SGW9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGW9"
FT                   /protein_id="ADU50600.1"
FT                   /translation="MADSLVGKDGPAVVGDFPWLRFYPAGVRHHLDYPDMPLYGLLDRA
FT                   ARERPEHPAIIFFNRTITYAQLNHAADRFARALVQRGVKPGDRVALMLPNCPQFVIAYY
FT                   GTLKAGGVVVNHNPLYTAPELEFQLNDAGCRVLVALDMTYPTVQKVRPRTRLETVILTR
FT                   INEYMPALLRLLYPLKARRDGTWPEIRDGHDVLWFQDLLAGAGRDGAGSGDGGAAPGGG
FT                   GPGAARIPVPAGPDDVALLQYTGGTTGRPKAAMLTHRNLLANALQTAEWVLQGKVDDGP
FT                   RHRIMGVIPFFHVYGMTTVMNLAIAIQGTMILQPRFNAEEVLKGVARYKPTMFPGVPTM
FT                   YVAILNHPKLRQYDFSSIESCVSGAAPLPLEVQERFERLTGGALVEGYGLTEASPVTHV
FT                   NPTGEGKRNGTIGIPLPDTEARIVDIETGTRVLGPGEVGELVVRGPQVMKGYWNRPEET
FT                   ERTLRDGWLYTGDIATMDEDGFFRIVDRKKEMIISGGYNVYPREVEEVLYQHPKVLEAA
FT                   VVGVPDPYRGEMVKAHVVLKPGETATEQEIIEFCRQRLAKYKVPRAVEFRAELPKSLIG
FT                   KVLRRVLAEEERRRAAEAPAEGPAAATAAPGAPGADADGDESGRDG"
FT   gene            566326..567111
FT                   /locus_tag="Tmar_0480"
FT   CDS_pept        566326..567111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0480"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: rmr:Rmar_1965 thioesterase superfamily
FT                   protein; PFAM: thioesterase superfamily protein; SPTR:
FT                   Thioesterase superfamily protein; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50601"
FT                   /db_xref="GOA:E6SGX0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX0"
FT                   /protein_id="ADU50601.1"
FT                   /translation="MLSWAARAIGEGPAGVRPLPRSGVRPMDDRQPQGMEGEGSGEGPV
FT                   AGAEPPGGRELPVPPARPARESRVEMTELVLPNDANPLGNILGGKVMHLMDIAGALAAA
FT                   RHSRRVCVTASVDRIDFLHPIRVGEAILVEAQVTDAGRTSMEVRVNVYSENLRTGQRRH
FT                   TATAFFTFVALDEHGRPTPVPAVIAETPDEQRLQIEARRRRQARLARAGRVGTAEPEAG
FT                   PPAGGDPSDPAASVGAPDPPSGGGTFDPPAGGDTPGPQA"
FT   gene            567360..568502
FT                   /locus_tag="Tmar_0481"
FT   CDS_pept        567360..568502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0481"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG3375 conserved hypothetical protein;
FT                   InterPro IPR000182; KEGG: rca:Rcas_2439 hypothetical
FT                   protein; PFAM: GCN5-related N-acetyltransferase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50602"
FT                   /db_xref="GOA:E6SGX1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038764"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX1"
FT                   /protein_id="ADU50602.1"
FT                   /translation="MDDVVIRPLESHDELARAEALEQVVWGGPPIVPAATMRAVLEVGG
FT                   CVLGAWLGDELVGFCFGFPGWRRRQPVPPGLDEPAGPAAAAGFGPADVPATGAVAPPGP
FT                   LAGPSAPPPPDVLAGPQVPPPPVPGPAGEREPVFHSDLLAVRPEVRDRGIGRRLKLAQR
FT                   EWALAQGLHLITWTYDPLQARNGYLNLTRLGGIARRYVREFYGVLDDELNRGLPADRLV
FT                   IEWYLRSRRVVRRAAEGATPGTATGRPGTGAWAAAPAAGELAAGHGPAPVSGGVPVLNQ
FT                   VRDAGGIPEPAGWRPPRGEPVVGVRIPARFADWRQDRPEWGLAWRFHVREVLEACLAAG
FT                   YLLDRCVPEGAGTAAGAAGGGGAGWSGSTVLYILARQAGE"
FT   gene            568641..569981
FT                   /locus_tag="Tmar_0482"
FT   CDS_pept        568641..569981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0482"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR010197: IPR013341: IPR013342; KEGG:
FT                   gtn:GTNG_0815 N-acylamino acid racemase; PFAM: Mandelate
FT                   racemase/muconate lactonizing protein; SPTR: Mandelate
FT                   racemase/muconate lactonizing protein; TIGRFAM:
FT                   o-succinylbenzoic acid (OSB) synthetase; PFAM: Mandelate
FT                   racemase / muconate lactonizing enzyme, C-terminal domain;
FT                   Mandelate racemase / muconate lactonizing enzyme,
FT                   N-terminal domain; TIGRFAM: o-succinylbenzoic acid (OSB)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50603"
FT                   /db_xref="GOA:E6SGX2"
FT                   /db_xref="InterPro:IPR010197"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX2"
FT                   /protein_id="ADU50603.1"
FT                   /translation="MAAPNESMPPQGPVPPGDRRSPEDPAGSAGPVPPAEPGTVRGAAP
FT                   AGTPTLEPRPIPPMPVEPAAEPVPLTITGVQLFWLRMPLVAPFETSYGRVDRRECLLVR
FT                   LEARHPEAGPVEGWGEVVADADPGYSYETTGTAWHVLSEFVLPALPGRTFETPGQWRAA
FT                   FEWVRGHPMAKAGVEMALLDARSRARGVPLWQEYGGDPGRRRIPVGVSVGIQPTLDDLL
FT                   ATVERWLERGYRRIKIKIKPGYEVEPVRALRERFGDIPLMVDANAAYTLADAERLEALD
FT                   GYGLMMIEQPLHEDDLLDHALLQRRLRTPVCLDESVRHVHAAREALVLGSGRIINIKQG
FT                   RVGGPTDARMIHDLCRRHGIPVWCGGMLETGVGRAHNIALTTLPGFTLPGDTSGSNRYY
FT                   HEDVIDPPVRVGPDGTIEVPQEPGLGFRVVPERVERYTVRHRSWRAS"
FT   gene            complement(570197..570733)
FT                   /locus_tag="Tmar_0483"
FT   CDS_pept        complement(570197..570733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0483"
FT                   /product="thioesterase superfamily protein"
FT                   /note="InterPro IPR003016: IPR006683; KEGG: gka:GK1363
FT                   hypothetical protein; PFAM: thioesterase superfamily
FT                   protein; SPTR: Hypothetical conserved protein; PFAM:
FT                   Thioesterase superfamily; TIGRFAM: uncharacterized domain
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50604"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX3"
FT                   /protein_id="ADU50604.1"
FT                   /translation="MAKEGTAGVAQGDHGIAVQDRYPDDFAWCYGCGRLNPAGLHLKTY
FT                   RDGEETVTAFRPRPEHTAIPGFVYGGLIASLIDCHGTATASLALYHRDGHRLGDPEPVP
FT                   RCVTASLQVDYRRPTPLGPELVVRGRAVEVGARKVVVESELYAGGTLCARGRMVAVLAP
FT                   PSMTPGAPPAPAPGT"
FT   gene            571311..572600
FT                   /locus_tag="Tmar_0484"
FT   CDS_pept        571311..572600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0484"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; KEGG: eba:p2A128
FT                   ABC transporter substrate-binding protein; SPTR: NLPA
FT                   lipoprotein; PFAM: NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50605"
FT                   /db_xref="GOA:E6SGX4"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX4"
FT                   /protein_id="ADU50605.1"
FT                   /translation="MEGTSNLAGGGAAAPAPGRGGPGTAPPVEGGARRAVRGHRRRGRV
FT                   LPGLAAVLAVALLVAACGTAGSSGGGGPAGTPAGAADGGGAGGGSGTGATGDCSQRPGL
FT                   AGVPPLPREVTVKIAEDGAPSGAGFYIATEKGYFRDLCIKPEFVSFESSAYMLPALAAD
FT                   QVQVAGGVLSVGLWNAIESGLELRIIATKGENVPGRSYFNLTVAADQADAIKDYADLKG
FT                   KRIAITAEASLDEQFVDLALQHAGLTRGDVQYVIIRSFGDMNAALANGAVDVAMHIEPL
FT                   ITQAEEQGILKRFGDAGRDYAPGFQIAEVLASPQFVADKELSQRFMLAYVKALRDYNDA
FT                   FIRRDEAKMADIIPIMTKYTALKDPALWKKVYVPGLNPDGRLNVESLKAQLEWYRARGY
FT                   FTGQIDLDQVIDLSLVDYAVQVLGPYDAGR"
FT   gene            572732..573802
FT                   /locus_tag="Tmar_0485"
FT   CDS_pept        572732..573802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0485"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: reu:Reut_B5801 binding-protein dependent transport
FT                   system inner membrane protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50606"
FT                   /db_xref="GOA:E6SGX5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX5"
FT                   /protein_id="ADU50606.1"
FT                   /translation="MNRWQHGNGGRGRRRGPGRLAPVLDGQAGGAPDGRAQDGRMPDSR
FT                   RDGRASDGGLRDGRPHDGRPHDGRAHDGRPQADPPVTVLADEPGPRGRGTGAGLTWRRR
FT                   RPVLGRERWLSILSPIAMLLIWEILVRLGWLDARFFPPPSRVAVRFADMVADGTLFHHL
FT                   GISLMRVILGFAAGAVPAVAIGLTMGLFPWVRAVLEPVVAALYPIPKIALLPLLLMIFG
FT                   VGETFKVVTIALGCFTLVLVNTVAGVVNIERIYVDVARNFGASRLDFYRTVAWPGALPM
FT                   IFAGLKLGMGVSLLLIVAAEMIGARSGLGYLIWNSYQVWDMAAMYIGLVLMSFFGYVFT
FT                   MALNELERVVLPWRPR"
FT   gene            574043..574855
FT                   /locus_tag="Tmar_0486"
FT   CDS_pept        574043..574855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0486"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="3.6.3.25"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR001827: IPR017871: IPR003593; KEGG: eba:p2A125 ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50607"
FT                   /db_xref="GOA:E6SGX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX6"
FT                   /protein_id="ADU50607.1"
FT                   /translation="MSVPWKIRIRGLRKEFVAGRRVIAALDGIDLEVAEGEFVCLVGPS
FT                   GCGKTTLLRILAGLEKPTAGTIEVAGSDPARPLQAMVFQEQSVFPWMTVRRNIGYGLAL
FT                   RRVPRAERERIVDHYLDLVGLTPFADAYPHQLSGGMKQRVSVARAFAVDPEILLMDEPF
FT                   AALDEQNKLLLAEELLRLWEANRKTVLYVTHSIDEAIHLADRIVVFTASPGRIKAEVPV
FT                   AIPRHRDLDTLRGHPAYAAAYQRVWQALRDEVLAARRHEERERVAGRR"
FT   gene            575164..576240
FT                   /locus_tag="Tmar_0487"
FT   CDS_pept        575164..576240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0487"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: sth:STH2964 cation efflux system protein;
FT                   PFAM: cation efflux protein; SPTR: Cation efflux system
FT                   protein; TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: Cation efflux family; TIGRFAM: cation
FT                   diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50608"
FT                   /db_xref="GOA:E6SGX7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX7"
FT                   /protein_id="ADU50608.1"
FT                   /translation="MAGGERNRAGGIGDDTAASLRGAWLSAGAYLLLSAVKIAVGWRAG
FT                   SRGVLADGLNNLTDVLASAAVLWGIRAAARPADAEHRYGHGRAETVAQLVVGTVMGLVG
FT                   LNVGVAALQAALAPQLEPPEPYAAAVALAAAAVMTAVYLYNRALARRTGSPALRAAARD
FT                   HRSDALVSLGTVVGIWGARRGWPWLDPVAGLVVGLLVVRTAWRLLAEATHELLDGFEPE
FT                   RLHRLSGRVAAVEGVQDVREVRGRRLGKVAAIDVTITVDPDLTVEESHAVADRVEQALR
FT                   RDPDIQHVHVHVEPHPAGRPGSTVPPGGPPAASAAGRRDGPAVARRDGAMAGPSHADEP
FT                   DEPGRSRNPGPGETPAPM"
FT   gene            complement(576293..576493)
FT                   /locus_tag="Tmar_0488"
FT   CDS_pept        complement(576293..576493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0488"
FT                   /product="YHS domain-containing protein"
FT                   /note="InterPro IPR011017: IPR007029; KEGG: mem:Memar_1872
FT                   YHS domain-containing protein; PFAM: YHS domain-containing
FT                   protein; SMART: TRASH domain-containing protein; SPTR: YHS
FT                   domain protein; PFAM: YHS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50609"
FT                   /db_xref="GOA:E6SGX8"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX8"
FT                   /protein_id="ADU50609.1"
FT                   /translation="MAVDPVCGMTIDESTAEEMGVETVVYRGTTYYFCCPYCRKQFERD
FT                   PEKYLQAPGAHHDETHGAGPA"
FT   gene            576637..578694
FT                   /locus_tag="Tmar_0489"
FT   CDS_pept        576637..578694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0489"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="COGs: COG2265 SAM-dependent methyltransferase
FT                   related to tRNA (uracil-5-)-methyltransferase; InterPro
FT                   IPR002792: IPR010280: IPR001566; KEGG: sth:STH2818 RNA
FT                   methyltransferase; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; (Uracil-5)-methyltransferase; SPTR: RNA
FT                   methyltransferase, TrmA family; TIGRFAM: RNA
FT                   methyltransferase, TrmA family; PFAM: tRNA
FT                   (Uracil-5-)-methyltransferase; TIGRFAM: 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50610"
FT                   /db_xref="GOA:E6SGX9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGX9"
FT                   /protein_id="ADU50610.1"
FT                   /translation="MSRERRGARPPTNRPRSATGRERRHRHRPGAGDRDGAAAGGTPGA
FT                   GRPLRPGQVIELEPHALAAGGDAVARYGGMAVFVPWAVPGDRLRVRVVDVKPRFARAEP
FT                   EALLVPGPGRVDPACPLFARCGGCRLQHLAYPQQLAWKRQMVVDALERIGRIPDPPVGE
FT                   TLGMDPPWYYRNKAAIPVRRLPSGRVVMGFFAPGTHAVIDLEATGCAIQHPVINQVVAA
FT                   LRRWLEEDPDGRATSTYDETRHQGLLRHLVVRVGLRSGEALAGLVVNGEGLPGEERLAR
FT                   YLRREVPQLVGVVKNLHRRPGNAILGPETVPLDGRPWIFDELGGLRFRISLESFYQVNP
FT                   VQAERLYRLALDYALGRPITAEAPKGPGPGSLADEPAGRRALATGEAASVTPGGAMATR
FT                   AAPAAGGSGLPTGDATAGGGAGFWLVDAYAGIGTLALLAAARLRDGVVAQDRRSWRVTA
FT                   IEVVPEATEDARTNAALNGLENVEFVTGAVEEVLPHLAAALQEAAGTGPGRGGPDVVLL
FT                   DPPRKGCDPAALAACLELAPPRIVYVSCNPVTLARDLAVLCDTGSPAAPPLPALPRPAA
FT                   AAGAAGAGGEAAMVEGVPAGGATAPGAAAGGGTAGDAQGGVRPRRRPRYRVVAVRPVDM
FT                   FPQTAHVECVALLERDDGGGPAPGAGTTGPAGTATATAGAITAGTGAGDR"
FT   gene            578785..579690
FT                   /locus_tag="Tmar_0490"
FT   CDS_pept        578785..579690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0490"
FT                   /product="Chlorite dismutase"
FT                   /note="COGs: COG3253 conserved hypothetical protein;
FT                   InterPro IPR010644; KEGG: gwc:GWCH70_3365 putative heme
FT                   peroxidase; PFAM: Chlorite dismutase; SPTR: Chlorite
FT                   dismutase; PFAM: Chlorite dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50611"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY0"
FT                   /protein_id="ADU50611.1"
FT                   /translation="METRGNQHTHPAPAATTAGPGGHPGARSGAGGGPEGAGPEAAGGP
FT                   QNPPPFTLEGWFILHDFRRIDWRRWKALDPARRAAIAREAADFLRQVAEARDTGEGASA
FT                   LYRVVGHKADLLWLHFRPALADLSDLEAALSRTALGDYLEPAYSYVSVTELSFYRSGPG
FT                   GPGRDLSGDPFVKARLYPEIPAARHVCFYPMNKKRAGADNWYMLPFEERGRLMHSHGLI
FT                   GRKYAGRVTQIISGSVGLDDWEWGVTLFADDPVDFKRVVYEMRFDEASARYGEFGPFYV
FT                   GVRTGPDDLVAFLCREAAGR"
FT   gene            579873..581699
FT                   /locus_tag="Tmar_0491"
FT   CDS_pept        579873..581699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0491"
FT                   /product="Amidase"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR020556: IPR000120; KEGG: sti:Sthe_2520 amidase; PFAM:
FT                   Amidase; SPTR: Putative amidase; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50612"
FT                   /db_xref="GOA:E6SGY1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY1"
FT                   /protein_id="ADU50612.1"
FT                   /translation="MEELVRAMAAQLLRREAADDGVIREAAARLEGIVNRLRAFAEEVM
FT                   GDQLPAFAFDPGHPAYRAAPSLPVENLQQLGATGGTGYGAALPARPAEAARGPRPASRE
FT                   VKAATWAAPGRRAMARGPLAGLTAGELVEAFHAGRLGVEEVTRAVLEQIEALEPHLNAF
FT                   VTVMAERALATARRRDEELVRWRRNGGGGGTSAAAGLGPLFGVPVALKDLIDVAGVPTT
FT                   AGSRVRAGHVADRTATVVRRLEEAGAVIVGKTATHEFAFGATTDTPFHGPVHNPWNLDH
FT                   SAGGSSGGSGAVVGAGLLPVALGTDTGGSIRIPAAACGTVGLKPTYGRVSRHGTVPLSW
FT                   SLDHTGPLAASVADAARVLEVLAGPDPLDPAAVPVPAQGLLEAAAAGAAGDLRGLRVGV
FT                   LADWARDRVHPEVEQAFRDALRQLEALGAELVEIGGPGGDGPAFPAAGVLTLVNRVLAL
FT                   AEGGAYHAATLARQAGDYSHEVRIRFELGQFLLARDYLLAQRLRAELARQATAVMEHCH
FT                   VLVAPTLPIPAPRLGQPVWEPAGADPEPVPEAMIRLTAPFNVTGQPALSVPVAVGASGL
FT                   PIGVQIVGRVFDEATVLRVGAALEQVRGPLRR"
FT   gene            582073..583764
FT                   /locus_tag="Tmar_0492"
FT   CDS_pept        582073..583764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0492"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="COGs: COG1524 Uncharacterized protein of the AP
FT                   superfamily; InterPro IPR010916: IPR002591; KEGG:
FT                   gwc:GWCH70_2615 type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; SPTR: Type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; PFAM: Type I phosphodiesterase /
FT                   nucleotide pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50613"
FT                   /db_xref="GOA:E6SGY2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY2"
FT                   /protein_id="ADU50613.1"
FT                   /translation="MKAASAVEVTAARVWNLLNEGKSFYPLFNLGLLAVLVVSDPAWRR
FT                   GALAGGGVGLAVALAASLPLVLAYVRWDFPLHLRWFLWPPFLAFGLLFGWPSPAALGLS
FT                   AGLYLFFTVIVWGTIYYHLRTGTTLWNFLRFWKLVLKNADSTSGNAQEQLPKSFLTLAV
FT                   WQHLLVAAAPQGAGAAAAGPGALAATGPGVAAAGSIAAGGTVLPTAATAGPGLPGDVGS
FT                   AALPVFLFTLGTALYAAAVHRIGFNWRPAEYPDYAAAPAPLPRPSRRVVVIVIDGCRKD
FT                   KLERAETPFLDWLAARGTRFDRMETVYPARTVVCFSSMFTGTYPREHGITSNLVLRLGV
FT                   RVESVFDVLRRHGRQGVLLGIAHLIDAFGDDVRAITSVQHGDVVDGNIMAAARQILEQD
FT                   DPDLLIVQLIATDQTGHARGVHDPQYLQRIREADAHIEAFFAWMHRHGYTRDTTFLICA
FT                   DHGQGDGIGGHGHLGEGERWVPFFLVGRNVARGRRVDRPHSIVSVAGTLMHLLGLPLPG
FT                   RARGPVLEEALEPGAPDLAADLEGYFAGPTPARAASPVLAERGVSR"
FT   gene            583761..584879
FT                   /locus_tag="Tmar_0493"
FT   CDS_pept        583761..584879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0493"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: gka:GK2679
FT                   dolichyl-phosphate mannose synthase; PFAM: glycosyl
FT                   transferase family 2; SPTR: Glycosyl transferase family 2;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50614"
FT                   /db_xref="GOA:E6SGY3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY3"
FT                   /protein_id="ADU50614.1"
FT                   /translation="MRRVAAVPLPGGKAARAAGMAPWPARPAVRAGGPASPAAGPAPPP
FT                   AGSSRPLVVVFLPAYNEAEAIGDVLRRIPRPAWPGWRTLVMVLDDGSTDGTGDVARAAG
FT                   ADLVVRHPRNRGLGYTVRQALRLAYRLGADAAVMIDADGEYPPETIPHVLAPIVEGRAD
FT                   YVLGSRFRGRIRGMRWYRRLGNYAFTLLQAVILRRWLSDGQTGLRAFSRPALRDGRIVH
FT                   DYNYAQVLNLSLLRQGYRLAEVPIAYRVRETGESFIRFRDYVRRVLPAIWRELTLPVER
FT                   RGAVGPRGAAAASRSGRTRPPGVPAGETPRRQGVPVSATGPGGPGPGTGARGAPARVPR
FT                   DGAPAGRASDHAAEGRPRSGAPGDRARGGSPG"
FT   sig_peptide     583761..583841
FT                   /locus_tag="Tmar_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            584947..585681
FT                   /locus_tag="Tmar_0494"
FT   CDS_pept        584947..585681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_4852 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50615"
FT                   /db_xref="GOA:E6SGY4"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY4"
FT                   /protein_id="ADU50615.1"
FT                   /translation="MVGGSKNTAHPPGPVDPARHQPSNGPFSRSRLSRSSRSSRGSRRG
FT                   DRRFCRSRRAVVLAVLVLAALALTACGQGEDRPGTVSVDPESGTVSGSGTGTGTGTGTG
FT                   SASGTHAGAEAGRVEPKPAGATQVNVTLKEWAIEVEPAQVKAGRVYFLVTNAGPERPHE
FT                   LVIVRSDAEPEQLPVADGRVREDQVEMVGEVEAFAAGTRASGLFDLEPGRYLLICNIVE
FT                   GEGDQATSHFAEGMVAELTVTP"
FT   gene            585786..586928
FT                   /locus_tag="Tmar_0495"
FT   CDS_pept        585786..586928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0495"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1840 ABC-type Fe3+ transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   rxy:Rxyl_1175 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Extracellular solute-binding protein, family 1; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50616"
FT                   /db_xref="GOA:E6SGY5"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY5"
FT                   /protein_id="ADU50616.1"
FT                   /translation="MVEPAPRADRSGGPEGSRRPRQRALRPWLRARGGWQRALRRPRGA
FT                   LRLVAVLALAGFVLSGCGVLGRSGRQELVVYSSRTQSLVHPLLEQFARETGIDIKVRYA
FT                   STAELVNTLLEEGERSAADVLYLADAGGWGPLRQAGLLAELPQDVLEKVDPRFRSPDGQ
FT                   WVGVSGRSKVIVYNKNKIDPGRDLPDSVMDLTDPKWKGRIGWAPTHGEWQILVTAIRLT
FT                   KGEDAARQWLEGMKANDPKEYPNLISIVRAVADGEVDIGVVNHYYVPRLMEELGPDFAA
FT                   RNYFLKNGDPGAVIDVTGAAILKSTKNREAAERFVRFLLSEEAQRYFTQETKEYPMIAG
FT                   IPLPAGLPPMEELDPPAIDQSDLGQLQQTVELLRETGVLP"
FT   gene            586966..588549
FT                   /locus_tag="Tmar_0496"
FT   CDS_pept        586966..588549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8131 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50617"
FT                   /db_xref="GOA:E6SGY6"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY6"
FT                   /protein_id="ADU50617.1"
FT                   /translation="MAAHDRSTGAGAERGAGPAPAGRAPGAHAGQGTRQDGAMEPLLPA
FT                   PPPSAGWDRRGAAWRAVGLFVLLAVLYSFSAGLRASRGAAITGDEPFYLLTTQSLLEDG
FT                   DLDLRQQYRRRSYRAFFDHPDGLWMQSVPTPDGRILSPHNPGLSVLLIPGFALGGLRGA
FT                   QAQLQLQAALAFALTYLWVARVTGELRWSGWATLALAASATPFVYATEIYPEVPAALIL
FT                   VAVLWVLAREEPDARRTRVAPARPHPGEARRALAVALLLAALLWLGVKYAPLAALVAAA
FT                   AGWRAGRRGRWTLVLAGLALGIPYVLFHLRVFGALTPYSVNVVYAGDTTPEVLRAHVTG
FT                   LANRFYRLWGLFLDRRFGLARWAPVLLLALPGIVVLARRRGTPRLALALMAAQHLMAVF
FT                   VAITMMGWWFPGRTLMAVLPLYALPLAVVLQRGGRRARVAFALLTAVSVAVTVALVRSV
FT                   AAGHVTVAVDPFAMPVAWFQAMGRLFPDYRSWTVTTTSLTALWLAVLAGLGAWGWRLAV
FT                   PRQMTPRQMK"
FT   gene            588609..590321
FT                   /locus_tag="Tmar_0497"
FT   CDS_pept        588609..590321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0497"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1178 ABC-type Fe3+ transport system
FT                   permease component; InterPro IPR000515; KEGG: rxy:Rxyl_1174
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50618"
FT                   /db_xref="GOA:E6SGY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY7"
FT                   /protein_id="ADU50618.1"
FT                   /translation="MALARPASRSRPAAGAPGQGAAAAARRPGWLSLVAGGLRLPDAPG
FT                   PGTGPRPPLGLVLPAALVGLAMLLPVAYLFIRTAGAWDRVLDLLLRPGTWAIAGRSLGL
FT                   VAAVTATGVVLAVPLAWLVARTDLPGRRFWAVVTVLPLAIPSYVGSFLYVVAAGPHGLL
FT                   QRLLAPLGVERLPDLHGFWGAYLVMTLFTYPYILLPVRAALARLDPALEEASLSLGRGR
FT                   WATFQAVILPQLRPAILSGARLVALYTLAEFGAVATLRYETFTWALYVQYQSAFDRAAA
FT                   GGLALVLVAAALGILGLDAVLRERWRYHRDTPGTPRPPARVPLGRWRWPALAFCAAVAL
FT                   LALGVPLAVLVYWAVRGVLEGRWWDLLGPATLNSLAVSALAAVGTVAAALPVAALGARY
FT                   PGPLSGLIDRASYVGFAIPGIVIALAMVFFGIRFLGPLYQTVALLVAAYVIVFLPTALG
FT                   PLRASWLQVDPKLEEVARTLGRRPWQVLAGVTLPLVRPGLLAGAGMVFLVTLKELPLTL
FT                   ILSPAGFDTLATSVWNSITEAFFGQAAVKSLLLVAASAASVGWILRREGEWEA"
FT   gene            590318..591679
FT                   /locus_tag="Tmar_0498"
FT   CDS_pept        590318..591679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0498"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components; InterPro IPR003439:
FT                   IPR017871: IPR003593: IPR013611; KEGG: chl:Chy400_0347 ABC
FT                   transporter related; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50619"
FT                   /db_xref="GOA:E6SGY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY8"
FT                   /protein_id="ADU50619.1"
FT                   /translation="MKGDGTPVIRCRGLVKRFGSTEAVAGLDLDVDRGEVLVLVGPSGC
FT                   GKTTTLRLIAGFENPDAGRIELAGRTVAGGGRPVPPEARRVGFVFQEYALFPHLTVAQN
FT                   IAFGLPRGPERRRRVREMVELVRLEGLEDRYPHELSGGQQQRVALARALAPRPEILLLD
FT                   EPFSNLDADLRQQVREEVREILRRTGITAVLVTHDRREALNLGDRVAVMHRGRIEQVGT
FT                   PEAVYYRPATPFVAEFMGPATLLEGRVEPGGIATELGFFRQGVGLAPGTRVRVLVRPDD
FT                   VALRPCDGATAAARGAGTGAGAVGVITGRERRDGYYHYRVRLDSGTVVGSELVHVHDYP
FT                   VGTRVRVTVHAGHPLHWLPAEDEPAAGGAGDPAAPAPSPHGRVTVGAGSGAGALGGGCR
FT                   GPAGTGPSPAAPGRKEAPGAGRGAAGDARGDGAGAGTGPGTGTTAVATGRRDRA"
FT   sig_peptide     590318..590392
FT                   /locus_tag="Tmar_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            591676..592788
FT                   /locus_tag="Tmar_0499"
FT   CDS_pept        591676..592788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0499"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG1087 UDP-glucose 4-epimerase; InterPro
FT                   IPR008089: IPR020904: IPR001509; KEGG: rca:Rcas_4269
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: Putative uncharacterized
FT                   protein; PFAM: NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50620"
FT                   /db_xref="GOA:E6SGY9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGY9"
FT                   /protein_id="ADU50620.1"
FT                   /translation="MRLLITGGAGFIGSHLAELALLQGADVVVLDNFTANYDTALKQAN
FT                   VELLRRRAARATGGFRFVRGDVRNGELLDRLFARHRFTHVAHLAALPGVRPSLAEPRRY
FT                   LEANVGGTVALFEAVRRHGRGVERVLVASSSSVYGAQPGPWREDMPLAPLSPYAASKAA
FT                   AEQYALTYHRLLGVGVTCLRFFTVYGPRQRPDMAIAKFTACALAGRPIPVLGDIRSRRD
FT                   YTEVGDVVRGAWAALLEPGADFQVYNLGSGRPVTLQDLIAALGRVLHRPIALDLQPPAP
FT                   GDAPATWADISRARERLGYEPRVSLEQGLARYVAWVRARGPGYRGTTGTSCSGPRGNRP
FT                   ARHLTGHPSPAETVLCATALRITLRDEDHN"
FT   sig_peptide     591676..591747
FT                   /locus_tag="Tmar_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            592840..594069
FT                   /locus_tag="Tmar_0500"
FT   CDS_pept        592840..594069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0500"
FT                   /product="SMC domain protein"
FT                   /note="COGs: COG4637 ATPase; InterPro IPR014555: IPR003395;
FT                   KEGG: bpe:BP3115 hypothetical protein; PFAM: SMC domain
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50621"
FT                   /db_xref="GOA:E6SGZ0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ0"
FT                   /protein_id="ADU50621.1"
FT                   /translation="MAASPVRPFVEFIKIRNYKSIGRCEVRLNRLTVLVGPNGSGKSNF
FT                   LDALRFVADALRTTLEHAIRDRGGINEVRRRSYGHPHNLGITLGINVPDGSRAIYEFQV
FT                   GSSQDSGYQVVRESCKLAPASSPSSWIHSYVVERGRLREASFIGKGPDQIAIDRLYLTV
FT                   VSALPEFRALYDGLSNMGFYNLNPDVIRDIQDPDPGELLDRDGRNMASVIRRLRETNPA
FT                   VLERIIEYLQAVVPGVRSVDALHLQRKETLEFRQEVRGAKHPWKFSATNMSDGTLRALG
FT                   VLVAAFQTQALRKFQVPLVGIEEPEIAIHPGAAVKLMDALLEAKRYTQILITTHSPELL
FT                   DHPQLTDDMILAVEAEHGETYIAPVDQQIRQVIRNNLYTVGHLLRLGQLQPDRVGFEPL
FT                   PRQLEFAFQQ"
FT   gene            594527..594691
FT                   /locus_tag="Tmar_0501"
FT   CDS_pept        594527..594691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_2688 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50622"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ1"
FT                   /protein_id="ADU50622.1"
FT                   /translation="MMVPERGYGETVDQVAFASRFDLQLARSRSPSFDKFYREVMRLLS
FT                   CEERTGVRR"
FT   gene            complement(594884..596893)
FT                   /locus_tag="Tmar_0502"
FT   CDS_pept        complement(594884..596893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0502"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COGs: COG3808 Inorganic pyrophosphatase; InterPro
FT                   IPR017441: IPR004131; KEGG: tbd:Tbd_1500 membrane-bound
FT                   proton-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase; PRIAM: Inorganic diphosphatase; SPTR:
FT                   Inorganic H+ pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H+
FT                   pyrophosphatase; TIGRFAM: vacuolar-type H(+)-translocating
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50623"
FT                   /db_xref="GOA:E6SGZ2"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ2"
FT                   /protein_id="ADU50623.1"
FT                   /translation="MNSYLWIPLAGSLLSLLTGLFFATRITRLPVEHPAVADIGGHIQA
FT                   GATAYLNRQYRTLALVALVLFVVLAVVPGLGLTTALWFVIGAVLSAAAGYIGMNVAVRA
FT                   NMRTAMAARKGLAAAFRVAVQGGAVTGLMVVGLGLLGVTALVWLTGAENNSALVGFGFG
FT                   ASLISVFARLGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDDAGMA
FT                   ADLFETYAVTAVAAILLGLLTPQFAGDARFVYFPLLLGAVGIVSSIVGVLATPPARPGA
FT                   IMRALYQGALASGIVGTIGFFAVTRWLGLDMNLFYASLIGLGVTVAMIIITEYYTSANY
FT                   RPVQNIAHASQTGHATNIIAGLAVGMRSTAVPALVIAVAILLAYNLAGLYGVAIAAMAM
FT                   LSLTGIIVTMDAYGPITDNAGGLAEMADLEDSVREVTDQLDAVGNTTKAVTKGYAIGSA
FT                   GLAALVLFASYVEELGKAGVEALAFDLGDPYVLAGLLIGGVLPFLFASMSMEAVGRAAF
FT                   DVVEEVRRQFREIPGIMERKAKPDYGRAVDIVTRAALREMVLPGLIPVLGPIVVGLALG
FT                   PKALGGLIVGSIVTGLFIAIQMTNGGGSWDNAKKYIEMGHYGGKGTEAHAAAVTGDTVG
FT                   DPYKDTAGPAINPMIKIINIVALLIAPIVASLWL"
FT   sig_peptide     complement(596783..596893)
FT                   /locus_tag="Tmar_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            597180..598460
FT                   /locus_tag="Tmar_0503"
FT   CDS_pept        597180..598460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0503"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="COGs: COG0212 5-formyltetrahydrofolate cyclo-ligase;
FT                   InterPro IPR002698: IPR005122; KEGG: bha:BH0836
FT                   hypothetical protein; PFAM: 5-formyltetrahydrofolate
FT                   cyclo-ligase; Uracil-DNA glycosylase superfamily; SPTR:
FT                   BH0836 protein; PFAM: Uracil DNA glycosylase superfamily;
FT                   5-formyltetrahydrofolate cyclo-ligase family; TIGRFAM:
FT                   mismatch-specific thymine-DNA glycosylate (mug)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50624"
FT                   /db_xref="GOA:E6SGZ3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ3"
FT                   /protein_id="ADU50624.1"
FT                   /translation="MTRDEAVDKDAVPSKEAARREVYRRLREAGAARFPFPIEGRIPNF
FT                   QGAERAAARLRELEIYRRARALKVNPDTPQLPVRAMALADGKTLYMPTPRLRGAFLRIR
FT                   PQDVPRGEERRAAQLSKAAEYGRFVPLAELAPEAAPIDLVVAGAVAVTRDGARAGKGEG
FT                   YADYEYALLRELGHPELPVVTTVHPLQLVDRLPVDPHDLSVDVVVTPDQVIRTRTPYPK
FT                   PRGIRWEEVTEEDLQAMPVLRELRALLWERMTVPEVLVPGLAAVFVGLNPGRASATAGH
FT                   HFAGPNNLFWRLLHEAGFVPRVLRPEEDGLLPRWGLGVTNVVPRATQGEADLTWDELAA
FT                   GGAVLREKMARVRPRLVVLLGKQVYRAYAGLARTARVEWGPQPRESVPGVREFAAPNPS
FT                   SRSTVPYEERLRLFREARAWLQDASRA"
FT   gene            598535..599074
FT                   /locus_tag="Tmar_0504"
FT   CDS_pept        598535..599074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0504"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835; KEGG: tth:TTC0626 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; SPTR: Probable transcriptional regulator,
FT                   marR family; manually curated; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50625"
FT                   /db_xref="GOA:E6SGZ4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ4"
FT                   /protein_id="ADU50625.1"
FT                   /translation="MSGWEILQQIWRLQQVVLREATPCLERHGLFRMAPFALAMVRRCG
FT                   TPSGVANALGLPAPTVSHILRRLEAEGWVVRQVDPGDLRRYRLALTPAGQEALAAARAC
FT                   LEAVMDRRLECLAPAERDALRRLLARLQEDLPPSGVGDVRAAAGDPGVDPAGDPGVERE
FT                   GAVPREGTAARDEPAR"
FT   gene            599037..601148
FT                   /locus_tag="Tmar_0505"
FT   CDS_pept        599037..601148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0505"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR004638: IPR011701; KEGG: tth:TTC0625 multidrug
FT                   resistance protein B; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Multidrug resistance protein B; TIGRFAM: drug
FT                   resistance transporter, EmrB/QacA subfamily; PFAM: Major
FT                   Facilitator Superfamily; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50626"
FT                   /db_xref="GOA:E6SGZ5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ5"
FT                   /protein_id="ADU50626.1"
FT                   /translation="MKERQPVTNQPAEPAEAAATGVNPARGIPAAAGPSATPSVPAAGP
FT                   GGAAAGDGPRPGERRLAMIGVMLCMFLGALDQTIVSTAMPRVVEELHGLDRYAWVATSY
FT                   LLATVVALPIFGRLNELLPGKWVFITAASIFLAGSALSGLSPSMDALIAFRALQGIGGG
FT                   GLFATSITTIGLLYPPRERGRVQGVFAAVFGLSSVIGPWVGGLLTDHLNWRWVFYVNMP
FT                   VGIVALYFLFRHMPLLPPMRRSAFDLPGAVTMALWTVPLILACSWGGSTYPWDSPQVLG
FT                   LFALAAVGLVLFVLVERRSAHPLFDLTLFANPTFRWAVLALLFFGGTFLGSVMFLPLYL
FT                   VQVKGFSASNSGLALTPLTMGTVAGSLLAGQLATRFGRYKPMLLVSSVASVALFIVLHQ
FT                   VLRVETPLWQVLVLMVLLGFVFGPSMPLYGMAVQNSVSRERIGTASSATQFFRQVGSTV
FT                   AVALLGTVLSGALHDGMIQHLPPAYRAATQSFQMPAEGMAGGVDMEARVRQGFEQVLAE
FT                   VEQALQGDEQAYRRLQADPRVPAALKQQVPEGGIPAQVRARTEPVRVALEAALQGDPQA
FT                   RQALLANPALPASLRQLVQNPPADPAARQAALAAARQALDAQVQTMTVEAERQAMAQIR
FT                   QAMEQQVDRVVATFRSAFNEAVTDALRQVYLYTAVMAVMGLLCLFFLPDQELRSSYAQP
FT                   EPVPAVARE"
FT   gene            complement(601511..602074)
FT                   /locus_tag="Tmar_0506"
FT   CDS_pept        complement(601511..602074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0506"
FT                   /product="MOSC domain containing protein"
FT                   /note="InterPro IPR005302; KEGG: bld:BLi03268 YuaD; PFAM:
FT                   MOSC domain containing protein; SPTR: Putative
FT                   uncharacterized protein yuaD; PFAM: MOSC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50627"
FT                   /db_xref="GOA:E6SGZ6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ6"
FT                   /protein_id="ADU50627.1"
FT                   /translation="MPFATTCRVEAVLVATDPDTFVTRRVEAVEVDLGGIPGDRHHGLT
FT                   RPAGSREPMYPRGTPIRNRRQLSAVSVEECQAIADGLGLDAVLPEWLGANLLLSGLPEL
FT                   TRLPAGARLLFPSGAGLVCEGENRPCRHPGEVLARLHPLHPERAALPVRFVQVARGRRG
FT                   IVLSVERPGRIARGDAVRIWLPRR"
FT   gene            602462..603523
FT                   /locus_tag="Tmar_0507"
FT   CDS_pept        602462..603523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0507"
FT                   /product="ROK family protein"
FT                   /note="COGs: COG1940 Transcriptional regulator/sugar
FT                   kinase; InterPro IPR000600; KEGG: tit:Thit_0081 ROK family
FT                   protein; PFAM: ROK family protein; SPTR: ROK family
FT                   protein; PFAM: ROK family; TIGRFAM: ROK family protein
FT                   (putative glucokinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50628"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ7"
FT                   /protein_id="ADU50628.1"
FT                   /translation="MAIHRDRYGTASGDPAPGAAAREAAGAGTAAGTGGGAGDGVVLGI
FT                   DLGGTKIALGLVDRRGKVLADVTLPTEATAGPAAAMDRLAAAARQLAARADRKPLAAGV
FT                   GAPGPLLLPEGRFTGTPNLPGWNGFALRDELARRLGIPVAVNNDANAAALAEARLGAGR
FT                   GAAVMVYVTVGTGIGGGLVVGGKLFSGVNGNGVEIGHTTLDPDGPPCGCGNRGCWEALA
FT                   SGPALARLAGERLGPSPRRPGGQWTAKDLLEAAAAGDPAARAVADEYARRLGVGLANAV
FT                   NAFNPDRLVLGGGVMARYDLLAPAMEAEMRRRALPANAAAVALAPATLGKRAGLVGAAL
FT                   LAWDLLDEPGPGR"
FT   gene            603557..604027
FT                   /locus_tag="Tmar_0508"
FT   CDS_pept        603557..604027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sno:Snov_3089 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50629"
FT                   /db_xref="GOA:E6SGZ8"
FT                   /db_xref="InterPro:IPR025356"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ8"
FT                   /protein_id="ADU50629.1"
FT                   /translation="MARVWLRLEGLLLALAALVAYGAAGGGWAAFIVFFVLPDGIGLVP
FT                   FALAARGTGGRWPRDRLRPAGTGGRRRRGAQDAQPLVAPRWFLLYNAAHSTALPLLLAL
FT                   LGWWATGRVYLPLLGWLTHIGLDRALGLGLKLYPYLRSTHLQLEEAPLRPRW"
FT   sig_peptide     603557..603643
FT                   /locus_tag="Tmar_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            604239..605105
FT                   /locus_tag="Tmar_0509"
FT   CDS_pept        604239..605105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0509"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284: IPR007627: IPR013249; KEGG: fal:FRAAL0980 RNA
FT                   polymerase ECF-subfamily sigma factor; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   Putative RNA polymerase ECF-subfamily sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50630"
FT                   /db_xref="GOA:E6SGZ9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6SGZ9"
FT                   /protein_id="ADU50630.1"
FT                   /translation="MEGNGAVAGIPWPGRRLSPVVPARAAPAGAAAPWPAAAPLAPPGP
FT                   GPGRHGAAPAPADSATRPHPHGVHPDAAGQGDGPPEAALLAGLRAGEPAALQRLAEEWA
FT                   PRLYRYAVRLGADPEGARDLVQEVLVRALRSFRSGRVPHRLGPWLYTILTNLLRDEARS
FT                   AYRQRVDLAGSALEGPAPWSPALPAPAETAAGTLGADPAEVVARRDEGADQARRLRAAL
FT                   MALPLPWRQVVVLRVLEELPVAEVAAVLGVAEGTVKSRLHRALKALRQALEPAAEPGEV
FT                   SAREQEG"
FT   sig_peptide     604239..604313
FT                   /locus_tag="Tmar_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            605089..606348
FT                   /locus_tag="Tmar_0510"
FT   CDS_pept        605089..606348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3468 ComEC/Rec2-related protein;
FT                   SPTR: ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50631"
FT                   /db_xref="GOA:E6SH00"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH00"
FT                   /protein_id="ADU50631.1"
FT                   /translation="MNRKDEPTAGGAGPAPVSPVPGGPEQGSALRDATGQAGWQALWRE
FT                   AADGARREGDTPLDPQEVARLWSGLRAVAADEPAVSQDLVPGVTRALVEAAHELPSGLG
FT                   LEPPAAAAAVAGPGCPPDLPEILPAGTVRPGLAQLARLLWAEARWLPLPFLVMQLLLTA
FT                   GGLLLHLVTLESAGIATAAGGLAGAAGSRGAGPELTGWQLVLVSADHLALVAPWLGTLV
FT                   ALAAAWPRRRQLWADLEALSPFPPASRLLARTWVAGILATVLMLVAGWIQPAAVLAAFG
FT                   DGLVAVPPGPDTAVAVPAGDGAGGAAGGMTGVASSVTAPAFAHDAWTAAAVVLARLAPL
FT                   WMAAAWALWWQVRTGTLGAMLASAALWTAVTLGGRFLGPWNPLAAGPLPAAGLHVAMLA
FT                   VALLLAWRLRGQAEVPNPAP"
FT   gene            606635..607336
FT                   /locus_tag="Tmar_0511"
FT   CDS_pept        606635..607336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0511"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439; KEGG: tpr:Tpau_2154
FT                   FHA modulated ABC efflux pump with fused ATPase and
FT                   integral membrane subunits; PFAM: ABC transporter related;
FT                   SPTR: ABC transporter, drug exporter-1 (DrugE1) family,
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50632"
FT                   /db_xref="GOA:E6SH01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH01"
FT                   /protein_id="ADU50632.1"
FT                   /translation="MSVPALASPTLAWQGLVLPGNRPIPIPDGFAAPGVTLVEGPAGSG
FT                   KSLFLRVLATLAVPRAGRVRYPWPGRDGSLVTFPGAGPDDLARVRGCTGYVPQEGRVLQ
FT                   GMKVASALAYLAALRAVPDARQAVAAILARWGLAGAAGQRLEELSGGQWRRWLLAQSQL
FT                   TRPALWILDEPARGLDHGGVELLREALEGYRSAAARGALVWAVVVDSEGRVADLADQHL
FT                   VLSSREGWRDP"
FT   sig_peptide     606635..606703
FT                   /locus_tag="Tmar_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            607380..607880
FT                   /locus_tag="Tmar_0512"
FT   CDS_pept        607380..607880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0512"
FT                   /product="VanZ family protein"
FT                   /note="COGs: COG4767 Glycopeptide antibiotics resistance
FT                   protein; InterPro IPR006976; KEGG: gtn:GTNG_0437
FT                   hypothetical protein; PFAM: VanZ family protein; SPTR:
FT                   Putative membrane protein; PFAM: VanZ like family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50633"
FT                   /db_xref="GOA:E6SH02"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH02"
FT                   /protein_id="ADU50633.1"
FT                   /translation="MDRSRTWLRQGSAWLQAAVALLYVGVLLRVTVLKFPQLLMNQDWQ
FT                   PQSLMLQWRFAVNPVPFRTIAGYLAGEPSAGIAVQNLAGNVLIFVPWGVLWVWCRAHRA
FT                   RAAVVVGTALVASFVLEVAEFLLRVGSFDVDDLLLNGLGAFLGYGAARFPWRRRFRART
FT                   TGC"
FT   sig_peptide     607380..607478
FT                   /locus_tag="Tmar_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            607946..609106
FT                   /locus_tag="Tmar_0513"
FT   CDS_pept        607946..609106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0513"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR017871: IPR003593;
FT                   KEGG: ele:Elen_1458 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50634"
FT                   /db_xref="GOA:E6SH03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH03"
FT                   /protein_id="ADU50634.1"
FT                   /translation="MDGTGMAGRDRTGMAPWGTAAGTTATVTPDAAAAGTGMRLQLEGV
FT                   TKIYGRRKVAVEDVSLTWGPGVLGLLGPNGAGKSTLLGILATLVEPTRGRVQIGPWALP
FT                   HDQHAVRRHLGYLPQEGGWFPQLTVYETLDFAAIFKGIQDPAARRREIERRLEQVGLQD
FT                   ARHVRAGRLSGGMRRRLGIAMALLGDPLLILLDEPTAGLDPEERVRFRQLLGGLGRDRL
FT                   VIFSTHVVEDIAATCEEVAVMAGGRLRWLGPPADLAACAAGLVWEVEGRAPEGAVVVSS
FT                   RREGAATRSRVLAWHEPPGARPASPTVEDGYVSLLRGLAAGRAGRAAATPGGSGRLSQP
FT                   AHLPAQASDRGCGSPDPASGHARDDVSDPASGRTPGPRPEGEGAGR"
FT   sig_peptide     607946..608044
FT                   /locus_tag="Tmar_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            609103..611283
FT                   /locus_tag="Tmar_0514"
FT   CDS_pept        609103..611283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bts:Btus_2086 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50635"
FT                   /db_xref="GOA:E6SH04"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH04"
FT                   /protein_id="ADU50635.1"
FT                   /translation="MRWTQSFRAAARYTWTRVRRTWWLPAAVAGGLATGLLTVTQTVAE
FT                   TGVGVLQQAAQFLSFLQAGVMVLAGLAADPERDEDSAAVFWSWPADTAALVLGKLVGAA
FT                   PLALLAALGAAVPPAVLMASLGRGAGLPWSSVLAEWGLLLAWLVPGALWAAAVGGALGL
FT                   WLRGLPLFAAILAVWLAGVLGAYLFQALFNPFFPVAWLLQWTGSAMLPPDFEDADQAAL
FT                   GGDLPLLVAHRVLYLAAAGLVVTILALGYRRHRSAGAPVRWGLRLAAGALAVLTVAVAA
FT                   GAAAVLYARADAGRQELLYYARQGVHPDGSPPPADQVPQFAVTRYQLDVDARRPPELRV
FT                   DARMVLENRSRVPVQDPTFTLRHVFTVTRVGVEGREAAAVHWTRDRDWIRLDGLVLPPG
FT                   GSATVTLSYQGKVDQWTLPGGYPWTRMASTSLPDLWHGAHVGPAGLSLPASYGWYPLAG
FT                   RVTLARALAMPTPAGQTAIWLLEGPATTGSGTIRWPGPVPPEAPAPLEPASFSVTVRHL
FT                   ARYPVLSNLQDLDGPWGPDTRMAGTSTFLQLVGWPLAHVATPDADIWYPAADPGSRKNA
FT                   AEWASWLREAYTWVGQEVRPRVVTLPLVGTARVDRLSIDPHSGVVMESGSAIMVPHQAM
FT                   EAVLLGPRDAAGDVESCLVGVVGQLVAWGQPDLPPGPHPCDDLPGGPRAGALATWLRET
FT                   PRAQVVAALSRLREIAAQRPLRASDLREVMGP"
FT   sig_peptide     609103..609234
FT                   /locus_tag="Tmar_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            611280..612014
FT                   /locus_tag="Tmar_0515"
FT   CDS_pept        611280..612014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2616 chromate transporter; SPTR:
FT                   Chromate transporter, chromate ion transporter (CHR)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50636"
FT                   /db_xref="GOA:E6SH05"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH05"
FT                   /protein_id="ADU50636.1"
FT                   /translation="MSGGLLRLHLRLARPGLVATACLGLAFVPVLVWPERLTGHPLGLH
FT                   TLLRLVEEFLVLVVLPVTVPLWSDVEGRRPVLWRALPFRRAVVVLWRFGLPLAAFALVA
FT                   TGMVGLAALRTAAPGGVSWQVGLRVVALALPAAAWLGALAALVSVLVRVPVAGAGAAMA
FT                   WWALEAVTQGDVTGSLYLFAASGGLRGAGVDPGAILEALALGNPLPPAFLANRWELVGL
FT                   ACLAALATAELYRRNERFLRQD"
FT   sig_peptide     611280..611396
FT                   /locus_tag="Tmar_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            612733..614043
FT                   /locus_tag="Tmar_0516"
FT   CDS_pept        612733..614043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0516"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro IPR020578: IPR000192;
FT                   KEGG: cya:CYA_1597 putative soluble hydrogenase, tritium
FT                   exchange subunit; PFAM: aminotransferase class V; SPTR:
FT                   Putative soluble hydrogenase, tritium exchange subunit;
FT                   PFAM: Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50637"
FT                   /db_xref="GOA:E6SH06"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH06"
FT                   /protein_id="ADU50637.1"
FT                   /translation="MQQPLQRGAGDCHGQPAGGPAAGPAAARPGREPGPVRPATVFLSP
FT                   GPTAVPDEVRAACARQVVLHRSREFDQVSGFVLEGLRRLFRTEGRVVVFPCSGTGALEA
FT                   AVVNTLSPGDRVLAVVMGLFGDRFAAIAEAYGLEVDRLEIPWGQVPTVEQVVERLRSAR
FT                   PGAVFLTHSETSTGALLPLDRLVPAIREAAPETLVLVDMVSSFAAVPVAMDAWGIDVAV
FT                   TGSQKALMTPPGLGIVALGPRALEAVERARLPRFTWDLRPYLAGGGDFPYTPAVTLWFG
FT                   LKAALERIAAEGEENVYRRHRLLSAMVRAGVRALGLEPLVRDEDASPTVTAVMLPEGIR
FT                   PAKVIRRLQDEHGVVVVSAQGHLKDRAFRIGHMGAVAPAEVRAGMAALDAVLAPMLAGA
FT                   GHGPVPGSAAAAAEAVRAAAAGSSGADAPARAAGVGR"
FT   gene            614040..615755
FT                   /locus_tag="Tmar_0517"
FT   CDS_pept        614040..615755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0517"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006140: IPR006236:
FT                   IPR006139: IPR002912; KEGG: sth:STH9 D-3-phosphoglycerate
FT                   dehydrogenase; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region; amino acid-binding ACT
FT                   domain protein; PRIAM: Phosphoglycerate dehydrogenase;
FT                   SPTR: Phosphoglycerate dehydrogenase; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; ACT
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; TIGRFAM: D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU50638"
FT                   /db_xref="GOA:E6SH07"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SH07"
FT                   /protein_id="ADU50638.1"
FT                   /translation="MTAPSTGSRKPRVVVADPLPRDGLALLHAHCEVVDAAGASPDILR
FT                   RELLPTADALIVRSRVKVTADLIAAAPRLRVIGRAGVGVDNIDLDAATERGIVVVNVAD
FT                   GNTVAVAEHVFALLLALVRRLLPASASLREGRWERSRWVGEELRGKVMGLVGFGRIGQE
FT                   VAQRARAFGMAVLAYDPYVPDARIRELGAEPAALDDLLARADVVSVHTPLTPATRNLIG
FT                   EAALARMRPGAYLINTARGGIVDEQALYRALTEGRLAGAGLDVFATEPPGESPLLALPN
FT                   VVATPHLGGSTREAQAYNARAVAEQVLRALQGQPVRGAVNLPHLSDRDWHAAGPLAPVA
FT                   ELIGLVYREGLGGPLEDLELRVAARDLPSERGFQLLAGAALKGLLSGVVDGPVNTVNAP
FT                   VLAARRGIALRWRSERHPDLPVPVVELAGGRGARRAVAGSLTPDGLPRLVHLDGLPLDM
FT                   VPAPRLLLTRHHDRPGMIGKVGSLLGAREINIAAMQVARRQVRGEAIMVLALDDPVPAA
FT                   LLAEIRRLPGMEEARLVQVPAALLEPARIPGAGDAGGEAGGPVHRPGEARERAS"
FT   gene            complement(615777..615905)
FT                   /locus_tag="Tmar_0518"
FT   CDS_pept        complement(615777..615905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmar_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_5481 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmar_0518"
FT                   /