(data stored in SCRATCH3701 zone)

EMBL: CP002353

ID   CP002353; SV 1; circular; genomic DNA; STD; PRO; 5472964 BP.
XX
AC   CP002353;
XX
PR   Project:PRJNA32825;
XX
DT   21-JAN-2011 (Rel. 107, Created)
DT   21-JUL-2015 (Rel. 125, Last updated, Version 32)
XX
DE   Isosphaera pallida ATCC 43644, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Isosphaera pallida ATCC 43644
OC   Bacteria; Planctomycetes; Planctomycetia; Isosphaerales; Isosphaeraceae;
OC   Isosphaera.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5472964
RX   PUBMED; 21475588.
RA   Goker M., Cleland D., Saunders E., Lapidus A., Nolan M., Lucas S.,
RA   Hammon N., Deshpande S., Cheng J.F., Tapia R., Han C., Goodwin L.,
RA   Pitluck S., Liolios K., Pagani I., Ivanova N., Mavromatis K., Pati A.,
RA   Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Detter J.C., Beck B., Woyke T., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Isosphaera pallida type strain (IS1B)";
RL   Stand Genomic Sci 4(1):63-71(2011).
XX
RN   [2]
RP   1-5472964
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Bruce D., Goodwin L., Pitluck S.,
RA   Kyrpides N., Mavromatis K., Pagani I., Ivanova N., Saunders E., Brettin T.,
RA   Detter J.C., Han C., Tapia R., Land M., Hauser L., Markowitz V.,
RA   Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Eisen J.A.;
RT   "The complete sequence of chromosome of Isophaera pallida ATCC 43644";
RL   Unpublished.
XX
RN   [3]
RP   1-5472964
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Bruce D., Goodwin L., Pitluck S.,
RA   Kyrpides N., Mavromatis K., Pagani I., Ivanova N., Saunders E., Brettin T.,
RA   Detter J.C., Han C., Tapia R., Land M., Hauser L., Markowitz V.,
RA   Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Eisen J.A.;
RT   ;
RL   Submitted (22-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c079d6a694ac23767fa394f6d90b8321.
DR   BioSample; SAMN00138929.
DR   EnsemblGenomes-Gn; EBG00001074856.
DR   EnsemblGenomes-Gn; EBG00001074857.
DR   EnsemblGenomes-Gn; EBG00001074858.
DR   EnsemblGenomes-Gn; EBG00001074859.
DR   EnsemblGenomes-Gn; EBG00001074860.
DR   EnsemblGenomes-Gn; EBG00001074861.
DR   EnsemblGenomes-Gn; EBG00001074862.
DR   EnsemblGenomes-Gn; EBG00001074864.
DR   EnsemblGenomes-Gn; EBG00001074865.
DR   EnsemblGenomes-Gn; EBG00001074866.
DR   EnsemblGenomes-Gn; EBG00001074867.
DR   EnsemblGenomes-Gn; EBG00001074868.
DR   EnsemblGenomes-Gn; EBG00001074869.
DR   EnsemblGenomes-Gn; EBG00001074870.
DR   EnsemblGenomes-Gn; EBG00001074871.
DR   EnsemblGenomes-Gn; EBG00001074872.
DR   EnsemblGenomes-Gn; EBG00001074873.
DR   EnsemblGenomes-Gn; EBG00001074874.
DR   EnsemblGenomes-Gn; EBG00001074876.
DR   EnsemblGenomes-Gn; EBG00001074877.
DR   EnsemblGenomes-Gn; EBG00001074878.
DR   EnsemblGenomes-Gn; EBG00001074879.
DR   EnsemblGenomes-Gn; EBG00001074880.
DR   EnsemblGenomes-Gn; EBG00001074881.
DR   EnsemblGenomes-Gn; EBG00001074882.
DR   EnsemblGenomes-Gn; EBG00001074883.
DR   EnsemblGenomes-Gn; EBG00001074884.
DR   EnsemblGenomes-Gn; EBG00001074885.
DR   EnsemblGenomes-Gn; EBG00001074886.
DR   EnsemblGenomes-Gn; EBG00001074887.
DR   EnsemblGenomes-Gn; EBG00001074888.
DR   EnsemblGenomes-Gn; EBG00001074889.
DR   EnsemblGenomes-Gn; EBG00001074890.
DR   EnsemblGenomes-Gn; EBG00001074891.
DR   EnsemblGenomes-Gn; EBG00001074892.
DR   EnsemblGenomes-Gn; EBG00001074893.
DR   EnsemblGenomes-Gn; EBG00001074894.
DR   EnsemblGenomes-Gn; EBG00001074895.
DR   EnsemblGenomes-Gn; EBG00001074896.
DR   EnsemblGenomes-Gn; EBG00001074897.
DR   EnsemblGenomes-Gn; EBG00001074898.
DR   EnsemblGenomes-Gn; EBG00001074899.
DR   EnsemblGenomes-Gn; EBG00001074900.
DR   EnsemblGenomes-Gn; EBG00001074901.
DR   EnsemblGenomes-Gn; EBG00001074902.
DR   EnsemblGenomes-Gn; EBG00001074903.
DR   EnsemblGenomes-Gn; EBG00001074904.
DR   EnsemblGenomes-Gn; EBG00001074905.
DR   EnsemblGenomes-Gn; EBG00001074906.
DR   EnsemblGenomes-Gn; EBG00001074907.
DR   EnsemblGenomes-Gn; EBG00001074908.
DR   EnsemblGenomes-Gn; EBG00001074909.
DR   EnsemblGenomes-Gn; EBG00001074910.
DR   EnsemblGenomes-Gn; EBG00001074911.
DR   EnsemblGenomes-Gn; EBG00001074912.
DR   EnsemblGenomes-Gn; EBG00001074913.
DR   EnsemblGenomes-Gn; EBG00001074914.
DR   EnsemblGenomes-Gn; EBG00001074915.
DR   EnsemblGenomes-Gn; EBG00001074917.
DR   EnsemblGenomes-Gn; EBG00001074918.
DR   EnsemblGenomes-Gn; EBG00001074919.
DR   EnsemblGenomes-Gn; EBG00001074920.
DR   EnsemblGenomes-Gn; EBG00001074921.
DR   EnsemblGenomes-Gn; EBG00001074922.
DR   EnsemblGenomes-Gn; EBG00001074923.
DR   EnsemblGenomes-Gn; EBG00001074924.
DR   EnsemblGenomes-Gn; EBG00001074925.
DR   EnsemblGenomes-Gn; EBG00001074926.
DR   EnsemblGenomes-Gn; EBG00001074927.
DR   EnsemblGenomes-Gn; EBG00001074928.
DR   EnsemblGenomes-Gn; Isop_R0001.
DR   EnsemblGenomes-Gn; Isop_R0002.
DR   EnsemblGenomes-Gn; Isop_R0003.
DR   EnsemblGenomes-Gn; Isop_R0004.
DR   EnsemblGenomes-Gn; Isop_R0005.
DR   EnsemblGenomes-Gn; Isop_R0006.
DR   EnsemblGenomes-Gn; Isop_R0007.
DR   EnsemblGenomes-Gn; Isop_R0008.
DR   EnsemblGenomes-Gn; Isop_R0009.
DR   EnsemblGenomes-Gn; Isop_R0010.
DR   EnsemblGenomes-Gn; Isop_R0011.
DR   EnsemblGenomes-Gn; Isop_R0012.
DR   EnsemblGenomes-Gn; Isop_R0013.
DR   EnsemblGenomes-Gn; Isop_R0014.
DR   EnsemblGenomes-Gn; Isop_R0015.
DR   EnsemblGenomes-Gn; Isop_R0016.
DR   EnsemblGenomes-Gn; Isop_R0017.
DR   EnsemblGenomes-Gn; Isop_R0018.
DR   EnsemblGenomes-Gn; Isop_R0019.
DR   EnsemblGenomes-Gn; Isop_R0020.
DR   EnsemblGenomes-Gn; Isop_R0021.
DR   EnsemblGenomes-Gn; Isop_R0022.
DR   EnsemblGenomes-Gn; Isop_R0023.
DR   EnsemblGenomes-Gn; Isop_R0024.
DR   EnsemblGenomes-Gn; Isop_R0026.
DR   EnsemblGenomes-Gn; Isop_R0027.
DR   EnsemblGenomes-Gn; Isop_R0028.
DR   EnsemblGenomes-Gn; Isop_R0029.
DR   EnsemblGenomes-Gn; Isop_R0030.
DR   EnsemblGenomes-Gn; Isop_R0031.
DR   EnsemblGenomes-Gn; Isop_R0032.
DR   EnsemblGenomes-Gn; Isop_R0033.
DR   EnsemblGenomes-Gn; Isop_R0034.
DR   EnsemblGenomes-Gn; Isop_R0035.
DR   EnsemblGenomes-Gn; Isop_R0036.
DR   EnsemblGenomes-Gn; Isop_R0037.
DR   EnsemblGenomes-Gn; Isop_R0038.
DR   EnsemblGenomes-Gn; Isop_R0039.
DR   EnsemblGenomes-Gn; Isop_R0040.
DR   EnsemblGenomes-Gn; Isop_R0041.
DR   EnsemblGenomes-Gn; Isop_R0042.
DR   EnsemblGenomes-Gn; Isop_R0043.
DR   EnsemblGenomes-Gn; Isop_R0044.
DR   EnsemblGenomes-Gn; Isop_R0045.
DR   EnsemblGenomes-Gn; Isop_R0046.
DR   EnsemblGenomes-Gn; Isop_R0047.
DR   EnsemblGenomes-Gn; Isop_R0048.
DR   EnsemblGenomes-Gn; Isop_R0049.
DR   EnsemblGenomes-Gn; Isop_R0050.
DR   EnsemblGenomes-Gn; Isop_R0051.
DR   EnsemblGenomes-Gn; Isop_R0052.
DR   EnsemblGenomes-Gn; Isop_R0053.
DR   EnsemblGenomes-Gn; Isop_R0054.
DR   EnsemblGenomes-Gn; Isop_R0055.
DR   EnsemblGenomes-Gn; Isop_R0056.
DR   EnsemblGenomes-Gn; Isop_R0057.
DR   EnsemblGenomes-Gn; Isop_R0058.
DR   EnsemblGenomes-Gn; Isop_R0059.
DR   EnsemblGenomes-Gn; Isop_R0060.
DR   EnsemblGenomes-Gn; Isop_R0061.
DR   EnsemblGenomes-Tr; EBT00001677394.
DR   EnsemblGenomes-Tr; EBT00001677396.
DR   EnsemblGenomes-Tr; EBT00001677397.
DR   EnsemblGenomes-Tr; EBT00001677398.
DR   EnsemblGenomes-Tr; EBT00001677399.
DR   EnsemblGenomes-Tr; EBT00001677401.
DR   EnsemblGenomes-Tr; EBT00001677402.
DR   EnsemblGenomes-Tr; EBT00001677403.
DR   EnsemblGenomes-Tr; EBT00001677404.
DR   EnsemblGenomes-Tr; EBT00001677405.
DR   EnsemblGenomes-Tr; EBT00001677406.
DR   EnsemblGenomes-Tr; EBT00001677407.
DR   EnsemblGenomes-Tr; EBT00001677408.
DR   EnsemblGenomes-Tr; EBT00001677409.
DR   EnsemblGenomes-Tr; EBT00001677410.
DR   EnsemblGenomes-Tr; EBT00001677411.
DR   EnsemblGenomes-Tr; EBT00001677412.
DR   EnsemblGenomes-Tr; EBT00001677413.
DR   EnsemblGenomes-Tr; EBT00001677414.
DR   EnsemblGenomes-Tr; EBT00001677415.
DR   EnsemblGenomes-Tr; EBT00001677416.
DR   EnsemblGenomes-Tr; EBT00001677417.
DR   EnsemblGenomes-Tr; EBT00001677418.
DR   EnsemblGenomes-Tr; EBT00001677419.
DR   EnsemblGenomes-Tr; EBT00001677420.
DR   EnsemblGenomes-Tr; EBT00001677421.
DR   EnsemblGenomes-Tr; EBT00001677422.
DR   EnsemblGenomes-Tr; EBT00001677423.
DR   EnsemblGenomes-Tr; EBT00001677424.
DR   EnsemblGenomes-Tr; EBT00001677425.
DR   EnsemblGenomes-Tr; EBT00001677426.
DR   EnsemblGenomes-Tr; EBT00001677427.
DR   EnsemblGenomes-Tr; EBT00001677428.
DR   EnsemblGenomes-Tr; EBT00001677429.
DR   EnsemblGenomes-Tr; EBT00001677430.
DR   EnsemblGenomes-Tr; EBT00001677431.
DR   EnsemblGenomes-Tr; EBT00001677432.
DR   EnsemblGenomes-Tr; EBT00001677433.
DR   EnsemblGenomes-Tr; EBT00001677434.
DR   EnsemblGenomes-Tr; EBT00001677435.
DR   EnsemblGenomes-Tr; EBT00001677436.
DR   EnsemblGenomes-Tr; EBT00001677437.
DR   EnsemblGenomes-Tr; EBT00001677438.
DR   EnsemblGenomes-Tr; EBT00001677439.
DR   EnsemblGenomes-Tr; EBT00001677440.
DR   EnsemblGenomes-Tr; EBT00001677441.
DR   EnsemblGenomes-Tr; EBT00001677442.
DR   EnsemblGenomes-Tr; EBT00001677443.
DR   EnsemblGenomes-Tr; EBT00001677444.
DR   EnsemblGenomes-Tr; EBT00001677445.
DR   EnsemblGenomes-Tr; EBT00001677446.
DR   EnsemblGenomes-Tr; EBT00001677447.
DR   EnsemblGenomes-Tr; EBT00001677449.
DR   EnsemblGenomes-Tr; EBT00001677450.
DR   EnsemblGenomes-Tr; EBT00001677451.
DR   EnsemblGenomes-Tr; EBT00001677452.
DR   EnsemblGenomes-Tr; EBT00001677453.
DR   EnsemblGenomes-Tr; EBT00001677454.
DR   EnsemblGenomes-Tr; EBT00001677455.
DR   EnsemblGenomes-Tr; EBT00001677456.
DR   EnsemblGenomes-Tr; EBT00001677457.
DR   EnsemblGenomes-Tr; EBT00001677458.
DR   EnsemblGenomes-Tr; EBT00001677459.
DR   EnsemblGenomes-Tr; EBT00001677460.
DR   EnsemblGenomes-Tr; EBT00001677461.
DR   EnsemblGenomes-Tr; EBT00001677462.
DR   EnsemblGenomes-Tr; EBT00001677463.
DR   EnsemblGenomes-Tr; EBT00001677464.
DR   EnsemblGenomes-Tr; EBT00001677465.
DR   EnsemblGenomes-Tr; EBT00001677466.
DR   EnsemblGenomes-Tr; Isop_R0001-1.
DR   EnsemblGenomes-Tr; Isop_R0002-1.
DR   EnsemblGenomes-Tr; Isop_R0003-1.
DR   EnsemblGenomes-Tr; Isop_R0004-1.
DR   EnsemblGenomes-Tr; Isop_R0005-1.
DR   EnsemblGenomes-Tr; Isop_R0006-1.
DR   EnsemblGenomes-Tr; Isop_R0007-1.
DR   EnsemblGenomes-Tr; Isop_R0008-1.
DR   EnsemblGenomes-Tr; Isop_R0009-1.
DR   EnsemblGenomes-Tr; Isop_R0010-1.
DR   EnsemblGenomes-Tr; Isop_R0011-1.
DR   EnsemblGenomes-Tr; Isop_R0012-1.
DR   EnsemblGenomes-Tr; Isop_R0013-1.
DR   EnsemblGenomes-Tr; Isop_R0014-1.
DR   EnsemblGenomes-Tr; Isop_R0015-1.
DR   EnsemblGenomes-Tr; Isop_R0016-1.
DR   EnsemblGenomes-Tr; Isop_R0017-1.
DR   EnsemblGenomes-Tr; Isop_R0018-1.
DR   EnsemblGenomes-Tr; Isop_R0019-1.
DR   EnsemblGenomes-Tr; Isop_R0020-1.
DR   EnsemblGenomes-Tr; Isop_R0021-1.
DR   EnsemblGenomes-Tr; Isop_R0022-1.
DR   EnsemblGenomes-Tr; Isop_R0023-1.
DR   EnsemblGenomes-Tr; Isop_R0024-1.
DR   EnsemblGenomes-Tr; Isop_R0026-1.
DR   EnsemblGenomes-Tr; Isop_R0027-1.
DR   EnsemblGenomes-Tr; Isop_R0028-1.
DR   EnsemblGenomes-Tr; Isop_R0029-1.
DR   EnsemblGenomes-Tr; Isop_R0030-1.
DR   EnsemblGenomes-Tr; Isop_R0031-1.
DR   EnsemblGenomes-Tr; Isop_R0032-1.
DR   EnsemblGenomes-Tr; Isop_R0033-1.
DR   EnsemblGenomes-Tr; Isop_R0034-1.
DR   EnsemblGenomes-Tr; Isop_R0035-1.
DR   EnsemblGenomes-Tr; Isop_R0036-1.
DR   EnsemblGenomes-Tr; Isop_R0037-1.
DR   EnsemblGenomes-Tr; Isop_R0038-1.
DR   EnsemblGenomes-Tr; Isop_R0039-1.
DR   EnsemblGenomes-Tr; Isop_R0040-1.
DR   EnsemblGenomes-Tr; Isop_R0041-1.
DR   EnsemblGenomes-Tr; Isop_R0042-1.
DR   EnsemblGenomes-Tr; Isop_R0043-1.
DR   EnsemblGenomes-Tr; Isop_R0044-1.
DR   EnsemblGenomes-Tr; Isop_R0045-1.
DR   EnsemblGenomes-Tr; Isop_R0046-1.
DR   EnsemblGenomes-Tr; Isop_R0047-1.
DR   EnsemblGenomes-Tr; Isop_R0048-1.
DR   EnsemblGenomes-Tr; Isop_R0049-1.
DR   EnsemblGenomes-Tr; Isop_R0050-1.
DR   EnsemblGenomes-Tr; Isop_R0051-1.
DR   EnsemblGenomes-Tr; Isop_R0052-1.
DR   EnsemblGenomes-Tr; Isop_R0053-1.
DR   EnsemblGenomes-Tr; Isop_R0054-1.
DR   EnsemblGenomes-Tr; Isop_R0055-1.
DR   EnsemblGenomes-Tr; Isop_R0056-1.
DR   EnsemblGenomes-Tr; Isop_R0057-1.
DR   EnsemblGenomes-Tr; Isop_R0058-1.
DR   EnsemblGenomes-Tr; Isop_R0059-1.
DR   EnsemblGenomes-Tr; Isop_R0060-1.
DR   EnsemblGenomes-Tr; Isop_R0061-1.
DR   EuropePMC; PMC5352709; 28360896.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002353.
DR   SILVA-SSU; CP002353.
DR   StrainInfo; 112923; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084991
CC   Source DNA and organism available from ATCC: ATCC 43644
CC   (www.atcc.org)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Isosphaera pallida IS1B, ATCC 43644
CC   collection_date     :: Missing
CC   lat_lon             :: 44.86123 -121.201442
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: USA
CC   environment         :: Fresh water, Hot spring
CC   num_replicons       :: 2
CC   ref_biomaterial     :: ATCC 43644, DSM 9630
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02488
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 2884
CC   Funding Program     :: DOE-GEBA 2007
CC   Gene Calling Method :: IMG/ER 2.7
CC   Isolation Site      :: algal mat from Kah-nee-tah Hot Spring in
CC                          Oregon
CC   Cell Shape          :: Coccus-shaped
CC   Motility            :: Motile
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 45C
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454, Sanger
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5472964
FT                   /organism="Isosphaera pallida ATCC 43644"
FT                   /strain="ATCC 43644"
FT                   /mol_type="genomic DNA"
FT                   /country="USA:Oregon"
FT                   /lat_lon="44.86 N 121.2 W"
FT                   /isolation_source="algal mat from Kah-nee-tah hot spring"
FT                   /db_xref="taxon:575540"
FT                   /culture_collection="ATCC:43644"
FT   gene            202..1665
FT                   /locus_tag="Isop_0001"
FT   CDS_pept        202..1665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterProIPR001957: IPR020591: IPR018312:
FT                   IPR013317: IPR 013159: IPR003593; KEGG: scl:sce0001
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; SPTR:
FT                   Chromosomal replication initiator protein dnaA; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60598"
FT                   /db_xref="GOA:E8R4K7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4K7"
FT                   /protein_id="ADV60598.1"
FT                   /translation="MTPAASTLPSLPRESELRAVLAELVEPSRYALWFGEEVRLGLLDG
FT                   GETLEVQVPNEAFGHRLESRFTDSLIESARRVSGRDSRLRFRVSDALDDQSRSQPTATL
FT                   VVDPGSKSVAAPRPGMSERSASVAPQGSAALAERRGLRTFDEFVVGPCNQLAHAAALDA
FT                   ARGLGRSCGPLVLHGAVGLGKTHLLESLHHLAKRLHPSARILHLTAEAFTNRFLEAIRG
FT                   QNLGGFRARHRQADLLIVDDAHFLAAKRATQDEFLHTYNAVSSQGGLVVVAVDRHPRRL
FT                   ERMSDELRTRFLGGVVAPLTVPDQETRRALIRSKAAARGVALPEEIVALLADPPRASVR
FT                   ELEGALNVVLAEVRLTGRALSPLWVRERLGELLTAPRSSPSLATIERTVARVFGIAPEA
FT                   LRGQTRSRAVTGPRMLAMYLARRRGRASYAEIGRHFGGRNHSTVMAAEKRVSAWLLRSH
FT                   DPYRFPGFDSAAEALARLERELDGDEASG"
FT   gene            complement(1812..2672)
FT                   /locus_tag="Isop_0002"
FT   CDS_pept        complement(1812..2672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0002"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="COGs: COG0584 Glycerophosphoryl diester
FT                   phosphodiesterase; InterPro IPR004129; KEGG: plm:Plim_3666
FT                   glycerophosphoryl diester phosphodiesterase; PFAM:
FT                   glycerophosphoryl diester phosphodiesterase; SPTR:
FT                   Glycerophosphoryl diester phosphodiesterase; PFAM:
FT                   Glycerophosphoryl diester phosphodiesterase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60599"
FT                   /db_xref="GOA:E8R4K8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4K8"
FT                   /protein_id="ADV60599.1"
FT                   /translation="MNPSLLALSLFAWVPANAPAITPIPNPFDPPRKAAVEYISHRGES
FT                   ADAPENTMAAFRLAWERDVDAIELDVHLSKDDRLVVIHDADTQRTCGVSLKVKDSTYDQ
FT                   LKGLDAGSWKDAKYAGEPLPLLEQVLETIPQGKRCFIEIKVGPEAVPALVKAIETSGKK
FT                   PEQLAVISFNAETVAESKRRLPEIPAYFLSGFRRDKETGEWNITFDQLIELAKTLKADG
FT                   LDLYYQGPFDRAAVEKVKSAGLGLYVWTVDDPEAARALIDLGIDGVTTNKARWLKEQVE
FT                   AAQSK"
FT   sig_peptide     complement(2571..2672)
FT                   /locus_tag="Isop_0002"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(2869..3639)
FT                   /locus_tag="Isop_0003"
FT   CDS_pept        complement(2869..3639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0003"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG1234 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; InterPro IPR022272; KEGG:
FT                   afw:Anae109_0563 beta-lactamase domain-containing protein;
FT                   SPTR: Beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60600"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4K9"
FT                   /protein_id="ADV60600.1"
FT                   /translation="MPAPPLRLLPLGVGEAFTRLYYTFGLAVEYDGRWLLIDCPHPIRK
FT                   MIHEAGQAAGLPFDLEQVEAVLITHLHADHVSGVEDFGFFNYFALGRRARVVIHPELAG
FT                   PLWDDLLAAGMGRMRFQAGEPFEPIDRERYFETIPLEPGQRLTLGPFEVESHPTTHSLP
FT                   CQGYRVTAAGRTLAVSGDTAFDPVLLAWLTCNAHLIVHEVTTHDPPGMHTHLTQLAALP
FT                   SELRERLRLVHYPDDYDLDASPIRPLRQGVVELV"
FT   gene            complement(3869..5296)
FT                   /locus_tag="Isop_0004"
FT   CDS_pept        complement(3869..5296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0004"
FT                   /product="Protein of unknown function DUF2088"
FT                   /note="COGs: COG3875 conserved hypothetical protein;
FT                   InterPro IPR018657; KEGG: dol:Dole_2523 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2088; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2088)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60601"
FT                   /db_xref="GOA:E8R4L0"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L0"
FT                   /protein_id="ADV60601.1"
FT                   /translation="MSMSCSTPPGSSDVWPRPGFPEVLIPWGPGERLALRMPESWRLID
FT                   VTQPLLDDALASEEYEARLGRLLDDPASGWSETLATTPLGRVALVIDDPSRWTPVERAL
FT                   PVVLERLERAGVGDDSIDLVVAVGRHRPVDREAMVRRLGAELTDRLRWWSPPVDDPTAY
FT                   DDLGTIDQDLPVRLFRPVVQADLRVLIGSTLPHLQAGFGGGWKLILPGCAHRSSLAAVH
FT                   RRGIRPEDHPETLLGGDPDLNPMRQAITRAMTLLPGKTFSIGHVLGVPGQILRVEAGCP
FT                   DEVQRRLAHEARRRFQAPFRPPAEVVVVGNSPWPGDPLQSFKALIHHRAACRPGGALVG
FT                   LFWASPDELDRSLDRRSLRRLGRGGRPAAWLIRHGLGLADRLASIWKLRPAFMIHWARE
FT                   LVVDRAVFVYCPLLHQVVGPHLGPVRLFDNLEALWNAVEVHLDQAGSHFRSAVRGGVRV
FT                   RVFPQGGLTYCRPSSIV"
FT   gene            5658..6110
FT                   /locus_tag="Isop_0005"
FT   CDS_pept        5658..6110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0005"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020476: IPR020084: IPR000086; KEGG: ngr:NAEGRDRAFT_49855
FT                   hypothetical protein; PFAM: NUDIX hydrolase; SPTR:
FT                   Hydrolase, NUDIX family protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60602"
FT                   /db_xref="GOA:E8R4L1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L1"
FT                   /protein_id="ADV60602.1"
FT                   /translation="MRDPIPTWYFVLVVVRRGDQFLVVQERKHDQTWYLPAGRVEPGET
FT                   LAEAAVRETREESGVEIELEGLLAIDHTPSLWGGSRLRVIYLARPKDDRPPKAVPDQHS
FT                   LRARWVNLEELDGLPLRSDEVKVWFQWVAGGGPVHSLELIRSEGLV"
FT   gene            6513..9764
FT                   /locus_tag="Isop_0006"
FT   CDS_pept        6513..9764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0006"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ); InterProIPR011761: IPR006275:
FT                   IPR005483: IPR005479: IPR 005481: IPR005480: IPR011607;
FT                   KEGG: psl:Psta_1525 carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; MGS domain protein; SPTR:
FT                   Carbamoyl-phosphate synthase, large subunit; TIGRFAM:
FT                   carbamoyl-phosphate synthase, large subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   MGS-like domain; Carbamoyl-phosphate synthetase large
FT                   chain, oligomerisation domain; Carbamoyl-phosphate synthase
FT                   L chain, N-terminal domain; TIGRFAM: carbamoyl-phosphate
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60603"
FT                   /db_xref="GOA:E8R4L2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L2"
FT                   /protein_id="ADV60603.1"
FT                   /translation="MPKRADIESILIIGAGPIVIGQACEFDYSGTQACKALREEGFRVV
FT                   LVNSNPATIMTDPEMADRTYIEPVIPEAVADIIAVERPDAVLPTLGGQTGLNVALALAD
FT                   QGVLERYGCRMIGANAEAIRKAEDRQLFKKCMAEIGLECARSGLATSLEEARALRDEIG
FT                   LPCVLRPSFTLGGSGGGIAFNKEEFERIAAHALELSPVHSVLVEESVIGWKEYEMEVMR
FT                   DGADNAVVVCSIENFDPMGVHTGDSITVAPAQTLSDKEYQTLRDASLAILRAIGVETGG
FT                   SNVQFAVDPRTGRVLVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYRLDELRNDIT
FT                   RETPACFEPTIDYVVTKVPRWAFEKFPEADPVLTTQMKSVGEVMAIGRTFRESLQKALR
FT                   GLEVGRFGLGCDAKDPFGTPEFPTLDRIKETLSTPDANRIWTIRLALLAGMSVEQIHDL
FT                   TSIDPWFLRHFVDLIERERQLRDAGSLDRVSDELMRAAKQDGFSDRQLAHLLNTDEIVV
FT                   RRDRLARGIVPVYKQVDTCAAEFEAVTPYYYSTYELEDETRLGDRPRIVVLGGGPNRIG
FT                   QGIEFDYCCCQAAFALRADGYEVVMVNSNPETVSTDYDTSDQLFFEPLTVEDVLNICER
FT                   VKPIGLVVQFGGQTPLNLARALEAAGVPILGTSPESIDLAEDRDRFSQVLARLGLRQTP
FT                   NGSAVKVEEAARIAATIGYPVLVRPSFVLGGRAMEIVYDESSLLKYMNEAVDVSSDRPV
FT                   LIDKFLEDAVEVDVDAVRDATGVVVVAGVMEHIEEAGIHSGDSACAIPPHNLPPEIIAE
FT                   IKRQTRLLADALEVKGLMNLQFAVKDGQVYVLEANPRASRTVPFVSKATGLNLAKVAAR
FT                   VMTGRTLAELGVVDDPVPGFVSVKESVFPFAKFTGVDIVLGPEMRSTGEVMGVDRSFAA
FT                   AFAKAQMAAGTTLPRQGGTVFVSVANRDRPAIVPIARKLADLGFHLMATAGTARVLQSH
FT                   GVSVEVVRKIHEGRPNLLDHLANDRIDLIVNTPSGKGARTDEGRIRASAVSHGVPCITT
FT                   LAAARAAVSAMERLRDGGLTVYALQDLLNLSKPRT"
FT   gene            10316..11113
FT                   /locus_tag="Isop_0007"
FT   CDS_pept        10316..11113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0007"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: sit:TM1040_0284
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60604"
FT                   /db_xref="GOA:E8R4L3"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L3"
FT                   /protein_id="ADV60604.1"
FT                   /translation="MAQLSEASSSDTLTSDLADQVKGLLPTSDVSGDDDPGKQLAMLEL
FT                   AGEEVAAGFKPQSVRALSPEVQYLHISRTIHQLVTDRNRAVGTFLFVASLLVGASSAMM
FT                   NAQPTVDPIVPMSLLVRWSLPVTFGALGIIGVFMCLILIRTREGLIYEVTKMNVILGIP
FT                   SPRVTRVSPLSIFYLMHLLVALLGGVCAGAAVGLILVDRGLTGLGGLAFAAVVAMIYVA
FT                   AFLTLYVIRVRRVSLDPIVVKTLENAAHTASPLPSASANNSGA"
FT   gene            11294..11638
FT                   /locus_tag="Isop_0008"
FT   CDS_pept        11294..11638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0008"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845; KEGG: bts:Btus_0242 transcriptional
FT                   regulator, ArsR family; PFAM: regulatory protein ArsR;
FT                   SMART: regulatory protein ArsR; SPTR: Transcriptional
FT                   regulator ArsR; PFAM: Bacterial regulatory protein, arsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60605"
FT                   /db_xref="GOA:E8R4L4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L4"
FT                   /protein_id="ADV60605.1"
FT                   /translation="MFKALADPTRREILRLLAQRDMTAGELADHFAMTKPTVSHHFAVL
FT                   KRAELVTHRKRAQQVVYSLNTTVAQELLAWIYDLFKVGNPPQTAGMSNEATRGDETGIP
FT                   ASSTTFNQEE"
FT   gene            11641..12378
FT                   /locus_tag="Isop_0009"
FT   CDS_pept        11641..12378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0009"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="COGs: COG5658 integral membrane protein; InterPro
FT                   IPR012867; KEGG: tpd:Teth39_1876 hypothetical protein;
FT                   PFAM: protein of unknown function DUF1648; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1648)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60606"
FT                   /db_xref="GOA:E8R4L5"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L5"
FT                   /protein_id="ADV60606.1"
FT                   /translation="MSVDHEFDLLNASESSVRASRRVTKELKVWGGSLAVLAATWISAG
FT                   VGYLVAPEMVPIHWNIHGQADGFGSPAALFLTPAIATAMLGVFAVMPWISPRPFQVNDF
FT                   RSTFLDVVGLMTGLFAAIHALILAATFEAPIDVGRWLVGVMMVFFILIGNILGRVRRNF
FT                   YIGIRTPWTIANERVWNDTHRFGGKVFVLTGVVGLGAILLGAPVWGIFVMALIAALGPV
FT                   VYSFARYRQLERLGELDGDHAAA"
FT   sig_peptide     11641..11697
FT                   /locus_tag="Isop_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(12383..13012)
FT                   /locus_tag="Isop_0010"
FT   CDS_pept        complement(12383..13012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB6463 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60607"
FT                   /db_xref="GOA:E8R4L6"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L6"
FT                   /protein_id="ADV60607.1"
FT                   /translation="MSHQAQRHSMTSDADTTTGWKEGPSRALALGLGLGLIALGVASRL
FT                   LPHPPNFTPAASIALYAGFLFAHRWAAALTVGAMMLISDLVIGFAEPVITLSVYAMLIL
FT                   PASLRPVLRRSAQTGRWRAWGIPGPPTLAAAAVGCSLAFYAVTNFAVWTVWYDPTLAGL
FT                   IACYVNALPFLKWTLLGDLVWTGTLFASHALALRLVGARVRDAIAS"
FT   gene            13564..15414
FT                   /locus_tag="Isop_0011"
FT   CDS_pept        13564..15414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0011"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterPro
FT                   IPR005841: IPR016066: IPR005844: IPR005845; KEGG:
FT                   rba:RB6061 phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II; SPTR: Phosphomannomutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60608"
FT                   /db_xref="GOA:E8R4L7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L7"
FT                   /protein_id="ADV60608.1"
FT                   /translation="MSTSSSVAFSVSELLAQVDRAQAEGALSEAAATRIRQWLVEEPFI
FT                   PYRERLAEEITAGRWTELDNAYYTVLEFGTGGRRGRMYPVGVNVLNERTIAESAQGLAD
FT                   HVVALKGTNAPRSCAIAFDTRHHSAEFALICARVMAAAGFTVYLVSQPRSTPLLSFAVR
FT                   HLGCDAGIMITASHNPPADNGFKCYAATGGQVVPPDDKRIIELVNAASTRVIPLAEADD
FT                   PRIRRVGLELDEAYLQAVLSQSVGTARDLTIVYTPMHGVGDSAVGEALRRAGFTRVEVL
FT                   ESQRAPDGDFPNVPGHIANPEIPRTLDAAIAEAKRIGADLVLASDPDADRIGVGLPIPG
FT                   DPQGAWTTLTGNQIGALLTAFVLEKTREAGRLKPEQTIVTTLVSTGMARALADRFGVRT
FT                   EDNLLVGFKWIAVTIDRIGPDNLLFAFEESHGYQKGGHVRDKDAATASLLFAELAADLK
FT                   AKGSHVLEYLNELYRQVGHYGETQINKVMEGRAGAQAIRNLMTAFRNDPPRSVGGLQVV
FT                   EVADYHAHEIRPIRDGGPARPLPEPSGDLLIFHLDAPGVRFAVRPSGTEPKIKFYLFAR
FT                   SEVQGDWPQALAAAKERTASLLAAMGRDLDAYVAQAVRDE"
FT   sig_peptide     13564..13632
FT                   /locus_tag="Isop_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            15667..16851
FT                   /locus_tag="Isop_0012"
FT   CDS_pept        15667..16851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0012"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG3380 NAD/FAD-dependent oxidoreductase;
FT                   InterPro IPR006076; KEGG: caa:Caka_1904 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; PFAM: FAD dependent oxidoreductase; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60609"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L8"
FT                   /protein_id="ADV60609.1"
FT                   /translation="MNTSENPTLESSRSTEEPFDVVIVGAGVAGLTLASRLREDAKAHG
FT                   RPVPRVVVLDKGRSVGGRMGTRRLEWPEGGEPARFDHGPPGFSVITAAFRKLVERAEAA
FT                   GAVLPHPKGQRLHWRGREGVRSFAAFLAEGVEVRSSTIVTAVRPDLADPSLWSLATTPA
FT                   APGLKAPDISSAPLDPTAPVTTLRARAVVLTCPVPQALAILEAGGVALASDLRADLAVV
FT                   SYERSWVALATFNEQDGQRLADLGPEGLVVVPEELPHKLIDHRARGVSPRPAYSIQAGA
FT                   NWSMTHWDDPADQVAPTLFQAARPWLGGSEEEVKPVHLEAHRWKFARVTVGFPRTERYA
FT                   TLNDAPPLLMAGDAFRGGAQAGPDGRSRDPETIYGVEAAWLSGQAAAAALEGRV"
FT   sig_peptide     15667..15795
FT                   /locus_tag="Isop_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            16921..17715
FT                   /locus_tag="Isop_0013"
FT   CDS_pept        16921..17715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0013"
FT                   /product="5'-nucleotidase; exopolyphosphatase;
FT                   3'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.6.1.11"
FT                   /note="COGs: COG0496 acid phosphatase; InterPro IPR002828;
FT                   KEGG: psl:Psta_2815 stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE; SPTR: 5'-nucleotidase surE;
FT                   TIGRFAM: stationary-phase survival protein SurE; PFAM:
FT                   Survival protein SurE; TIGRFAM: 5'/3'-nucleotidase SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60610"
FT                   /db_xref="GOA:E8R4L9"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4L9"
FT                   /protein_id="ADV60610.1"
FT                   /translation="MLILLTNDDGVFAPGLRALRKELLKLGKVVVVAPAQEQSGVGHSI
FT                   TLHSPLVVKPIDDDDGSDLGHMVEGSPADCVKLAILELLDRPPDLIVSGINAGSNAGIN
FT                   VLYSGTVAAAIEGAFFKITSVAISLESAEHFDYPHAARHAAKVIERIMANRPEPGSLFN
FT                   VNLPAHVRGEPRGVKVVPMGLGRYGEGFERRRDPRGRTYYWMTYKPPFHLEGTESDVSA
FT                   LTQGYITVTPLHFDLTRAEALEPLTRWDWSGVGATRDGSPGR"
FT   gene            17919..18572
FT                   /locus_tag="Isop_0014"
FT   CDS_pept        17919..18572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_2816 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60611"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M0"
FT                   /protein_id="ADV60611.1"
FT                   /translation="MISHPSPICRPGRFPTASSLTLSLIVAGFGCGGVKYDSPPPSSST
FT                   TSAPAAPPSTAPAKPDPNRPALTQRRTDDVRESQAEQERGARVMQPGEARGKSAIGNVY
FT                   VTSVSRIAELSIQARLETFNAIEGRYPESHEEFMEKVIRGADPIALPALPPNQKYAYNV
FT                   AEHKLEILVYPEGVDPNATAPVPDAPTAPAANTPPPPPLGGGRNPLGLDLPGGS"
FT   sig_peptide     17919..18092
FT                   /locus_tag="Isop_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            19080..20756
FT                   /locus_tag="Isop_0015"
FT   CDS_pept        19080..20756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6296 glycosyl transferase family 2;
FT                   SPTR: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60612"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M1"
FT                   /protein_id="ADV60612.1"
FT                   /translation="MTTPSASIPSRTSEAEPTDDASSISLSRDADFEKRIRILEERIRD
FT                   LREENARLRRQWDETTQAISWRIINMLSRPARRLAPLGSRRRRVLRSACNLAARARRAL
FT                   TPIVRVPRHALTISRGAAWTIRRLAERPRPFVADDRPVFLFVSHVGGGGVSRHIQDMAD
FT                   RLRLEGVRVVVARPNPQGRLVFEELEQAGAIAWRVEVRPCRPIIKAYLDAIQPVFVHVH
FT                   HRLGVPETLFKALDARGLPTDWTLHDYHALCPRVHLHDDRGEYCGQPDPEGCRTCLKSR
FT                   GDYHGRRVNPDVVAHRHAWRACLQAARRIYVPSEDMKRRLQREFPDLDMTVHPHLEPSL
FT                   PRSHMARRWRDGEPVRVAVLGVITLVKGLNRLLEAAHDAWTRALPLTFVVIGTADRSEE
FT                   LLATGHVEITGRYRESEIETLLDEAKCHLAWLPSTLPETYMYTLSIAQAAGFRPVVYDL
FT                   GAQAERVGTAGRRVPLETSAATLNDCLLQWAALDAQLGPLEPPRFADYPSLLRDYYELS
FT                   PANLKASRSEIFPVTRRRIHGVASAPVLLRKTDARLHQRHR"
FT   gene            20728..21888
FT                   /locus_tag="Isop_0016"
FT   CDS_pept        20728..21888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA1583 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60613"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M2"
FT                   /protein_id="ADV60613.1"
FT                   /translation="MHAFTSVTANYLPKAAVLARTLKRTNPEVTFHLLISDDLPDDCPK
FT                   AILESFDSIVTIWDLPLTNLDSWTFKHSVVELCTAVKGPMVEYLFDRVGAERVYYFDPD
FT                   MVVVGSLAELNARLSQHAVVLTPHQTVPETSLQAIVDNEICSLAHGVYNLGFLGVRRTE
FT                   EGLKFVRWWADRLRLFCHDDIPRGLFTDQRWVDLAPAFFDGIGVLRDPGYNVATWNLST
FT                   RRATGQSPWNIQINGRPLVFYHFSGLDSGAQLTMLERYGRESPVLFELRDWYLAECESY
FT                   GQSLLGNRTSRWGCYDNGEPITHEQRVVYRNRLDLQQAFPNPYRTQPVSKSYFHWFAAN
FT                   HRKMILRRDKPEPAIRTMIRRHSHRPPLKWAKKAWHALRTSPPPTI"
FT   gene            complement(22106..22333)
FT                   /locus_tag="Isop_0017"
FT   CDS_pept        complement(22106..22333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_0866 8-amino-7-oxononanoate
FT                   synthase; SPTR: Putative 8-amino-7-oxononanoate
FT                   synthase/2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60614"
FT                   /db_xref="GOA:E8R4M3"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M3"
FT                   /protein_id="ADV60614.1"
FT                   /translation="MSRPRSQGASKPARGAVRGASSRRAQPAAQTRKVGVPQAQSDIYT
FT                   ALLGISMAAMTIGCALLIFYWSGYEFKTTP"
FT   sig_peptide     complement(22259..22333)
FT                   /locus_tag="Isop_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(22302..23156)
FT                   /locus_tag="Isop_0018"
FT   CDS_pept        complement(22302..23156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_0750 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60615"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M4"
FT                   /protein_id="ADV60615.1"
FT                   /translation="MNFVGKILVLVILVFSILFASLASVVFATAKNHRVELTKQRDQFN
FT                   RDLAAIRAERDRLTQDLSNAESDRVNLAQEVQKLKEQLETIGNTITAIEDDRKAARTEL
FT                   EVVNRALEAAQSEAAFRLREMEVLSVNLKKSQDDANALKIEQTNLNAKIAELTRELATA
FT                   KAQNATLREDNAAYAAWMRSKGFNDDIATIRGVSAPPKVEGIVLRVDSSNKRLEISIGS
FT                   DVGLVPDHELFVYRTSPPEFLGKIRIVETDPDRSAAVVVGKTYQGKLLQEGDIVSATLP
FT                   RGF"
FT   sig_peptide     complement(23073..23156)
FT                   /locus_tag="Isop_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(23306..23869)
FT                   /locus_tag="Isop_0019"
FT   CDS_pept        complement(23306..23869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_069880 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60616"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M5"
FT                   /protein_id="ADV60616.1"
FT                   /translation="MTTKLGKVFVVLITTLSLYLLGLAIAVVAIPSKWDARIAEVNKSI
FT                   NELRQEKVKYEERTLFQNARAEQAKKKLADLQTAYETQIKQLDTDATKVSRDIESARKS
FT                   LAEVRVRTNELLEQTRETANQVDDAIDNLRAIRLQTREYDQQNQLLNDRIVNLRRQVEV
FT                   VSKNEADLRRLSSASGSVVTAVNE"
FT   sig_peptide     complement(23783..23869)
FT                   /locus_tag="Isop_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(24340..25377)
FT                   /locus_tag="Isop_0020"
FT   CDS_pept        complement(24340..25377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0020"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR005982: IPR000103: IPR013027: IPR008255; KEGG:
FT                   acp:A2cp1_4094 thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; SPTR:
FT                   Thioredoxin reductase; TIGRFAM: thioredoxin reductase;
FT                   PFAM: Pyridine nucleotide-disulphide oxidoreductase;
FT                   TIGRFAM: thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60617"
FT                   /db_xref="GOA:E8R4M6"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M6"
FT                   /protein_id="ADV60617.1"
FT                   /translation="MPHSSVIIIGAGCAGLTSALYTARANLSPIVLDGFKPRGRVPGGQ
FT                   LMWTTDVENYPGFPQGVQGPELIELMRRQAERFGARFHHDNVVKIDLSRRPFHLVAKPD
FT                   LEKRESVEYTCDGLIIAGGADARLLDLPHEMTFMGHGLSTCATCDGALYRGKVVGVVGG
FT                   GDTAVEEATFLTRFASKVFLIHRRHELRASKIMQQRLLTNPKIEPLWNRTVAEYLGDHE
FT                   PEAQLKAVRLASTTGEPDVTLELDGLFLAIGHSPNTDIYQGQVAMTPEGYLLNRLALCW
FT                   KGVEAPAGLLDSMPNYGTATSVEGVFAAGDVVDTHYRQAVTAAGMGCMAAIDCEKWLEA
FT                   TRPHA"
FT   sig_peptide     complement(25303..25377)
FT                   /locus_tag="Isop_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            25427..26134
FT                   /locus_tag="Isop_0021"
FT   CDS_pept        25427..26134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0021"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="COGs: COG1551 Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing); InterPro IPR003751;
FT                   KEGG: nam:NAMH_0494 carbon storage regulator; PFAM: carbon
FT                   storage regulator; SPTR: Carbon storage regulator homolog;
FT                   PFAM: Global regulator protein family; TIGRFAM: carbon
FT                   storage regulator (csrA)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60618"
FT                   /db_xref="GOA:E8R4M7"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M7"
FT                   /protein_id="ADV60618.1"
FT                   /translation="MAQTLGFSKGRVVNPRRPQRQRGGNWSRCPGVGTDWWVMVRRGRG
FT                   SCSMLRSPGGTPWGVSTNAGVWGWTKPDGRSGSPSEPMIRGPRRGGQPIARPSRRSIPI
FT                   RAAPLRFAAIRVTTSTSDRPGSLVRGCDPTESWNGTRGAARMLVLSRKLMEKVYIGDDI
FT                   CVTVVRLENGQVRLGIDAPRHIPVVRAELQDQTRNRRGGTPARASAHPTSSHPHSHHHT
FT                   PPQGLKTASTSSR"
FT   gene            complement(26377..27087)
FT                   /locus_tag="Isop_0022"
FT   CDS_pept        complement(26377..27087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0022"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: psl:Psta_2596
FT                   two component transcriptional regulator, winged helix
FT                   family; PFAM: response regulator receiver; transcriptional
FT                   regulator domain-containing protein; SMART: response
FT                   regulator receiver; SPTR: Phosphate regulon response
FT                   regulator PhoB; PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60619"
FT                   /db_xref="GOA:E8R4M8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M8"
FT                   /protein_id="ADV60619.1"
FT                   /translation="MSKPRILVIDDERSLVEVLAINLEREGFEVMTAFDGQDGLRQAQV
FT                   KLPDLIVLDLMLPVKPGLEVCRELRADSRTRDVPVIMLTAKTEETDELVGFAMGADDYV
FT                   SKPYRMKVLIQRIKTQLNRRRQTEDAKNGDLVVERHGVVIDRHRHRALCNNEELLLTPT
FT                   EFRLLEALMRQAGRAFTRHELMDAAMGEDAVVLERTIDVHIKSLRKKLNHSADLIETVR
FT                   GVGYRFRETGLAES"
FT   gene            complement(27063..27224)
FT                   /locus_tag="Isop_0023"
FT   CDS_pept        complement(27063..27224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60620"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4M9"
FT                   /protein_id="ADV60620.1"
FT                   /translation="MVGCMMVSKKDNVASSLPPTDGLAVTTHRRRPSRRVRPFVWNRVE
FT                   PCPSRASW"
FT   gene            complement(27347..28240)
FT                   /locus_tag="Isop_0024"
FT   CDS_pept        complement(27347..28240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0024"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /EC_number="3.6.3.27"
FT                   /note="COGs: COG1117 ABC-type phosphate transport system
FT                   ATPase component; InterPro IPR003439: IPR015850: IPR003593;
FT                   KEGG: tkm:TK90_0954 phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Phosphate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60621"
FT                   /db_xref="GOA:E8R4N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N0"
FT                   /protein_id="ADV60621.1"
FT                   /translation="MPSFNSESVAASSPSGLNAAPPASASSRPRSDSPVWSSLLTTHRV
FT                   RIWHGRHLVVRDVNLAIPRERITALIGPSGCGKSTLLRAFNRLTDLTPLLRVEGTIQLE
FT                   GRDIHDPTIRVDELRRRVGMIFPQPQPFSKSIFENVAWAIRLKGPVEHLEEKVEIALRR
FT                   ARLWDEVKDKLQSPAQALPPGPSQRLCLARALAVEPEALLLDEPCASLDPGATAQLEEA
FT                   LMDLKFKDGMTMVIVTHNLAQAKRISDLTACLALDDASPDPTRPTGLLVEAAATETIFT
FT                   TPRDPRTEAYITGRVG"
FT   sig_peptide     complement(28166..28240)
FT                   /locus_tag="Isop_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            28641..29378
FT                   /locus_tag="Isop_0025"
FT   CDS_pept        28641..29378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0025"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: mmi:MMAR_2311
FT                   glycosyl transferase; PFAM: glycosyl transferase family 2;
FT                   SPTR: Glycosyl transferase; PFAM: Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60622"
FT                   /db_xref="GOA:E8R4N1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N1"
FT                   /protein_id="ADV60622.1"
FT                   /translation="MDEPLSVVIPVYHEGDNVLEVYQRFVAEAGPFGEMIFVWDTPDDP
FT                   TIPFLDQLRAADPRVVSLHNTLGRGVLNALRAGIAAARGRAILVAMGDLSDELSIVPQL
FT                   MAHWREGATVVCPSRYMPGGRQEGAPWLKSLLSRLAGLSLYAIGALPVRDPTNNFKLYD
FT                   AAFLKSVTIESGRGFELALELTVKAHELGGKVVETPTHWRERSQGQSRFKLIQWLPGYL
FT                   KWYFRAVGNRLRPGRRALISQED"
FT   gene            complement(29576..30886)
FT                   /locus_tag="Isop_0026"
FT   CDS_pept        complement(29576..30886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0026"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="COGs: COG4102 conserved hypothetical protein;
FT                   InterPro IPR001295: IPR010869; KEGG: psl:Psta_4282 protein
FT                   of unknown function DUF1501; PFAM: protein of unknown
FT                   function DUF1501; SPTR: Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1501)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60623"
FT                   /db_xref="GOA:E8R4N2"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N2"
FT                   /protein_id="ADV60623.1"
FT                   /translation="MASHRFCDGVVRRDFLKIGAVGSLVSLPQFLRLSHAGAVGSGPDQ
FT                   RGRAQAAIFVNLGGGPSHLDTFDLKPEGPSEIRGEFKPIETTASGMAICEYLPKLAQVA
FT                   QFFSIVRGVSHSLAAHELGTKYLNTGNRPLPSLEFPGYGAVVSKELGSPDDLPPFVAIP
FT                   NTPQVAGYLGIRYAPLSTTSTPRPGQPFRVRGIGLGQGLTVSEIEKRHDLLRRLDRTFD
FT                   AIENDSDLIGGLDEFSRRAYEIIRSPRSREAFDISKESPAISGLFGTTPFSQSCLLATR
FT                   LIESGVRFVTVSLGGWDTHQNNFPKLKDTLLPDLDHGLAGLFSALAAKGLWETTTVFVT
FT                   GEFGRTPKINARGGRDHYPRAMTCLMGGGGIAGGRVVGASDASGAGPADGKGYAPDDLA
FT                   ATFYHTLGIDPAKEYQTPTGRPVAIVRNGSIIKDLLA"
FT   sig_peptide     complement(30734..30886)
FT                   /locus_tag="Isop_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(31088..34000)
FT                   /locus_tag="Isop_0027"
FT   CDS_pept        complement(31088..34000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0027"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="InterPro IPR003343: IPR011444; KEGG: plm:Plim_4094
FT                   protein of unknown function DUF1549; PFAM: protein of
FT                   unknown function DUF1549; Ig domain protein group 2 domain
FT                   protein; SMART: Ig domain protein group 2 domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: Bacterial
FT                   Ig-like domain (group 2); Protein of unknown function
FT                   (DUF1549); Protein of unknown function (DUF1553)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60624"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N3"
FT                   /protein_id="ADV60624.1"
FT                   /translation="MIRRHAVQLGGVLAGPLILLAWISAAVAPTPPIRAANPSQPWTQE
FT                   ASLEAAELAPASQRFTTLEPGDGELVEVPDFQKHVLPLMGQLGCNGRSCHGSFQGAGGF
FT                   QLSLFGYDFKKDHAALMAKESGRVNLDDPEGSKILLKPTLQMPHKGGQRMEIDSWQYNL
FT                   LVRWIEAGAPSASEAARFEHLEVTPRELRFNHVGQTAQLKVVAHWSDGTIEDVTCLSRF
FT                   RTNDESIAEIDEYGLVTAKAPGDTHVVAFYDNGVTPIPVLIPVSDQVGPRYPEVPTPTQ
FT                   IDALVVDKLRKLGIVPSGICDDAEFLRRVSLDLTGTLPIPEEVSSFLADDRPNKRALKI
FT                   EELLERPTYSAYWAMKLCDFTGNAERHFQGTINPRLTAQHWYEWIERRLRENMPYDKIV
FT                   EGIVLARGREPGESYADYAARESSYYRPNPADQADFTERDTMPYYWARRNARTPDDKAL
FT                   SFSHAFLGIRLECAQCHKHPFDQWTQADFQQFTQFFAGVRYGKPREYTQMLNDLTKTHP
FT                   QLKGKNNNQLNRELAGLLRNGETVPLEELIVTPPRRPNTKGQAQPRRQGGRVATPKLLG
FT                   GDEVDVTSEADLREPLMEWLRSPENPYFARALINRVWANHFHVGIVNPPDDMNLANPPS
FT                   NEPLLDYLVGQFISSGFDLKALHREILNSDTYQRSWEVNPTNRLDERNFSRAVIRRLPA
FT                   EVVLDAVKQVTANSASLAQAGSWIGDRAIGPMGNSRVQRESYAATVFGENKRDTNCDCA
FT                   RSNEPNLLQAIFLQNDDRELLAVLDRRDGWLAELQGRGGPAPEARQPRKPDTELKNPNK
FT                   VEERLAKAQTKAAAQEGKGDGTDLQRQLAETRARLVEVQQRLRALSGNAAAATKGQRRQ
FT                   RLQAQIGELQRRIVALQTQARRQRETNQVNDPAKVKAVASGFDLEEVVHEAYLRTLSRL
FT                   PRPEELAAARDYIASSETPIDGVRDLLWALINTKEFVTNH"
FT   sig_peptide     complement(33896..34000)
FT                   /locus_tag="Isop_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(34101..35036)
FT                   /locus_tag="Isop_0028"
FT   CDS_pept        complement(34101..35036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_4284 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60625"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N4"
FT                   /protein_id="ADV60625.1"
FT                   /translation="MVMRHRLRLRQHRPELPRMRRVRSRWSERLAAATASLVLTIHSAW
FT                   FAAAVPTRLIRDDPPSLPNADTKGQSAKTDRRPAAGTGAAKRPTNPATGARNPGLFTPE
FT                   REAAGLAFAKRHHPELLALLGPLAAMNRAAYEDAILELFTVSERLAAWQTRDPARHAIM
FT                   LELWIVQSKIDLLRAKLLQSPSPDQAEPLRRELRVLLDRQIEAELNRQRLDRAQVEARL
FT                   RKLEEGIARLERDRAKLVENRLKRLMSLGEAAQRARPPENGPPPKRAAEATPSPSSPPT
FT                   NRLPQPDQPPTPPTDGQRHAQIDVIKDRQN"
FT   sig_peptide     complement(34890..35036)
FT                   /locus_tag="Isop_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(35037..35903)
FT                   /locus_tag="Isop_0029"
FT   CDS_pept        complement(35037..35903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_00190 serine/threonine protein
FT                   kinase; SPTR: Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60626"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N5"
FT                   /protein_id="ADV60626.1"
FT                   /translation="MTPDTFAPSSRSQPDPPAPDATGSGDRLDDWDWWAVRYRLDELDP
FT                   DQCLVFEAALEGSQEARDALAAAAALIDTLEQALNAESTAGLRRLIGPQPQSPLSTRSS
FT                   SRLGTRTTANRGRRPLWKAGPWSLAAAALLALGVGLVRNLPPSRHNSTQPPPTAYADDE
FT                   RLMALATSWSQLRDESDSEAISDPDLDDPVPRSSATDFDLHAVAMFEEASLDDELDLGL
FT                   GASLAWASFNRNDEPTAAPPSWILEATALTELNESGPSGVPSDSSPNPTSTSPADTALD
FT                   DPTTTEV"
FT   gene            complement(35900..36481)
FT                   /locus_tag="Isop_0030"
FT   CDS_pept        complement(35900..36481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0030"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284: IPR007627: IPR013249; KEGG: psl:Psta_4286 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; SPTR:
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60627"
FT                   /db_xref="GOA:E8R4N6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N6"
FT                   /protein_id="ADV60627.1"
FT                   /translation="MVVHNDVPPLPERDSASPPLDAETVEALFRNHAQALRWFIRGIVR
FT                   DPETAEDVLQTTFTRLIEHGGPDQTDPASRKSWLFQVAHHEAIAQKRKGRLRERANRDA
FT                   RLVRAADSGNQDTAEDHLQRAETIARVRQAVEALPPAQRDVVLRRLAGRETFAAIAQAD
FT                   GLPLGTVLTRMRLALGRLRSLLDSHRDPSP"
FT   gene            complement(36677..38665)
FT                   /locus_tag="Isop_0031"
FT   CDS_pept        complement(36677..38665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2006 hypothetical protein; SPTR:
FT                   Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60628"
FT                   /db_xref="GOA:E8R4N7"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N7"
FT                   /protein_id="ADV60628.1"
FT                   /translation="MSEPTQLQELPRPTRAFLAWWFRVSLGSALAALAGAMLAVWPHWV
FT                   CSQQPLPDWIDAEAEASAPVSRGSGDPRWIADQDELYYLAVGGRSLRGVPGDPALPPDR
FT                   LGRVPYKSTALDPGVTLARWFGLTADHLGIVWRLQGGATAGIGWFLVFHTILGPRRFRS
FT                   TSALALTVILLADVGVLDYRPLIENWLSLLPTEESPPNPNPPRPMTNFRLATPGLTQGF
FT                   LALFIAFAIRTRSHMAADETLHPPFWATVSAGLFMGLLFHVYFYYWTAVFSTLLVMAVC
FT                   DWRGRTAYLGILLLGLTVGAGSILKDAIYYNQFPDDWLARTDKFLVVNRTEDLHLSKGA
FT                   SAMVLLGWVGLITARRRGWSETWLAGLTLTWALGTTGWLLVKQQLLTGIEIENFHWKYV
FT                   AGPGLMVFWLGGLTLALGRERPAAIAALLGLLAVLQFALALNVRRAEALGPNESVELRA
FT                   WLRAMDALDDRTLPTASPLAGPEKPVSIACLKRGAVPVANYWTRLSPAFDDLTWHRRIA
FT                   LNAAVQGQSRDEFVRDQVAEFNRIDGFGGPWRRDPAARAWAIRTRLEAFDDITANPTDW
FT                   ITPDQVTHVLMPIDRTPLTPDTPDFPGWVRLLRLQPEGYTPLDLWALRPAAATLADQAS
FT                   PSSPTVSDRTSATLADQTQKVTRPLRE"
FT   sig_peptide     complement(38573..38665)
FT                   /locus_tag="Isop_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(38680..38826)
FT                   /locus_tag="Isop_0032"
FT   CDS_pept        complement(38680..38826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0032"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60629"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N8"
FT                   /protein_id="ADV60629.1"
FT                   /translation="MIDGTRRFRDGGGEGFPSLPTSIGLQRFGNGWMFFAASKPVATLP
FT                   FRP"
FT   gene            complement(38882..39373)
FT                   /locus_tag="Isop_0033"
FT   CDS_pept        complement(38882..39373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0033"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro IPR017936:
FT                   IPR000866; KEGG: aac:Aaci_1040 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; PRIAM: Peroxiredoxin; SPTR: Alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60630"
FT                   /db_xref="GOA:E8R4N9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4N9"
FT                   /protein_id="ADV60630.1"
FT                   /translation="MSEPVAPPVVKLEAGQPAPLFTLTDQEGQEVRLESFRGRPVVLYF
FT                   YPKDDTPGCTTEACGFRDARADYEAAGAVVLGVSPDDVESHRKFAAKHGLNFTLLADPD
FT                   KVVCQAYGVWKEKTMYGRKSWGVERTTFVIDRNGQIVTIFPRVKVDGHVEAVLKVIQSL
FT                   "
FT   gene            39719..39823
FT                   /locus_tag="Isop_0034"
FT   CDS_pept        39719..39823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60631"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P0"
FT                   /protein_id="ADV60631.1"
FT                   /translation="MKENSLKAVAVPLQPSAFPRVSVPPQNALVERST"
FT   sig_peptide     39719..39802
FT                   /locus_tag="Isop_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            39866..42094
FT                   /locus_tag="Isop_0035"
FT   CDS_pept        39866..42094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0035"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002035; KEGG: psl:Psta_3985 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60632"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P1"
FT                   /protein_id="ADV60632.1"
FT                   /translation="MSLHPPDSAVMARAAGSDANASPVPALPVDPAPMCRTASQNGGRT
FT                   KISRVDHNRSAEPRRGSALVVEPSALPEGDLGDVVGSSTDRGRRTSEGIKLGVTLDPED
FT                   NPAATANVPSPPPATKARPETESDEAPPVISRLDLKVLAFSALIHIALLLATGLLVVHT
FT                   ADVELPIQLTSTNTDTIVPETDRLELESLTTEAVGGLDAIAAGSFAPAVGAPAQVANPV
FT                   VEQAARMPNPNVEIADIPLPRAEESNLMLNVQGSGAEHVGGAEGAVDRVAMEILRRLER
FT                   GPVLVVWALDASGSLYEERQRLSKYIGQVYQDVLKLDNEELSAGDNLLTAAVAFGRDRK
FT                   VLIETPSRDLSRIREAIENVPLDKTGIESTFTTVAEIARYFGRFKRNDTRYQTLCVILT
FT                   DEVGDDEERLDLAIQAARDAAMPVYVLGSAALFGQVLGMVPYTDPESGQHYPALPVRQG
FT                   PESIRNEMINLPFWNRGQDALHLDSGFGPYALSRLCGATGGIYFITRLGATKVQFDPAR
FT                   MREYKPDWVSIPEYEVMLAKNPLRMAVVQAAQITQQRLPGRPSLTFPPTGTDAFNTAMR
FT                   ENQFRADRTRITVDEALEPILKVAKLRDREPSKRWQAHYDLARGRLMAMKIRCFEYNSA
FT                   CARMKIDPLKFKNPNSNAWRLVPDNQVRFSDQAAKAAEQARELLKRVETEHAGTPWAYL
FT                   ARLELEEPLGFRWEETYVEPPQRNDNPPNRKNTPKKAEMARPPEPPKI"
FT   gene            complement(42258..43664)
FT                   /locus_tag="Isop_0036"
FT   CDS_pept        complement(42258..43664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0036"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /note="COGs: COG2262 GTPase; InterPro IPR016496: IPR005225:
FT                   IPR006073: IPR002917; KEGG: psl:Psta_3580 GTP-binding
FT                   proten HflX; PFAM: GTP-binding protein HSR1-related; SPTR:
FT                   GTP-binding proten HflX; TIGRFAM: GTP-binding proten HflX;
FT                   small GTP-binding protein; PFAM: GTPase of unknown
FT                   function; TIGRFAM: GTP-binding protein HflX; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60633"
FT                   /db_xref="GOA:E8R4P2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P2"
FT                   /protein_id="ADV60633.1"
FT                   /translation="MAELKSTQPRNRRERAILVGVLLPDGQYNPDDPLDEIRGLAETAG
FT                   LVVLAGLLQNRREVDPATYIGSGKVAELKELVEAHEADLVLFDNDLGPAQTRNLEQQLK
FT                   VKVIDRTEVILDIFATRARTYEARLQVELAQLEYAMPRLKRMWTHLSRYKGGVGVRGPG
FT                   EKQLEEDRRLVAKRIQDLKAKLAVVQARKEREVAARTEVPTVSLVGYTNAGKSTLMNAL
FT                   TGAGVYTADQLFATLDTRTRQWHFKGGGHVLLSDTVGFIRNLPHSLVASFKATLEEARQ
FT                   ADVLLHVVDASSHEAERQIEAVEAVLHELALSDVPTLLVLNKCDRVRDQDSLAILRARH
FT                   PEVVEISAATGTGLAELEAAVRAKLNETALDVEIHTHAGDGKVLAYLAQHAHIHSQDYS
FT                   NTDDLHVRLLCRLPRKCLGFLSEQGVNLHITTLVDQTPMREDQKEMISKRRDLSNSNPL
FT                   GLSLTWTATA"
FT   gene            complement(43782..44765)
FT                   /locus_tag="Isop_0037"
FT   CDS_pept        complement(43782..44765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0037"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR014780: IPR002501; KEGG: sti:Sthe_1260 tRNA
FT                   pseudouridine synthase B; PFAM: pseudouridylate synthase
FT                   TruB domain protein; SPTR: TRNA pseudouridine synthase B;
FT                   TIGRFAM: tRNA pseudouridine synthase B; PFAM: TruB family
FT                   pseudouridylate synthase (N terminal domain); TIGRFAM: tRNA
FT                   pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60634"
FT                   /db_xref="GOA:E8R4P3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P3"
FT                   /protein_id="ADV60634.1"
FT                   /translation="MKPFSSSLHGFLNLAKPPGWTSREVVDFVVRLFPRRSAPKVGHAG
FT                   TLDPLATGVLVVAVGEATKLIDRVQAQTKVYTATIRLGADSDTLDAAGVVVERDPAGLV
FT                   PPSVEQIENALQEQVGTIQQVPPAHSALKVGGRRAYELARAGETVELAARPVRIDAIRL
FT                   TGYQWPRVEIEIECGAGTYIRSIARDLGQTLGTGGIIEVLTRTRIGRFRLEEAHAPSDL
FT                   SLNRLEEVLIAPLEAMIGRPRVRLTEEQMDAILQGKRLDASVVAWASPPAINDQGEVAL
FT                   VAPESRGGDLVALAEPLGHSGIVWLQPRRVLATNANPTDFRGVQGM"
FT   sig_peptide     complement(44634..44765)
FT                   /locus_tag="Isop_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            44915..46510
FT                   /locus_tag="Isop_0038"
FT   CDS_pept        44915..46510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2251 hypothetical protein; SPTR:
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60635"
FT                   /db_xref="GOA:E8R4P4"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P4"
FT                   /protein_id="ADV60635.1"
FT                   /translation="MTPTINPMPSSIKTAAPWGWFGGIVTALVSLRAAMWAVGAWAAIG
FT                   LPLESFHLEAKMVHHARRVQLGKELYPAWDRSPSLPNFFGPVHPMLVGGLARVVNADLP
FT                   AVFTIGRVVSVAATVLAALGIGWFVGRIEGRGKRLGLVAGLATLGGVPLVGFSTMTRCD
FT                   LLADTLGILGFGLAGWAVGRPWLSSPSVGSDNHPNEQRSASPGLVAASVVLAAAILTKQ
FT                   TSGIYLIAAVVGLVWAGRRREAIALSLGTLGLTALVVAALSLTVTPRLAASLLGESSAP
FT                   WSLSHWARVVGRLVRNGPELLILPALGFGLWARSGQPLKASLAIVTLAVSLAASAKIGS
FT                   DQNYFLGLRLVAALALVEVMILAPTYRGRTVLRVLALGSLLPSLALQFGATSQSWQTRS
FT                   FFDSVAGRVALEPYAALFRQASDRSAPPFLTDSGLLSLYQDEVGRAWFVDPWLYRLMVV
FT                   TGRTDPGALVEAVEARRFERLVLTSDLFSDLYDTYEFGLPPQVVAAARRHYRLVGRVAD
FT                   LFLYELNPLPLSSS"
FT   sig_peptide     44915..45040
FT                   /locus_tag="Isop_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            46564..47445
FT                   /locus_tag="Isop_0039"
FT   CDS_pept        46564..47445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0039"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COGs: COG0253 Diaminopimelate epimerase; InterPro
FT                   IPR001653: IPR018510; KEGG: plm:Plim_0185 diaminopimelate
FT                   epimerase; PFAM: diaminopimelate epimerase; PRIAM:
FT                   Diaminopimelate epimerase; SPTR: Diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: Diaminopimelate
FT                   epimerase; TIGRFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60636"
FT                   /db_xref="GOA:E8R4P5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P5"
FT                   /protein_id="ADV60636.1"
FT                   /translation="MALRFVKMHGIGNDYIYISGFDQPIPDDPSALAVRIADRHFGVGG
FT                   DGLILVLPPEPGSEADAVMRMFNADGSEGGMCGNGIRCVAKFLYDSGYVRAPRIRVKTK
FT                   GAGVLSLDLEIDPASDRVRRVRVEMGAPILRASAIPTTLPGDPPLDYPIAVTYDGKTIT
FT                   YRGTAVSMGNPHLVMFVEDVASIDLERIGPLLERHEAFPDRVNVHVAQVDAPDVARMRT
FT                   WERGSGITLACGTGACAVLVAGVLTGRTARAARIHLPGGALDLEWPRDGETVIMTGPAV
FT                   TVFEGVWDESRV"
FT   gene            47429..47866
FT                   /locus_tag="Isop_0040"
FT   CDS_pept        47429..47866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_00620 malate dehydrogenase; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60637"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P6"
FT                   /protein_id="ADV60637.1"
FT                   /translation="MSRASDRIALLLDCRSDQSIKTTCLLPGASRLVFITTRHHQVGVM
FT                   RGGVGVADLPFDEQAGMDPNRAEPRRLLWGTGIPSRHDRQVGAGLRAGLFAGGRPSIAE
FT                   RRLIDAARIPNRKADEWLAAAVLLDPNLVESSDRNAPQESR"
FT   gene            complement(47851..48075)
FT                   /locus_tag="Isop_0041"
FT   CDS_pept        complement(47851..48075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60638"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P7"
FT                   /protein_id="ADV60638.1"
FT                   /translation="MELGTLLLVDLISVNHSTELGSRRQWGFAGVTNAQFFFNSLSPSN
FT                   PVRLAVASQEEMGARVGSRVRGGLGQRDS"
FT   gene            48410..53644
FT                   /locus_tag="Isop_0042"
FT   CDS_pept        48410..53644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0042"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="COGs: COG2319 FOG: WD40 repeat; InterProIPR019782:
FT                   IPR017986: IPR009056: IPR019781: IPR 003343: IPR011444:
FT                   IPR001680; KEGG: plm:Plim_1151 protein of unknown function
FT                   DUF1549; PFAM: protein of unknown function DUF1549; WD40
FT                   repeat, subgroup; Ig domain protein group 2 domain protein;
FT                   SMART: Ig domain protein group 2 domain protein; WD-40
FT                   repeat-containing protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: WD domain, G-beta repeat; Protein of unknown
FT                   function (DUF1549); Planctomycete cytochrome C; Protein of
FT                   unknown function (DUF1553)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60639"
FT                   /db_xref="GOA:E8R4P8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P8"
FT                   /protein_id="ADV60639.1"
FT                   /translation="MSFVRPIWIRTRWMTWLILGSSALLPPAWSAPLRVVDEAAASQPP
FT                   ATVSYYEQVRPIFQNHCQGCHQPAKAQGGYVMTEFSALLKGGDIGNAIVPGDVEASELV
FT                   MRLELEEGDEALMPKGGPPLSKLEIETIKTWIAQGARDDTPESAKRTYDAEHPPIYNRP
FT                   PVVAALDFSPDGRFLAVGGFHETLLMSADGSQRLARLIGVSERIESVKFSPDGKRLAVS
FT                   GGLPARMGEIQVWNVETGKLLLSVPVTYDTVYGVNWSPDGTLISFGCADNTVRAIDSRT
FT                   GKQVVYMGSHNDWALDTVFTKDGSRLVSVSRDMTAKLTEVATQRFIDNLTSITPGALKG
FT                   GLAAVARHPERDEIVVGGSDGKPRVYRIDRLTARVIGDDSNLIRQLPGVNGRINDVAVS
FT                   PDGKRIAVVGGLDGQGELVIHSYEFDTGLPEDIKAINAKVISSRTAEENAKLAAYYVKD
FT                   IREVARVGLASTALYAVAFAADGQSVAVAGTDGLVRVYETETGKPVREFLAAPVGESTP
FT                   TPAEALAATPNASVSNTVTTTSRAWSATGIDLPGEINPPSETLPPGRTVTTLSVAPQAI
FT                   ELDGPFAYAQLVVSATLDSGDVVDVTRMVRYELSAPVAAISPTGMITAENDGRAELKLT
FT                   LGDRVLVVPVSVTRHDPPADPSQQFVPDFVRDVNPVLSKLGCNQGTCHGAAQGKNGFKL
FT                   SLRGYDPIFDIRALTDDHAARRVNLASAEDSLMLLKPTGSVPHQGGRLMTPGSTYHTIV
FT                   RDWIAAGAKLNRDTPKVVKIELFPLNPVVQTVGGRQQLRVLATYADGQVKDVTREAFIE
FT                   SGNTEVATADRNGLMTSLRRGEAPMLARYEGAYAATTLTVMGNRDGFQWTPPPSWGRID
FT                   DLVAAKWQRMKIQPSELTTDAEFLRRVYLDLTGLPPTPEEVSAFLADSRDTRVKRDEVI
FT                   DRLIGSEAFIEHWTNKWADLLQVNSKFLGPEGAKAFRDWIRNEVAANTPYDQFARKILT
FT                   ASGSTRENPAASYFKILRSPDAIMENTTHLFLGVRFNCNKCHDHPFERWTQDQYYQTAA
FT                   YFARVGLDTDPESKGRMIGGTAVEGGKPLYEIVSDKPEGEVIHDRTQQPTPPKFPFECH
FT                   YSSPGEGASRRAELAAWITSPDNAYFAKSYVNRLWGYLLGVGIMEPIDDLRAGNPPSNP
FT                   ELLDYLTAEFLASGMNPRAIMAQICKSRVYQLSVKTNRWNEDDTINFSHAQPRRLPAET
FT                   LYDAIHAVTGVPSTIPGVPPGTRAAAIPDSGIDLPSGFFATFGRPVRESACECERSSDL
FT                   QLGPVMALVSGPTLADAIAAPNNAIAKLAETTPDDRDLIASIYLRVLNRPATPAEIEAG
FT                   LEFFTRVELDHAQVVADLAAAEAEAAPRTLQRAKARLEAIDQARAALEAYQPERLAKLK
FT                   EAEARRLEAIAQAEKAVEDYKATKFGEKLAAWEAEQTHRVAWSILEPTDLKGGAKDLVL
FT                   TREADGSITASGPSAKTTYVVTAPAPAGIQRITALRLEAMTDPRLPANGPGRAQNGNFV
FT                   VNELTLKVGPKDDPKAAQPVKIKAAHADYTQPGFDPAHLFDGQTGQPNNGWAIHPAMGV
FT                   THWVTLELDQPIEVSANTMLTVALAQNYTDGQHALGRFRLAVSGAENVGLSLAGEYDAI
FT                   LSTPASERTEQQTATLRHYFAALDEEFRKLVAAVDEAKKPVPPDPRQLELEAALARARA
FT                   PLQPEPRLVQLRADLEMSLKQVANPRLTAAQDLTWALINSPAFLFNH"
FT   sig_peptide     48410..48532
FT                   /locus_tag="Isop_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            53923..55416
FT                   /locus_tag="Isop_0043"
FT   CDS_pept        53923..55416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0043"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="InterPro IPR017909: IPR006311: IPR010869; KEGG:
FT                   plm:Plim_1150 protein of unknown function DUF1501; PFAM:
FT                   protein of unknown function DUF1501; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1501)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60640"
FT                   /db_xref="GOA:E8R4P9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4P9"
FT                   /protein_id="ADV60640.1"
FT                   /translation="MLIVPGLSTAKDLCDPQLGPTRRDVLRVGGSGLLGLSLGSMFTLQ
FT                   ARSAQAMAAGEGSKNAGGPGWGKAKSIIMVYLQGGPSHLDLWDPKENVPDNVRSAFKTI
FT                   PTKIPGVHFTEILPRLAQSIDKVTLIRSLSYTPNGLFNHTAAIYQMMTGYTTDKVSPSG
FT                   QLEPPSPKDFPNFGSNIIRLKPPTEPMLPFVMLPRPLQESNVVGKAGTAGFLGKAYDPY
FT                   TLYPEGDDMDNTKMDRIRVDDLQLRPEVFARRLERRARLRDAVNAAMPELDQAVSQYNL
FT                   DGYYQKALDLIVSGRAREAFNLKAEPDAVRDRYGRTTFGQSCLLARRLVEAGTRVVEVI
FT                   WPKVANSDNHSWDTHVGLTDRIKNQAGPMFDAGLSALLDDLDERGLLDSTLVVAVGEFG
FT                   RSPQRGVSTSGNGNSDDGRDHWPYCYTGLIAGAGIKRGYIHGKSDKTGSAPVEDPVHPG
FT                   ELLATIYHAFGIDPLTIVYNHLNQPRELVKAEAITRLFA"
FT   gene            55941..58958
FT                   /locus_tag="Isop_0044"
FT   CDS_pept        55941..58958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0044"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="COGs: COG0567 2-oxoglutarate dehydrogenase complex
FT                   dehydrogenase (E1); InterPro IPR011603: IPR001017:
FT                   IPR005475; KEGG: sfu:Sfum_3547 2-oxoglutarate dehydrogenase
FT                   E1 component; PFAM: Transketolase central region;
FT                   dehydrogenase E1 component; PRIAM: Oxoglutarate
FT                   dehydrogenase (succinyl-transferring); SPTR: 2-oxoglutarate
FT                   dehydrogenase, E1 component; TIGRFAM: 2-oxoglutarate
FT                   dehydrogenase, E1 subunit; PFAM: Dehydrogenase E1
FT                   component; Transketolase, pyrimidine binding domain;
FT                   TIGRFAM: 2-oxoglutarate dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60641"
FT                   /db_xref="GOA:E8R4Q0"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q0"
FT                   /protein_id="ADV60641.1"
FT                   /translation="MNRSTVASRWNLDLLEAKLADWKRDPLAVEESWRLFFEGYELGLT
FT                   DLETKRPAATAAPAAVAPVPPPASEAGRAPASFSEYDLDIARKQASVTRLVDAYREIGH
FT                   FLADLDPLQLTPKLERHELLDLEAFDLDETDLDTVFYTRLFEPNRASLRELIAALRETY
FT                   CRTIGVEYMHIHDNRIRQWLQARMEPIRNRPNLGTHKKRRLLLKLYAADLFERFLQKHY
FT                   AGQKRFGLEGAESVIPLIDAIIERGGAGQVREVVLGMPHRGRLNVLANILHKPYGMIFG
FT                   EFEGHMAPETVCGDGDVKYHLGFSADHVTSCGQMVHLSLTPNPSHLEAVNPVVEGRVRA
FT                   KQRHLRDRDGRMVLPLLIHGDAAFAGQGIVAETLNLSRLPGYRTGGTVHIIVNNQIGFT
FT                   TAPKDARSSPYCTDVAKMIDVPIFHVNGDDPEAVVHVAEIALDFRQTFGMDVVIDLVCY
FT                   RRHGHNELDEPRFTQPRMYRAIDARPPVKQIYTDQLIASGELTRKEAETIAETFEEKME
FT                   AIFNEIHNQPPPTPTPPKSFGGPWKGLVRDYSFEPVETGVSQETLARIVAHVTTPPPPG
FT                   AYGRPDRPFKLNPILDRILRQRAKAMAEGGPIDWAFAETLAFGSLLIEGHPVRLSGQDS
FT                   RRGTFSQRHAVWVDPETGEEYYPLRHLAPEAAEFFVYDSFLSEAAVLGFEYGVALDSPH
FT                   VLVMWEAQFGDFANGAQAIIDQFIASGESKWGRANGVVLLLPHGYEGQGPEHSSARLER
FT                   FLQLHASAENNIEVVYPTTPAQYFHLLRRQLKRNFRKPLIVMTPKSLLRRKEATNTVAD
FT                   LTTGRFREVLDDPAITNPDQVKRVILCSGKVYYDLAARLAKETELRGNIALVRIEQLAP
FT                   WPLDALKTLKARYHQTRQWIWAQEESQNMGAWSFVSPRLRDLLGIAVPYVGRDSSASPA
FT                   TGSSKVHDREQAELVEAALFGDGGHVVTATPRTPHLVSVPTAANGSASSSASAANGAST
FT                   GHAAVVQSAGGARHSS"
FT   gene            59503..60822
FT                   /locus_tag="Isop_0045"
FT   CDS_pept        59503..60822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0045"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR000089: IPR006255: IPR004167: IPR001078; KEGG:
FT                   sti:Sthe_2057 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: catalytic
FT                   domain-containing protein of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; SPTR:
FT                   2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
FT                   succinyltransferase; TIGRFAM: 2-oxoglutarate dehydrogenase,
FT                   E2 subunit, dihydrolipoamide succinyltransferase; PFAM:
FT                   2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); e3 binding domain; Biotin-requiring enzyme;
FT                   TIGRFAM: 2-oxoglutarate dehydrogenase complex
FT                   dihydrolipoamide succinyltransferase (E2 component)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60642"
FT                   /db_xref="GOA:E8R4Q1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q1"
FT                   /protein_id="ADV60642.1"
FT                   /translation="MAQAAVPVVVPNAGESITEGILARWIKPNGSFVQAGDDVCEIETD
FT                   KTTNPAKASVSGILIWKAQEGDTVQIGAIIGEIDPSAQPVVSTVPASDSPASSSVAASG
FT                   SSTSSVNVNGGASVPPMTPAGRRIAAELGVNPAEVTATGRHGLVTKPDVIAHLAGRVDA
FT                   PASPPPTPAPIPAPTPAPATLTPPTSTPTPAFATGPVAATGPGRPREIRERMSGLRQKI
FT                   AQRLVEAQHTAAILTTFNEADLSRVIELRTKYKESFQKKHGISLGFMSFFIKAAVDALK
FT                   TYPRVNGRIEGNEIVINQVYDIGVAVSTERGLMVPVIRDADQKGFATLEKELAAYATRA
FT                   RENKIDVADLQGGTFTITNGGVFGSLLSTPILNPPQSGILGMHAIQKRPVVLDDQVVIR
FT                   PMMYLALSYDHRIIDGREAVGFLVRIKECVENPERMLIDI"
FT   gene            61055..62518
FT                   /locus_tag="Isop_0046"
FT   CDS_pept        61055..62518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0046"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3);
FT                   InterProIPR006258: IPR013027: IPR000815: IPR012999: IPR
FT                   004099; KEGG: mag:amb3963 pyruvate/2-oxoglutarate
FT                   dehydrogenase complex; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   SPTR: Dihydrolipoyl dehydrogenase; TIGRFAM:
FT                   dihydrolipoamide dehydrogenase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60643"
FT                   /db_xref="GOA:E8R4Q2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q2"
FT                   /protein_id="ADV60643.1"
FT                   /translation="MSQSSPSTATGGRYDLIVIGGGPGGYVAAIRAAQLGLKVACVEKR
FT                   STLGGTCLNIGCIPSKALLDSSELYHLAHHRFQRHGIKFANVELDLGAMMGRKDEVVTQ
FT                   LTRGIEGLFKKNKVAWLHGFGRLASPTTVAVKAADGVETFHEAGHILLATGSEPTELPF
FT                   LKFDGHTVVSSTEALAFDRVPDHLVIVGGGYIGLELGSVWKRLGSKVTVLEFLPRIVPF
FT                   ADHEIADHLLRSLKKLGLEFHLETKVTGALISNGANANGSGVPPAAVVLAESKSGEKLE
FT                   FPCDKVLVSVGRRPYLDGLGLAEIGVEYDPKSGKVKTDSHFRTNIPTISALGDLIDGPM
FT                   LAHKAEEEGVAFAELLAGKPGHINYDTIPAVIYTWPEMASVGINEQQARERGYDLAIGK
FT                   FPFTANGRAKAMDETEGLVKIIADAKTDRVLGVHIIGPRASDMIAEAVAVMEFGGTAED
FT                   IARTCHAHPTLSEAFKEAALAVDRRAIHI"
FT   gene            complement(62655..65525)
FT                   /locus_tag="Isop_0047"
FT   CDS_pept        complement(62655..65525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0047"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="COGs: COG4232 Thiol:disulfide interchange protein;
FT                   InterPro IPR017936; KEGG: plm:Plim_0535 cytochrome c
FT                   biogenesis protein transmembrane region; PRIAM:
FT                   Protein-disulfide reductase; SPTR: Cytochrome c biogenesis
FT                   protein transmembrane region; PFAM: Cytochrome C biogenesis
FT                   protein transmembrane region; Protein of unknown function,
FT                   DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60644"
FT                   /db_xref="GOA:E8R4Q3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q3"
FT                   /protein_id="ADV60644.1"
FT                   /translation="MMILSPSRGGTGGRVRVVTAPTILGLLFLAATLASGRLQAQDQPP
FT                   DGSQPQPRQKETSKRFQPAEAVFSTQIVPAEARPGQTVQFQVQAKLAPTWHIFAYAPKQ
FT                   FDEGPRATEFDLFNTGGLNIAGPWTAEPPPNRSKDPNFPEVEFVEYHENQVVWSIPLTI
FT                   PEDAQPGSRTIQVQAYYQLCDPNTCSRPGRWNLEPATLTILAATNPAPALTAAASDNQA
FT                   TTPQEDTTSNASSPKQPRRPDDKPFFKPSQARLSTNVTPAQATPGSTVNFEITMELDEG
FT                   WHAYGLNNSDEADGPFTALDLFDTGGLTVVGDWTADPQPETKPDPQFPDLPFVATHEGR
FT                   VTWRIPLSIPADAPPGKRTLKVQAYYQLCDANQCTRPGRWTAPEAVLTVLPAGAAAPVT
FT                   ATANPAAATQTTTNVAAAGVDTSLSAGSQSNAADANNAADAKPVTGRNEVTEAIEQGIV
FT                   PFVLLAIFGGLITLAMPCVWPMIPITVNFFVKQGEANRGRAIGLALTYSLSIIGMFTIL
FT                   GVMVAVLFGAKALQDIAINPWINGFIAVMFIAFGLSLLGLFELRLPSSLLNLSSRGEQV
FT                   GGVVGVMFMALTLVITSFTCTAPVVGALLVAAAVGESYLYPILGMLIFSTVVALPFFAL
FT                   SIAPGLLKSLPKSGDWMNSVKVVGGLLELGAAFKFVNNVELAFVPDPSDAWFNAHALIA
FT                   IWSVTAAVCGLYLLGMFRTKYDYEQPMIGPGRLVFGTAFLAIALYLAPALFGAPPRSRA
FT                   YEFFALGLLPPDYVNLERGGGFGGVGASTGGGEALAKKATSTDPDQAEREETKFHGVEW
FT                   GMSYQAALERARKESKLVLIDFTGVWCANCRAMEGEVFPKPAVVEEMKKFVTVALYNDK
FT                   VPIGSLTVQQQQALAERNFELMVNLIGSTTNPTYVVLDPVTETVIDSIGGKRSVEVFVD
FT                   FLKNARAKAQAARTATPAGDSRTAAR"
FT   sig_peptide     complement(65406..65525)
FT                   /locus_tag="Isop_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(65793..67313)
FT                   /locus_tag="Isop_0048"
FT   CDS_pept        complement(65793..67313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_2051 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60645"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q4"
FT                   /protein_id="ADV60645.1"
FT                   /translation="MVKSSPQPATPESAAPSWRDDEASARFTPMNLSLGGGTQLRGRVL
FT                   SRLVGFYQKLFRQLLDHFFPEGLLEQVDDRSFIRFDDVARGYGFCELDEDGVAMNLTVF
FT                   RTSYRFYPGAPAPFLESERRLLQTIVHLIHARFQAIYDPTAQADSDFSRYALEDLVVAH
FT                   ALDPSRLNVIASALEVLRVSGLSTYENRRISTGALLLGTDYDPTAPQRIKPADAQPYTA
FT                   RLSSLKRFHRICDGINTVFVVDREGDLIWPVEIRRWADQAHGEDPLPDHLPCPKPYHAH
FT                   AKATLHNGHLCVVLTPFQEIKVFHQGSMAFAYSDARWRLLDIPAKFAAWREAVEAKQTT
FT                   DPPDLAARIFRAALNLSEGRSGALFVLLRDPDESLSRLVDVSDLIQHDEEDEEENETAM
FT                   PIGRPPSQLAKRTLHHLVRDQTLSQLDGAVMESLARVDGAFVTDLRGRLHAFGAILKIP
FT                   PDLPTGARAVEGARTAAALAASFHGPVLKVSEDGFLTMFLAGRRIWEI"
FT   gene            67620..68405
FT                   /locus_tag="Isop_0049"
FT   CDS_pept        67620..68405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0049"
FT                   /product="HNH endonuclease"
FT                   /note="COGs: COG3183 restriction endonuclease; InterPro
FT                   IPR002711; KEGG: tra:Trad_1508 HNH endonuclease; PFAM: HNH
FT                   endonuclease; SPTR: HNH endonuclease; PFAM: HNH
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60646"
FT                   /db_xref="GOA:E8R4Q5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q5"
FT                   /protein_id="ADV60646.1"
FT                   /translation="MVRVYEMQNPLRTEKYVQGLKAIRSRVSDAHRRVFVAHHAAVNRT
FT                   ATAKQLAARANLGGHSVVNSLYGKLGHALCDELGVTPELRPNHKNRWWSVWARGWSDSE
FT                   GFVWQMLPQVAEALEKVGICAPERETSLPEEVEAPPDRTLTEGAVRQITVNAYERSRQA
FT                   VRKCKERHGTACVVCGFNFGVVYGPVAEGTIHVHHLRPISEVGAEYMVNPETDLVPVCP
FT                   NCHVVLHLGMGGGCRSVEEVRRLIETNRRRSEPNAAGSQ"
FT   gene            complement(68444..70069)
FT                   /locus_tag="Isop_0050"
FT   CDS_pept        complement(68444..70069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0050"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1807 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferase of PMT family;
FT                   KEGG: cyb:CYB_0994 hypothetical protein; SPTR: Putative
FT                   membrane protein; PFAM: Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60647"
FT                   /db_xref="GOA:E8R4Q6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q6"
FT                   /protein_id="ADV60647.1"
FT                   /translation="MQPRCESNSKTKTKTEARFQRGALALIAATLVVRLVAAATVGPGN
FT                   DEAYHVLYAWHLDWSYFDHPPMLGWLGRLGLELWGDPRSLLGLRLGFVLLFAATTWLMY
FT                   RLTARRWGARAGFAAAVWLNAIGYYGGASGLFALPDGPFAFFWLAMLDRLAAVQEQPER
FT                   HGVWLVAGLAWGGALLSKYIAAALPLGVVLWLMCDTRARALVARNLRGPLLFALGGLIA
FT                   FSPTLGWNAVHGWVSFAFQGGRAVGWTSLRPDALGLALAGLAAYLFPWMLAVLLTAAAA
FT                   TLRELKANPRALTSPPLTSNNPEPSPGPPTTGRPPDSLDTLLLCLAAVVIGFFLMLACV
FT                   KPILPHWTMIGWLSLVPLAGRWTDRRWATHPVRTRRLLTAALAAWAVVMGVAIVQARWT
FT                   PLPLGRLDPLADHVGYPQVAAQLRARGLADPDRVFWFTRRWFSAGHLALASGGDLEVTC
FT                   FHDHDARGFVFWNDPNATLGRDGVLVSESSRTDQERNAYAPYFEAFEPLGRVTATQRGR
FT                   VVRTLELTLFRRQLKPFPIGPRPE"
FT   sig_peptide     complement(69956..70069)
FT                   /locus_tag="Isop_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(70278..71690)
FT                   /locus_tag="Isop_0051"
FT   CDS_pept        complement(70278..71690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0051"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG2208 Serine phosphatase RsbU regulator of
FT                   sigma subunit; InterPro IPR010822: IPR001932; KEGG:
FT                   plm:Plim_3158 stage II sporulation E family protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein; SPTR: Stage II sporulation E family
FT                   protein; PFAM: Stage II sporulation protein E (SpoIIE)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60648"
FT                   /db_xref="GOA:E8R4Q7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q7"
FT                   /protein_id="ADV60648.1"
FT                   /translation="MDSFNDPFQAITSSITPIASQDDLVTADDLDSLWRERLRQVVAMM
FT                   REMSRQTDPQTMVKAYDRRMREIMPIGGRVSLSRRGLEAPWFRITRFSGWDEEINPWTQ
FT                   KERLPLLRGGLFAELLYGDEPDLRLHLKPDPDDPAAPYLEGFGSLAALPHYDQGVALNM
FT                   TLLLRVEPDGFTWEQLPGMVWMSNLFGRATHNLVLTNQLRQVNAQLERELRTVADIQRS
FT                   LLPRSLPPIPGLDLAAYYRTSRHAGGDYYDVFALPGGRYGLLIADVSGHGTPAAVVMAI
FT                   THSLVHTYVEPCDNPAALLSYLNQQLTTRYTSESGMFVTAFYGVYDPATRILRSTRAGH
FT                   NPPRLIRSDPDGAAGSFVVEPIEGPAGLPLGILEDQSYPCHETALKPGDVLALYTDGVT
FT                   DTVAPPRDPSGRYEFYGTERLDAMLARCVQKGRGCSASGLLRMLLDDLNSFSQGAPPVD
FT                   DQSLLLIKAKND"
FT   gene            71789..73342
FT                   /locus_tag="Isop_0052"
FT   CDS_pept        71789..73342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0052"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR012795: IPR012796: IPR011063; KEGG: dau:Daud_0086
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein; SPTR: tRNA(Ile)-lysidine synthetase; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: TilS substrate
FT                   C-terminal domain; PP-loop family; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase, C-terminal domain;
FT                   tRNA(Ile)-lysidine synthetase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60649"
FT                   /db_xref="GOA:E8R4Q8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q8"
FT                   /protein_id="ADV60649.1"
FT                   /translation="MSRSDRNDSPLGQTFSPPQHDRSPRSGKVTAPFPAGQGFWPEWGE
FT                   AVVERCRGWSRRGIGPSVVVGVSGGGDSVALLRLLDAAIRAGALDWSLTVAHFHHGLRG
FT                   SQADAEADAVERLAHALGWPVVVERWSDPPQGIAPAEAPLRAARLEFLARVASHHQARA
FT                   VVLAHTRDDQAETVLQRVLRGCGPRGLGGIPPRRRLTQGVDLLRPLLEVPRACLRDWLT
FT                   AIGQPWHDDPTNTDQHRTRAWIRHDLLPRARRHVNPQADAHLARLARHARILCRRLEHD
FT                   GARLLRTCWRDHLDESTSSEEARVSLDRIRLAAAPRWLRVEALRGLWRARGWPEADMTQ
FT                   RHWHKLARLVETPQERSDHFPGGLRVRINRNDFVISHPCKLTLSPIESRAWDEGGFVVV
FT                   ASGTTVTPRGRLTIMETSPHLIASDPFLETIDADTLHLPLILRGPRPGERFDPLGMGGS
FT                   TQPLNDFLRSRDVPRTERSAVVLLSDAMGIVWVVGHRIAHRVRLTSASRRGWRLKWVED
FT                   "
FT   gene            complement(73486..74313)
FT                   /locus_tag="Isop_0053"
FT   CDS_pept        complement(73486..74313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60650"
FT                   /db_xref="GOA:E8R4Q9"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4Q9"
FT                   /protein_id="ADV60650.1"
FT                   /translation="MSYANGLSNGHTSLKQPLVLSGWSGRKVVGFGLLTIVLVLGVLFV
FT                   VFLFIREDYKATAAYGRRTVPPIVDRWANLTPEGFDQQKWDDLVIATRLLVDRVSTLGL
FT                   LDRDGLDALAADLNNRANGSNPAAALADLAGIWVDLEVAIGPRLGRVEVPEPIAEAVAL
FT                   GLMVPVIAPEVLRRDGIDPETAKQAASATRRMLAAVALSGRFDSETIKQLATELRPRST
FT                   PLATNPARLFANLNAIWDDIARRDPQVLNAPGVPARPAALIEAARNQTNTSNQ"
FT   gene            complement(74481..76229)
FT                   /locus_tag="Isop_0054"
FT   CDS_pept        complement(74481..76229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0054"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; InterPro IPR002528;
FT                   KEGG: gbm:Gbem_1791 polysaccharide biosynthesis protein;
FT                   PFAM: multi antimicrobial extrusion protein MatE; SPTR:
FT                   Polysaccharide biosynthesis protein; PFAM: Polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60651"
FT                   /db_xref="GOA:E8R4R0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4R0"
FT                   /protein_id="ADV60651.1"
FT                   /translation="MGEVAEADAELVSSSASLAATNRDGSQTSPTWKGQPGAGVAAALP
FT                   SVLGRLASGTFWVALRIPINAAIGFLTIPLIVGAIGEELNGAYQFAWGFGFFQVLLEFG
FT                   MSSALSRRISEAWTQRDHEAVDRTVVCGLLFYAVMTLVQCLALLAVLHLALPLTDYQGE
FT                   ARELIVKLLWLQIVTAPCYGLGMILASLLQAARRYEVLPLLDLIISVLRFGIMVVALRA
FT                   GVPFFTIMVMVISLQIVLYFGPGFWVLFQNVGYRPTLRRPRREDVSSLVKFSAYVFILN
FT                   LSMILADKVDTTVLGFALADPGPPTTVYQAVSKPFLSLRQMAWMLTGLLVPAVASLAAA
FT                   RDDHGLDRVKYDATRALLGVLLPPVLLAGLLAGPFLVVWMGESYRQHAGLMQLFLIAAA
FT                   PLAISGLVQTAIGMGEIKFIAWTALIGAVINLPLSFVLTWVWNDVSGVIWGTVLTTLFS
FT                   NLIAPGWYLWRRLEIDAGEFARRALSAPLAGVAALLVATLVLPCWVPLEPDQVGWAERV
FT                   ARLLLHIGVGLIAYAAGHLLTPWGRSDLRLLRDRLSARSASKQLAPADSHGSQPAATLA
FT                   SPSNVD"
FT   gene            76640..78823
FT                   /locus_tag="Isop_0055"
FT   CDS_pept        76640..78823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0055"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="InterPro IPR000595; KEGG: tcr:504449.30 hypothetical
FT                   protein; PFAM: cyclic nucleotide-binding; SPTR: Putative
FT                   uncharacterized protein; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60652"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4R1"
FT                   /protein_id="ADV60652.1"
FT                   /translation="MTTQANSDERLERAEVREILRSITPLRALEPARLERLLDQSHLLT
FT                   LTSGQWLTRQGERDCRVFVLLRGLIEVWNAAVVPPQRLETIEPGRCFGERAVLLDEPRD
FT                   RDHRASDRGPAHLLVIAGEVYLELTAQSPAFAQALGSLWRLKRGGSDPIDNFLAELRYG
FT                   VSQGMIPLFRLIPRYLQLQPALHPLANDEGRIDWPALLYAVRRLPDTITRTFMLFLADE
FT                   VPALYGQPQRLFQAVATATRPRATYEMLPGKAMVLLRDGLSDLLDLICCICLYAVESRK
FT                   IRKRVATHERLILLGDHLEDRPNLGPTEADRRDRRVLAEMGFDERDIQGLRQIWPRDPC
FT                   RHLQEMLVQHEDIAIGLRRRRDDATRRPAESWAAQIAADFRDLTGDDPHDLPPELAVHV
FT                   ISSNTHSVTNCLSHYLADHADRILAWGRAFRPELYQEEWSNPRDLLYALARDFLRTHPD
FT                   EAARKRRLEREGGVLRRYETAFTGIQVELIDLAAVARRPVDPDLTLPDRAPAVIVNIDF
FT                   AFGQQAEEILAVLILLFRRNLASVNILGKAGTLVGNRGDLLAPTAFLDQHTDQFQPLVG
FT                   PQRVDFQRLRRRLPHHQLHQGPMLTVLGTLMQNRVLLNLYKNIWRCVGLEMEGFHYHNQ
FT                   LVRSIRRGVLSDDLAVRFLYYVSDAPLRPGESLSESLRVLEGVPPLYAVTREVLAGIFE
FT                   QERQRAGQPLTPPPETPSPGWDGLETWTARSSR"
FT   gene            78854..79930
FT                   /locus_tag="Isop_0056"
FT   CDS_pept        78854..79930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0056"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014044; KEGG: ami:Amir_2074 SCP-like
FT                   extracellular; PFAM: SCP-like extracellular; SPTR: Putative
FT                   uncharacterized protein; PFAM: Cysteine-rich secretory
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60653"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4R2"
FT                   /protein_id="ADV60653.1"
FT                   /translation="MVRSWSFVDAAPARFPSRGFRLEPRRHATIPLLLALTSEAGIAPA
FT                   YAQRRDPSGLEPARILHEHNRLRVAEGLEPLAASPVLQRIARDYALELARRQMIDHVGE
FT                   DGSTLTDRAAKGGYLFTAIGENLAFGHQNVKSLMHDWMHSPSHRANILQPAYTQAGIGF
FT                   ARDTRGLLYVVVNFGAPRQPVTEGRVVSAHSASNPSDAGKPSPSPTALLKQAIDTLRAQ
FT                   EGAAPLTISPLLTRAAGLHAYDLAQRSLASPVGSDGATVSKRVRDLGYRPRIVAQLVAR
FT                   GGATAEEVITRWSESAGPRRLLLDDHKEIGLARVEDDQGVPHWCVVLADPQTPPSTAPR
FT                   STPESGFSAETVSPSHHP"
FT   sig_peptide     78854..78994
FT                   /locus_tag="Isop_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(80104..81357)
FT                   /locus_tag="Isop_0057"
FT   CDS_pept        complement(80104..81357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0057"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR019775: IPR014044; KEGG: ter:Tery_4644
FT                   allergen V5/TPX-1 related; PFAM: SCP-like extracellular;
FT                   SPTR: SCP-like extracellular protein, putative; PFAM:
FT                   Cysteine-rich secretory protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60654"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4R3"
FT                   /protein_id="ADV60654.1"
FT                   /translation="MGFDGLESRQLMTGGIQSTSFAFPASQVSHLEPTSEAQYLLELIN
FT                   NARINPSGAANRIQDQANDPRAHRSLRSSVNFFRVDLNSELNAIRSIRSQQPLAWNPRL
FT                   SQAADSHSQDMARNRFQAHDGSDGSSPSQRLDRVGYSDRSYDVENAFAYAESIDHAHQA
FT                   FLVDWGVSNRSHRANLLQPHANSSNSANEVGLGIVRTNSSGFGPLVVTQHFARRETTPY
FT                   LLGVIFDDRNGDNFYNPGEGISDARVTARNTATGETTTVNAWGSGGFQMQLRPGQYEVT
FT                   ATIQGRIVRSRPVTISNENVKVDYRLQDLTFQSDSAPPPVSLARSAPIAPMVVTPPTVS
FT                   TPAPAPAPAPTLAPAPAAPISSASEPVAQTSDTRWEASWSNRLQSTISSSANSNPTAGL
FT                   WNVVLSSLRWSSWSSDRD"
FT   gene            82124..83857
FT                   /locus_tag="Isop_0058"
FT   CDS_pept        82124..83857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0058"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: zpr:ZPR_0251 putative secreted protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60655"
FT                   /db_xref="GOA:E8R4R4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032285"
FT                   /db_xref="InterPro:IPR032288"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4R4"
FT                   /protein_id="ADV60655.1"
FT                   /translation="MSVTKPTPHSYAGVIRLGQTRFSAALSLAAFLATTMGLSVPTLAA
FT                   TGTHGGNTHPSETIKATGVVFEDRDGDGLRDQEEPGLSGVRVSNGETIVTTDDQGRYEI
FT                   EIDAKDATVFVIKPRDFMTPTDADGLPRFTYSHKPEGSPPTQYAGIAPTGPLPASVDFP
FT                   LVRRPEPNRFRVVMFGDTQPRDLKEVDFIAHDVVAPLAAAEAQADPEDRAAFGVTLGDV
FT                   VNDDLDVMPPLNAVVGRLGLPWYNVLGNHDMNYDSPDDSLSDETFERIYGAPYYAFNYG
FT                   PVHFVVLDDVIWSGIGPDRPRGRYKGGLGERQLTFLRHDLAGVPKETLVVFLMHIPVWE
FT                   MEDREAFYRLIEDRPHTLSFSAHTHIQEYRLLGPEEGWTSPHPHLHVNHVTVCGSWWTG
FT                   KTDENGIPHTTMRDGVPNGYSIVHFDGPNYVIDFKPARRPASHQMTIFAPDFVTVADAA
FT                   RTEVLANIFTGLKTTPVQVRIDGGDWIDLTRSSEPDPYYVRLKQAETGPNPPDGRPLPN
FT                   PAASPHLWKGTLPADLSVGAHTIEVRFVDHFNRTFTDRRIIRVVPNPADAQTDEQGQNG
FT                   R"
FT   sig_peptide     82124..82255
FT                   /locus_tag="Isop_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(84537..85292)
FT                   /locus_tag="Isop_0059"
FT   CDS_pept        complement(84537..85292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0059"
FT                   /product="protein of unknown function DUF901"
FT                   /note="InterPro IPR010298; KEGG: psl:Psta_2939 protein of
FT                   unknown function DUF901; PFAM: protein of unknown function
FT                   DUF901; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF901)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60656"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:E8R4R5"
FT                   /protein_id="ADV60656.1"
FT                   /translation="MRILIDGYNLMYAAGLMPPRGRSLSPAQFRKLRTRLLDRIAEGLP
FT                   EVDAHQTVVVFDASVKPPDDPALSREETHRGIRARYAQEAHSADDALEDLIHDHPTPRT
FT                   LTVVSSDNRIRLAAKHRKCVVLRSDEFLDRLDAYRAEEDRRARRSRLGIPATIVPPTKK
FT                   GPLSPEEEARLYGLDERETGFWLREFSELAHDPQTRAALNPEPEGLISEEDIDRIAREI
FT                   EIEFDRHMQGTSDPRRAGRRPPRPRSGQC"
FT   gene            complement(85525..86856)
FT                   /locus_tag="Isop_0060"
FT   CDS_pept        complement(85525..86856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0060"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="COGs: COG1004 UDP-glucose 6-dehydrogenase; InterPro
FT                   IPR017476: IPR001732: IPR014026: IPR014027; KEGG:
FT                   psl:Psta_1357 nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; PRIAM: UDP-glucose
FT                   6-dehydrogenase; SPTR: Nucleotide sugar dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase family, NAD binding
FT                   domain; UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain; UDP-glucose/GDP-mannose dehydrogenase
FT                   family, UDP binding domain; TIGRFAM: nucleotide sugar
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60657"
FT                   /db_xref="GOA:E8R5B6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5B6"
FT                   /protein_id="ADV60657.1"
FT                   /translation="MRIAVVGTGYVGLVTGTCLAESGNQVVCIDKVAAKIELLKSGGIP
FT                   IYEPGLAELVHRNAKDGRLSFTTDLGAGIAEAEIVFIAVGTPQGDDGGADLSGVYAVAE
FT                   QIGRHLNGYKIVVVKSTVPVGTNAEVARRIAAVTDCPFDVASNPEFLKEGAAIEDFNKP
FT                   DRVVVGVRKPEVGERLRELYAPFLRTDRPFLVMTPESAEMTKYVANCMLATKISFINEM
FT                   ANLCERYGADINQVRRGIGHDQRIGFHFLHPGVGYGGSCFPKDIRAVIHMAKAKGVPAA
FT                   MMEAVDSVNEAQKAVLGGKILSHFGPRLDGKTIAVWGLAFKPRTDDIREAPSLTLIDLL
FT                   LERGAAVRVHDPEAIPNVRALYGDRLIYCDRPYGALEQADALAIVTEWNEFRNPDFEVM
FT                   LRLMRQPIIFDGRNLYEPATMKRLGFQYQGIGRAMVDPTPSYRM"
FT   sig_peptide     complement(86797..86856)
FT                   /locus_tag="Isop_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(87189..88601)
FT                   /locus_tag="Isop_0061"
FT   CDS_pept        complement(87189..88601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0061"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="COGs: COG0174 Glutamine synthetase; InterPro
FT                   IPR004809: IPR008147: IPR008146; KEGG: psl:Psta_1754
FT                   glutamine synthetase, type I; PFAM: glutamine synthetase
FT                   catalytic region; glutamine synthetase beta-Grasp; SPTR:
FT                   Glutamine synthetase; TIGRFAM: glutamine synthetase, type
FT                   I; PFAM: Glutamine synthetase, catalytic domain; Glutamine
FT                   synthetase, beta-Grasp domain; TIGRFAM: glutamine
FT                   synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60658"
FT                   /db_xref="GOA:E8R5B7"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5B7"
FT                   /protein_id="ADV60658.1"
FT                   /translation="MTPREVLALIRSKEAQTVDLRFMDFPGVWQHFAIPADRLTEETFE
FT                   EGIGFDGSSVAGWRQINEADLLVVPQPETALIDPFAARPTLMMICNIQDPLTKQDYTRD
FT                   PRNIARKALGHLRSTGVADQARIATEIEFFIFDDVRFDQHGHQAFHLVDSIEGDWNTGR
FT                   DERPNLGSKPRSPLGYFPCPPTDTLADLRAEMVGILAECGVRVTAHFHEAATGGQCEID
FT                   LDWADLVQAADQVMLARYVIRSVARRHGKTATFMPKPLFGDNGSGLHTHLAMRKEGESI
FT                   LPGHGYAGLSDTALYMIGGILKHANALCAFANPTTNSYKRLVPGFEAPTRIGYSRRNRE
FT                   AIVRVPIHSFSPHAQSIEYRAPDAAANPYLLFSALVMAALDGVQTKSAPGEPYDRDLYD
FT                   LDPQINDRQPTLPLTLKDSLEALQRDQEFLLRGDVFTPDVLDTWIWYKRTHESEAVRVR
FT                   PHPYEFVLYYDV"
FT   gene            89052..89672
FT                   /locus_tag="Isop_0062"
FT   CDS_pept        89052..89672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dba:Dbac_1387 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60659"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5B8"
FT                   /protein_id="ADV60659.1"
FT                   /translation="MNPYLSASTNPDPDNNAEKSKCSWLLAVDAGLRLGMAYFEEPGHV
FT                   VWCRSHHLGSRHALRNAIGSILAGLPQAGRLVVEGGGPLVELWTGEAQRRGWAVLVVAA
FT                   ERWRADLLVPRDRSDARRAKAAALARAREMLRNSPRAANPTHLRHDAAEAVLLGHWAWN
FT                   HADLFINPSRRETLPNVAPPKPTARRRMPRRGHDEGPDVLKCD"
FT   gene            90553..91590
FT                   /locus_tag="Isop_0063"
FT   CDS_pept        90553..91590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cin:100178638 similar to topoisomerase (DNA)
FT                   III alpha; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60660"
FT                   /db_xref="GOA:E8R5B9"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5B9"
FT                   /protein_id="ADV60660.1"
FT                   /translation="MRVNPPFGTIGMRSARLSASFLLVISLTTGLGGGIVLGDDRSLMD
FT                   RVRLEYPQALVKLEDIFSTMRGKGVLTRKLGSGNDEKTLHWDVEFAKRGDMALVRRTWN
FT                   AKQFSEEQAVIKDVYCKNLDRYVFSLSSAVDNPNLSVTRLGHDVQDFDFCYGVYVKRHA
FT                   EAAYCVFGLPVRRMMEDASFKITKVSSRVEGDRELLRIDYDYHPKDLILRSGWLEVCPS
FT                   DRWRIQEYETQLSAEMKGRTIKGVVEYQKDQKTGENLPVRSKIDMTDGIIAFDFQTFSL
FT                   TPAPEEEEFTLAAFGFPDVEPSGAEGTSNLLGFVGAGVLLLVVAAILKALASRAQQRRP
FT                   RAGES"
FT   sig_peptide     90553..90666
FT                   /locus_tag="Isop_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(91735..92763)
FT                   /locus_tag="Isop_0064"
FT   CDS_pept        complement(91735..92763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0064"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: plm:Plim_4074 protein of
FT                   unknown function DUF1559; SPTR: Putative uncharacterized
FT                   protein; PFAM: Prokaryotic N-terminal methylation motif;
FT                   Protein of unknown function (DUF1559); TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60661"
FT                   /db_xref="GOA:E8R5C0"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR027558"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C0"
FT                   /protein_id="ADV60661.1"
FT                   /translation="MVYRAPARTSRWGFTLIELLVVIAIIAVLIALLLPAVQSAREAAR
FT                   RAQCTNNLKQLALAAMNYESANGCLPGTNLRLQFCNSCGYSPFVAMAGFFEQTAVFNAI
FT                   NFNHHMYRGENATVAGVGPTTLWCPSDPAVNKTFPLDSFYFPLTAAQRQALRQVNTGYG
FT                   GNAGLWLTYWTGQVSAARGTMNNGMVVRLSEITDGTSNTLMLGERAFGIMSPSDQQFYC
FT                   WWNSGYWGDTSFDTMYPLNYAFRARQQIAQFGWWRVPLSASGSFHPGGANFAMCDGSVR
FT                   FLKETINSWQINTNSNQLGGGPDPVGLQFINSVWNMGTAVPGIFQALSTRSGGEVISAD
FT                   AL"
FT   sig_peptide     complement(92647..92763)
FT                   /locus_tag="Isop_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(93164..93406)
FT                   /locus_tag="Isop_0065"
FT   CDS_pept        complement(93164..93406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgu:100226598 RAS p21 protein activator
FT                   (GTPase activating protein) 1; SPTR: TRAP transporter
FT                   solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60662"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C1"
FT                   /protein_id="ADV60662.1"
FT                   /translation="MFHVFHRMMAVLCAVALVGCNGGSGAASNTDAAAAGSIDMAAAKK
FT                   RAAELNPDAPMGGGGATGGDTRKVDEKAEAKAKSN"
FT   sig_peptide     complement(93305..93406)
FT                   /locus_tag="Isop_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(93765..94586)
FT                   /locus_tag="Isop_0066"
FT   CDS_pept        complement(93765..94586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0066"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG0596 hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily); InterPro IPR000639:
FT                   IPR000073; KEGG: svi:Svir_29320 predicted hydrolase or
FT                   acyltransferase of alpha/beta superfamily; PFAM: alpha/beta
FT                   hydrolase fold; SPTR: Predicted hydrolase or
FT                   acyltransferase of alpha/beta superfamily; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60663"
FT                   /db_xref="GOA:E8R5C2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C2"
FT                   /protein_id="ADV60663.1"
FT                   /translation="MRLDCDDRGPRDATVILLLHGFPLDRTMWTHQIGPLADSGRRVVV
FT                   PDLRGFGRTGTPPCHQPGDAFVVDQMADDLWDTLDALGIGPARPVTLAGLSMGGYVALA
FT                   AAVQRPERVAALILLNTRDGADDPAQAAQRLELAAAIETSGSTASLVESMPLRLLGATT
FT                   QAQQPHLLDQVRAMMSAAPPLSVAATLRGLAARPDRTNWTPTWTKPARVIIGNEDVVSP
FT                   PEVMHALADRLRLAPEDRVAIPQAGHLTPLEQPQAVTQALLAFLDRLDQPE"
FT   gene            complement(94591..96054)
FT                   /locus_tag="Isop_0067"
FT   CDS_pept        complement(94591..96054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttr:Tter_2666 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60664"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024749"
FT                   /db_xref="InterPro:IPR025277"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C3"
FT                   /protein_id="ADV60664.1"
FT                   /translation="MLLPPPLTLISWLALASGWLSPLPLQATPAHHDATDDPSSNSHRW
FT                   KFPLRVSDNRRYLVQNDGEPFFYLGDTAWELFHRLSLDEADRYLRDRASKGFTVIQAVV
FT                   LAELKGLTDPNPNGDLPLFDNDPTRPNEAYFRHVDAIVARAEELGLVIGMLPTWGDKWT
FT                   DRAGGAGPVIFTPENARVYGEFLGQRYRDRPIIWILGGDRVIDTDTHLAVIEAMALGLR
FT                   AGDGGNHLISFHPRGGRTSADPLHDKPWLDFNMLQSGHARDRANYAQIAADYARRPTKP
FT                   CMDAEPIYENHPLDFNPKNGYSDETDVRKAAYWAMLAGALGHTYGCHDIWQMAAPGRPP
FT                   ISNARSTWFDALNLPGAGQMRHVRKLFETIQPFHRLVPDQGLVADELDRREGPHHVQAA
FT                   RRADNRAAVLYLPEGRPIRVNLEPLVGPTLAVQWFNPRDGSLQTAAPVSRTQDADGSTL
FT                   QRFAPPDDQQGRGHDWILLLQTADSTNGT"
FT   sig_peptide     complement(95974..96054)
FT                   /locus_tag="Isop_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(96223..100479)
FT                   /locus_tag="Isop_0068"
FT   CDS_pept        complement(96223..100479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0068"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000719: IPR019782: IPR017986: IPR006530: IPR
FT                   017441: IPR008271: IPR019775: IPR017442: IPR019781:
FT                   IPR020635:I PR002290: IPR001680; KEGG: psl:Psta_3450
FT                   serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; WD40 repeat,
FT                   subgroup; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; WD-40
FT                   repeat-containing protein; SPTR: Serine/threonine protein
FT                   kinase; TIGRFAM: YD repeat protein; PFAM: Protein kinase
FT                   domain; WD domain, G-beta repeat; TIGRFAM: YD repeat (two
FT                   copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60665"
FT                   /db_xref="GOA:E8R5C4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C4"
FT                   /protein_id="ADV60665.1"
FT                   /translation="MTAERQATNPPPPGLEALTTPREEFPGSNADQPPAISDPTPSFAA
FT                   EEEEDLLGDAVERYLERIEAGAAPPLEEFLRDYPPELADDLRAALEGLRLVHGLAGSAS
FT                   SRLTKRPDHLEPGREIAGYRILGELGQGGMGVVFEALHLGLERPVALKVLRAGPGARGR
FT                   DRRRFLNEARVAAGLHHTHIVPVFDVGESHGLCYYAMQRIEGVGLDRVLRRRRLIQAER
FT                   PTHPLSTRPGPPTHLPAETSQTQAPSGSRPGGPDRSTDGPESDFELDLDLPSPVATPTG
FT                   PIFQPPEGSEYDRWVARVGLQAAQALDYAHQRGVIHRDIKPSNLLIDARGMVWVADFGL
FT                   ARRLSDPGLTHSGGVVGTPKYMSPEQAESKPLDGRTDIYSLGATLYELATLKPPFETTD
FT                   LNELIRSIVGVEPTAPRVHQPRIARDLETIILKAMAKRPEDRYRTAGELAEDLERFLNH
FT                   EPVKARRISPVGRLWRFARRNPAMSSVTLAAAAVITAVVTVAYLQVAADRDRAVLAQAE
FT                   LNREVLQRILGEASLIESSTTPDRRNRGLALILEARDRLEELTASPGPSTPITLINRTK
FT                   NGLPLTAVSPDLADLPLRLRDRAVGFLASRGVAHEGTLDAGRVLSLLFPDPNHLLSQSR
FT                   DGSELTVWNVTTRQDIQRHNLVAARDLLPSGTRRPSPLFGSGLALSPLGPLGPASGGRG
FT                   VVAFNPKTGHPTAPWLVDREFIYVITSIPGHRAVTIDRPVATQVGESRSFLIQLWNLDE
FT                   FLPRDSTSAPSDSPPNDSPSNVVQSETNGGRSHPPLSASETFATSTAFVPQPLASWDLL
FT                   VNVGNDLVPQLLDLSTDGRLLGFALFGGDEIRLVSGEDGSPLGEFVVASPVTWLAVAND
FT                   ALVAVATRETVQIWQAETGSPRAILETRLAPLRSLQFSPTDEFLAVTGSTTPGVELWDP
FT                   RSGQLVARLETDQLPERLAFSPDGRRLAVADASGQVRIWSIQAPIGLKRALELPTPANT
FT                   LDFNTAGRLTAAAPRPSLDQANPGNAADSSGNANSTVEGIGFNGGVWLLDPAVSSPSSA
FT                   TASPYKPSHQPFRLLTSSGLTSPDSSVIPIPSPQVQARFLHDDTLIAVDSRGIWLWSSD
FT                   HLRTPAPSPTLDPMDEEESWLDPESETQSDPPSDPVGHTGVLFLPAPGEEEVNRRTVGR
FT                   GRGGGPRLALSPQRTALTFFTRNRWWRGRADAVAAILSKPRSQSNVSSASWPFQPLIPP
FT                   PNEFPREPITALTINDAGDEIDSLDASNRLTRWKVDDAGRLRVVERIELPDRGVCLDIT
FT                   PDHRTLAVGLRSGSVALLRLPDPNTTSNASSQGSSLIMLAPPADDPAQPITALRWSGDG
FT                   RLLAVGSRDQVRLWINDSHNHPPQPWIRLPAGRGSVGALTFCPRGVTLAIATGDANVAF
FT                   WDLEHLRVELNRLRLD"
FT   gene            complement(100476..101465)
FT                   /locus_tag="Isop_0069"
FT   CDS_pept        complement(100476..101465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0069"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284: IPR007630; KEGG: psl:Psta_2501 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily; PFAM: sigma-70 region 4
FT                   domain protein; SPTR: Probable RNA polymerase sigma-E
FT                   factor; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: ECF sigma factor; TIGRFAM: RNA polymerase
FT                   sigma-70 factor, Planctomycetaceae-specific subfamily 1;
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60666"
FT                   /db_xref="GOA:E8R5C5"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C5"
FT                   /protein_id="ADV60666.1"
FT                   /translation="MIFLLLIVPPTLRTLGTRGPPRIKRGLVKSTRFTSRLRCRDDSKL
FT                   RQGVVSELFDRPRSERNQSGIVIEAPRSTPLLILSFYWTLMRDDGVSVARSRKLQATPA
FT                   MNPAVPPVELIARAKEGQAEALGDLCALYRNYLRMVVRSGLGAKLREKVELSDVVQEAL
FT                   VEVVRQFPQFTGTNEAALVGWMRRLVGQKLADLGRYHNRVKRAGGIAPLPLDVPVTPGG
FT                   EGGDSAVGGGPARLLDMLALSQTSPSEAASNRELTVLLADALAQLPSNEADVLWLYHVE
FT                   GLSFEAIGERLGISRKVARGIWARGLKTVKRQLEGPPGGSLKAEGFSP"
FT   gene            101547..101924
FT                   /locus_tag="Isop_0070"
FT   CDS_pept        101547..101924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0070"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: zpr:ZPR_2605 acyl-CoA thioester hydrolase;
FT                   PFAM: thioesterase superfamily protein; SPTR: Acyl-CoA
FT                   thioester hydrolase; PFAM: Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60667"
FT                   /db_xref="GOA:E8R5C6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C6"
FT                   /protein_id="ADV60667.1"
FT                   /translation="MKFRTRRLVLPKDLNSSQKLFGGRLLEWIDEECGIHAMLEMKTPR
FT                   VVTKVISQIDFKAPAVRGDVIEIGIDTIRYGRTSITLRIEVFNRTSGVTMLTIDQFVMV
FT                   SVDEHGQPTPHGVTGPETEEA"
FT   gene            complement(101985..102896)
FT                   /locus_tag="Isop_0071"
FT   CDS_pept        complement(101985..102896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_1977 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60668"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C7"
FT                   /protein_id="ADV60668.1"
FT                   /translation="MTVKRRQAFGLPVLDQALGGGLLPGTLTVVAGATGVGKTQLGLTW
FT                   AAQGRRDPAESCRGIVCDLASRGDSQNHAAYAQRLDDWILTEHPNTGPHDPALDPLEYP
FT                   FEFQRPLGDWFRPFHHAGKRVTRRDLEADAWHEWKVDLARTLRRAAAWHYAWFVRGVRR
FT                   VVFDGVEPTDRFADSIQFELFEYLYHQVLRREADWLAREVFRERFRSVADQVAHSDHRY
FT                   RHDEIGCLYLYTTPQVMLDDLVTAPISEGDLFANANTIIFMGRTKLNNGYGRALHVAKH
FT                   RGSVCDEGIKVYRIVESGLEFL"
FT   sig_peptide     complement(102798..102896)
FT                   /locus_tag="Isop_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            103420..105558
FT                   /locus_tag="Isop_0072"
FT   CDS_pept        103420..105558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0072"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG4964 Flp pilus assembly protein secretin
FT                   CpaC; InterPro IPR001775: IPR001814: IPR007055: IPR004846;
FT                   KEGG: rba:RB13104 type II secretion system protein; PFAM:
FT                   type II and III secretion system protein;
FT                   transport-associated; SPTR: Probable type II secretion
FT                   system protein; PFAM: Bacterial type II and III secretion
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60669"
FT                   /db_xref="GOA:E8R5C8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C8"
FT                   /protein_id="ADV60669.1"
FT                   /translation="MIARRFQTLLTRTHGLRRVGLTCWSAALISGSWGMAPSISFAQQP
FT                   PPVEVPTPAPAPVPLPEDPPLPTPIVPIPEVPPIPEAATLPATAATSAPARVAVRPAQD
FT                   GQAEPGNLPQALPNAAAENTPPLPEEVADPKMSAKELENLTPYTNIPNPRPITGQIAEL
FT                   FELIQDPSVELSVVVGRGKVIQLREQPLRFILGNPRIATLSFPPSDVQSLAQLDRPSDA
FT                   RLFVVYGIQAGTTTLTIWDKNNVPTTFLVRVSVDTLDIQNQIRAVFPGTDVTVRQSANQ
FT                   IILEGQVPDTKTMNEVIRLVNGLLVSNQAGEVRAPTGAGGGGGGQSVGAFAAAERALGD
FT                   EAPSGISPQIINRLRVPGPRQILLKVKLAELNRTAIREIGANWLRGRNNSLIGSQIGGI
FT                   AGFTTETNTQMTAAFAAPSFGRPGIAGGQPIPGSVTGSLIQGIDTLLNATAGSALQPSA
FT                   QLFGIFRAGEFDLFLNALRTNNLATILAEPNLTALDGQPARVIAGGEIPFPVPQLGAGG
FT                   GGGGAVITIQFRPFGAILTFLPQILEDDLIRLDVEPVFSTPNQGLGTSINGTAVPGFNT
FT                   RSARTVVQLREGETLAIAGLIQKNNQAATNRIPLLGDAPIVGPLFSRNRFETLETELIV
FT                   IVTPYLIAPMGEGEVPKVPTDYVDEPNDIEFFILGRTEGKTGIPHRSTIQHHTPFTLQK
FT                   HFASENQWVVGPHGHSSD"
FT   gene            105782..107053
FT                   /locus_tag="Isop_0073"
FT   CDS_pept        105782..107053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0073"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000209; KEGG: bja:blr0521 hypothetical
FT                   protein; SPTR: Blr0521 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60670"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5C9"
FT                   /protein_id="ADV60670.1"
FT                   /translation="MTLRKRPRTLGLAAGLTVGLTAWINPPGVAQPPMGPVLRSNADRP
FT                   ARVVAPEGPPIAFSAAPSPAPTPAPAASIPPPTFAGSSSPAFNPPPYPSPYASAFPYAA
FT                   QPPAGVMPAAYAPPAQAANLYPVSPVPAVAQPAASASATPAAQPQPGGTSPAYPVAAAG
FT                   SVPQLGGYPAPYYPAYPNMAPLPYPAVVPQVAMPQAPPPPPTKPMPQMPIFANPQGGGS
FT                   GSGRAGGMVYDPATGTWRPSPFAVLNPTGPAGGAAGTGSLLGGLRDRVLGWPEKFVEPP
FT                   LGAASNEFIELQRSKALEGKYTLYRSDFVSGTDRLSPGGANRLNRMATRLNRWMGPLTI
FT                   EWVPEDPAIGEARRNRIVSLLQGAGFNIAPEQVVVGPSPYEGLRGEEGVGHYNAIINRY
FT                   TQGLDSFQSNIAGGEALQTTGGGS"
FT   gene            107419..108360
FT                   /locus_tag="Isop_0074"
FT   CDS_pept        107419..108360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0074"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="COGs: COG5010 Flp pilus assembly protein TadD
FT                   contains TPR repeats; InterPro IPR019734: IPR013026:
FT                   IPR001440; KEGG: ade:Adeh_2822 TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; SPTR: Tetratricopeptide repeat protein; PFAM:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60671"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D0"
FT                   /protein_id="ADV60671.1"
FT                   /translation="MGSHVRTPSQCRLVGLAGLLSLTLAAGCQNVNGPKELANNAGRDG
FT                   LETVQGSHSFTAKVTDQQAYNVHMDLGRVHELRGAHEAAIAEYLQALEVCERSPGRGLL
FT                   HVAAGSNLNARKAKAHRRIASAYDRLGQFAQAETHYRLALQLTPNDHHIWNDAGYSYYL
FT                   QNRWSDSERALRTAASMAPEDSRVQINLGLTLAASGKIDEAYNCLAKVAGPAVAHANLG
FT                   YILAASGKRAEAREHYMAALRLQPEYTPFQRALRKLDEEIQTAGGGVTPKPSFLAVQPE
FT                   PTAFWQDPKIARASAITGIPMPRPLDLTLKAN"
FT   sig_peptide     107419..107532
FT                   /locus_tag="Isop_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(108535..108843)
FT                   /locus_tag="Isop_0075"
FT   CDS_pept        complement(108535..108843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg8032 hypothetical protein; SPTR:
FT                   Chromosome 10 SCAF15123, whole genome shotgun sequence."
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60672"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D1"
FT                   /protein_id="ADV60672.1"
FT                   /translation="MFLDVVPTFETPPSKPFPKGTTRTAERDEGGWTTIERKQKQKQKR
FT                   NRIEFGRWSRRDEPEPWRGEPEVSESEEGTVLPELRDQAEHRHCLQESINLFILFIQ"
FT   gene            complement(108850..110532)
FT                   /locus_tag="Isop_0076"
FT   CDS_pept        complement(108850..110532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0076"
FT                   /product="Heat shock protein 70"
FT                   /note="COGs: COG0443 Molecular chaperone; InterPro
FT                   IPR001023: IPR018181: IPR013126; KEGG: cac:CA_C0472
FT                   HSP70/DnaK family protein; PFAM: Heat shock protein 70;
FT                   SPTR: Chaperone protein dnaK; PFAM: Hsp70 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60673"
FT                   /db_xref="GOA:E8R5D2"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D2"
FT                   /protein_id="ADV60673.1"
FT                   /translation="MSDAPSSHHAIKKVFGIDLGTTYSAIAYVDEHGKPVVVPNQESER
FT                   ITPSVVLFDGESVIVGNTAKESAKVEPDKVASLFKQHMGDPHFVFKVGGQSYSAEDLSS
FT                   FVLRKVVGDAERALGEEIRDVVITCPAYFGISEREATANAGRLAGLNVRAILNEPTAAA
FT                   IAYGLEQEEDQTVLVYDLGGGTFDVTMIAIKDRLIQVICTGGDHRLGGALWDEAIVVHL
FT                   ASEFQEQTGCAEDPMDDPEVLNDLFLQAERGKKTLTQRDKAPFRVTHAGHQARVELDRS
FT                   KFEEITKHLLDRTIELTREMLAEAKAKGYETFSKIILVGGATRMPQIKARLIQEFGKEP
FT                   EIFDPDEAVAKGAALYGLKEALQQEVKEILAVHHPQAEAASGGLDLEAVTTAQVEQALD
FT                   TIEARIGFTLTGPVRELVNTKIVNVLSKSLGVVAKDHTNHDVVVYLLRRNTEVPAQSVQ
FT                   DFGTDQANQIAVDIKVVAGETASTNPADCQEVGVATLTLPENLPAQSPIRVVFAISQDG
FT                   RLSVTGTDLTGGGSIEVEFETEAVMSNEEVETRSTALRMIPVS"
FT   gene            complement(110670..111377)
FT                   /locus_tag="Isop_0077"
FT   CDS_pept        complement(110670..111377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0077"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675; KEGG: noc:Noc_1193 abortive
FT                   infection protein; PFAM: Abortive infection protein; SPTR:
FT                   Abortive infection protein; PFAM: CAAX amino terminal
FT                   protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60674"
FT                   /db_xref="GOA:E8R5D3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D3"
FT                   /protein_id="ADV60674.1"
FT                   /translation="MNRTEFLVSLVVLEVGLLALAHVLGWWFEQPMTGLIRWSGLGLAV
FT                   GVAGTIPLYVLFLAGRRWPPRWLRGIDEFMDREIVGILRQLNLVELIAAALLAGVCEEF
FT                   LFRGFIQGGLSEWLGVWWGLALASLLFGVSHAVTPGYAVVATLIGAFLGWMWITTEDLG
FT                   APILTHMLYDGLVLMHLSGRWPTPRPAWSRSEPGDQPPRRSESNARANTDSDADSDSDP
FT                   RSVDPLTSRTKRP"
FT   sig_peptide     complement(111315..111377)
FT                   /locus_tag="Isop_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            111844..112947
FT                   /locus_tag="Isop_0078"
FT   CDS_pept        111844..112947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0078"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="InterPro IPR000866: IPR005123: IPR006620; KEGG:
FT                   rlg:Rleg_5934 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   2OG-Fe(II) oxygenase; SMART: Prolyl 4-hydroxylase alpha
FT                   subunit; SPTR: Alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60675"
FT                   /db_xref="GOA:E8R5D4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D4"
FT                   /protein_id="ADV60675.1"
FT                   /translation="MLTVGDPAPWFHARSSVNPNFHFDTAAGRYLVLCFFGSSSDPAAR
FT                   RVLSDLEHATDLSNIVNCCFFGVSRDPADEHEARLPTGKPGLIWFWDFDNAIGRLYGVP
FT                   DSQTPRKDDAAEGDRFASQITYVLDPRLRVVARVPFAPDPARHVPNLVRIVRALPPVSS
FT                   LAEAHAPVLVVPHIFEPHFCRQLIEIYEADGGYESGFMREVGGKTVPVHDHSHKRRRDC
FT                   EIKDLQVIQACQMRLKRRLIPEIHKSFQFEATRIERHIVACYDASTGGHFRAHRDNTTK
FT                   GTAHRRFAISLNLNDDFQGGDLRFAEFGPRTYRAPVGGAVVFSCSLLHEATPVTAGKRY
FT                   AFLPFLYDDVAAEIRRRNAQFLAPGPN"
FT   gene            113129..114184
FT                   /locus_tag="Isop_0079"
FT   CDS_pept        113129..114184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0079"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: plm:Plim_2996 oxidoreductase
FT                   domain protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Oxidoreductase domain protein; PFAM: Oxidoreductase family,
FT                   NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60676"
FT                   /db_xref="GOA:E8R5D5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D5"
FT                   /protein_id="ADV60676.1"
FT                   /translation="MATIRIGIAGIGFMGMIHYLAAQRAEGVTVAALQSRSAKKRAGDW
FT                   TDIQGNFGPRGGMMDLSGVRVHERFEDLLADETVDLVDLCVPNPEHSCLAIQALEAGKD
FT                   VLVEKPIALRVDDADAMIAAARRFGRLVMVAHILPFFPEFEFAYQAVASGEHGRLLAAH
FT                   FTRVISRPDWGNAGDFVSGGGPAIDLHVHDTHFVDLVCGPPRAVRSRGVVESGVVIHLD
FT                   THYHYPDGGPIVSAVSGALATAGRPFSHGFELYLERATLSFRFDNLADEPRLSPLTIIH
FT                   ANGQIERPQLGSGDPIDAFARELEEAGRAVAGRVESRMLSASRARRALRSCLAEVESVL
FT                   TGLAVNLSDSE"
FT   sig_peptide     113129..113194
FT                   /locus_tag="Isop_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(114225..115163)
FT                   /locus_tag="Isop_0080"
FT   CDS_pept        complement(114225..115163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0080"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: plm:Plim_2033 regulatory
FT                   protein ArsR; PFAM: regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR; SPTR: ArsR family transcriptional
FT                   regulator; PFAM: Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60677"
FT                   /db_xref="GOA:E8R5D6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D6"
FT                   /protein_id="ADV60677.1"
FT                   /translation="MMNIHALMRTTDGVWIQLNGPRDAVDRLIDDLAARHQATVEGNGP
FT                   AATSALLTPTPAQIPPGQTADDRGASLPQLPAFPPNPNAQATRIAGPDRGQLKLAKLAR
FT                   IFQLLADSTRSALVNQLNQSSRSVTELCMGLSGQSQPSVSHHLALLRSARIVESDRAGK
FT                   FNYYSLTPLGHRVAELLNQLRDYARAAGETDVDLLAKPLADASRLMILLTLKRDGWRSV
FT                   SSLVKALPDQSQPSVSHHLGTLRDAGFVINRREGRFIHYALAPRGEALVGAFLKIFRTA
FT                   AKPQPADEQQHQSSQLGGDDSSPARPSTQPN"
FT   gene            115700..116518
FT                   /locus_tag="Isop_0081"
FT   CDS_pept        115700..116518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0081"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="InterPro IPR014284: IPR000792; KEGG: bxe:Bxe_C1157
FT                   two component LuxR family transcriptional regulator; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   SPTR: Putative uncharacterized protein; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: Bacterial
FT                   regulatory proteins, luxR family; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60678"
FT                   /db_xref="GOA:E8R5D7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D7"
FT                   /protein_id="ADV60678.1"
FT                   /translation="MLKNLPLNPLNLTLSLPRLSRSSEVCGEFVEGSSATSSAASPEPR
FT                   AAAVADGCTPDGSSPAAAAVAPTAVSRSRAVGTRTMALVVGLAALTAQVSSETDLVRDI
FT                   QRYCAVCWRNARLDPGLWDDCTQEVCCRLLAKARAGELDLDRVLDEDSPERRELVRAID
FT                   MVRKRVQRSRKVQPLDERVIGGVDWDERERSRRELGEVLESARAAALTPRQDRILDLWL
FT                   QGFTVPEIAEELAMSPARVSDQKYKALRRLERHLAGRSDLDRDHKTGVSV"
FT   sig_peptide     115700..115780
FT                   /locus_tag="Isop_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            116717..118855
FT                   /locus_tag="Isop_0082"
FT   CDS_pept        116717..118855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0082"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="COGs: COG0465 ATP-dependent Zn protease;
FT                   InterProIPR005936: IPR003960: IPR003959: IPR000642: IPR
FT                   003593; KEGG: plm:Plim_1623 ATP-dependent metalloprotease
FT                   FtsH; PFAM: peptidase M41; AAA ATPase central domain
FT                   protein; PRIAM: Microtubule-severing ATPase; SMART: AAA
FT                   ATPase; SPTR: Cell division protein FtsH; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: Peptidase family
FT                   M41; ATPase family associated with various cellular
FT                   activities (AAA); TIGRFAM: ATP-dependent metalloprotease
FT                   FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60679"
FT                   /db_xref="GOA:E8R5D8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D8"
FT                   /protein_id="ADV60679.1"
FT                   /translation="MENPRPASGKDSPASEKSDGNGSLGRGSRSDFSKAEGNGSSSGGG
FT                   SSTPSWLLIVLILVIVFIVLNNPFKAETMVDFHPWFTQQVAEDNVKSLVIQGTKARGQL
FT                   RKPTNFTPPGQGVGREIDKFSVYFPTEDDQKEIVKRLQQDRDPLTGKERQFVRIEGEAP
FT                   PDRSGLMWATLLLPILLMVLIVWFMMRRARDQFDGGILGSFVKSPAKRHDKSKQRTTFD
FT                   EVAGLESAKYELQEIVEFLKNPEKFARLGGRIPKGVLLVGPPGSGKTLLARAVAGEAGV
FT                   PFFSISGSEFIQMFVGVGASRVRDMFKTAKENSPCILFIDEIDAVGRIRGAGLGGGHDE
FT                   REQTLNQILTEMDGFSPNESVIVLAATNRPDVLDPALLRPGRFDRHVTVDRPTKKGRLE
FT                   ILKVHTRNVPLADDVDLEAIAKSTVGMSGADLANLVNEAALIATRQDKDKVEAADFEAA
FT                   RDRVLMGARREEVITEKDKRMTAYHEAGHALVAWLTPQADPVSKVTIIPRGRSLGTTQF
FT                   IPEEDKVSYSESEIHARLAMTLGGRAAEKLVYNDLTAGAANDLKQATRLARMMVTQWGM
FT                   SDRIGPVFFQSSEEHPFLGREMSEIRDHSEATARVIDEEIARILRAADEHAYSLLSTHR
FT                   NELEKLAEALIEREVLSVKDIEELIGPRAGDKEKAVSTSTNGQASRASAGYVDGEARTA
FT                   AAPASTGDGPPLHHGEGE"
FT   sig_peptide     116717..116743
FT                   /locus_tag="Isop_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            118942..119925
FT                   /locus_tag="Isop_0083"
FT   CDS_pept        118942..119925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0083"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139: IPR011611; KEGG: syx:SynWH7803_0167
FT                   ribokinase family sugar kinase; PFAM: PfkB domain protein;
FT                   SPTR: Putative sugar kinase; PFAM: pfkB family carbohydrate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60680"
FT                   /db_xref="GOA:E8R5D9"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5D9"
FT                   /protein_id="ADV60680.1"
FT                   /translation="MSRPSPTVVCAGVVVADHLSPPISHLPRAGELVACDDLVLAIGGC
FT                   ASNAAAALAKLGVHAAVLGKVGDDVFGRFVAETLRAQGVDDRLLAIDRSRATSQTLIVN
FT                   VKGEDRRFIHCFGANQGLTVGDLAAAFDSLWAEGASPSVFYLGGYLILPGVDPTDLAAF
FT                   LHDLRGRGITTLLDVATPGPADYLSKLTPVLPEVDVFLPNTDEAKLILGESDPIRQAQA
FT                   FRDLGTRRVVVTMGEAGAVALSDHLRAKLGVFPVEFVDGTGGGDAFDAGYIAGLLDGLD
FT                   EVGCLTFASALGASCVRAVGTTAGLFNRKQLQTFIQDHTLPIERLA"
FT   sig_peptide     118942..118989
FT                   /locus_tag="Isop_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(120029..120847)
FT                   /locus_tag="Isop_0084"
FT   CDS_pept        complement(120029..120847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0084"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="COGs: COG0560 Phosphoserine phosphatase; InterPro
FT                   IPR006383: IPR006385: IPR005834; KEGG: hch:HCH_05985
FT                   phosphoserine phosphatase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Phosphoserine phosphatase;
FT                   TIGRFAM: HAD-superfamily subfamily IB hydrolase, TIGR01490;
FT                   HAD-superfamily hydrolase, subfamily IB (PSPase-like);
FT                   TIGRFAM: HAD-superfamily subfamily IB hydrolase, TIGR01490;
FT                   Haloacid Dehalogenase superfamily, subfamily IB,
FT                   phosphoserine phosphatase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60681"
FT                   /db_xref="GOA:E8R5E0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E0"
FT                   /protein_id="ADV60681.1"
FT                   /translation="MSNANESVPPRPFDASASSLTGSAAVDPQAPRVIGRDDHDWPLFD
FT                   PAPAAVLLDVDGTLLPNTTTFLFARMLRRRGFIKRSILLRALYHGLQHHFGQLDYAKLV
FT                   EFACSNLTAIPDGQLRAMAEENFELQVKPRLFLGVVDHVRWLRDQGAAVAMVSSSPEVV
FT                   LRPLADHLGCNDLLTTPVRVENGRFLGLGDGPPCYGAGKLHWAQVWAKSRGIRLDHAAA
FT                   YADNWSDRPLLEAVGVAAVVHPRCRLRQLARERGWLILRPRVAASRSRAH"
FT   gene            complement(120844..122343)
FT                   /locus_tag="Isop_0085"
FT   CDS_pept        complement(120844..122343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0085"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterProIPR005841:
FT                   IPR005844: IPR005845: IPR005846: IPR 005843; KEGG:
FT                   rba:RB9832 phosphomannomutase (pmm); PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphomannomutase (Pmm); PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60682"
FT                   /db_xref="GOA:E8R5E1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E1"
FT                   /protein_id="ADV60682.1"
FT                   /translation="MDSVESTHPNHPDPRSTTHQPWSTSMFQTRDEPIVRIASVSGLRG
FT                   IVGRGLDPVVIASFAGAYAATLRFGAVSNEVPHSCNDAPPLVLIGHDGRSSAPLFMPVV
FT                   ASALAGSGCRVIEVGPVATPTLGFLTKRLGAQGAAQLSASHNPPEYNGLKFFQPEGMVL
FT                   DPEQGYEVARRFETGSFAWAGLERLGTVEPFAGNPHADHVAAVLARVEVEAIRARRFRV
FT                   LVDSCHGAGGAAARLLLERLGCDLIALGDQPDGRYDHPPEPLAENLVETAAATRDQGAA
FT                   VGFVQDPDADRLAVIDEHGRYLGEELTLALAASVVLARDPGPLVINLSTSSVSARVARD
FT                   LGCPVVRSPVGEIHVVHAMKRAGASLGGEGNGGVIDPRVGLVRDSLLGIALILDRIATD
FT                   PLNRPLSAIADALPRLTMLKRKFARDPQANLLQLWDRIAAECPEASADRRDGLRLDWPD
FT                   GGFVHLRASNTEPIVRAIVEHDDPARAEELADRMQRRLAAG"
FT   gene            123602..124831
FT                   /locus_tag="Isop_0086"
FT   CDS_pept        123602..124831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0086"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="COGs: COG0677 UDP-N-acetyl-D-mannosaminuronate
FT                   dehydrogenase; InterPro IPR017476: IPR001732: IPR014027;
FT                   KEGG: nml:Namu_4191 nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase; SPTR: Nucleotide
FT                   sugar dehydrogenase; TIGRFAM: nucleotide sugar
FT                   dehydrogenase; PFAM: UDP-glucose/GDP-mannose dehydrogenase
FT                   family, NAD binding domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, central domain;
FT                   UDP-glucose/GDP-mannose dehydrogenase family, UDP binding
FT                   domain; TIGRFAM: nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60683"
FT                   /db_xref="GOA:E8R5E2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E2"
FT                   /protein_id="ADV60683.1"
FT                   /translation="MVIETTDGWLGGTRFDLDICVVGGCGHVGLPLAITLADAGFSVAV
FT                   HDINDDAVRLVNDGRMPFLETGAEEVLRRVVGRSLIVANDPTLVKRARVVIVVIGTPVD
FT                   AHLNPTFHVMKRFVKGMLPLMADGQTLLLRSTVYPGTTEKIHELIRKAGREIAVAFCPE
FT                   RVAEGKAMEELRVLPQIVSGCSPKAIADAREVFGRIAVDLIELTPIEAELTKIFTNVWR
FT                   YIQFAIANQMFMIAAEHDLDFYRIHEAMTRDYPRMKGLPRAGFAAGPCLFKDTMQLAAV
FT                   ANNTLALGHAAMLINEGLPNFLVKRLRLKYDLASMCVGILGMAFKAESDDPRESLSYKL
FT                   RKILEYEAREVVCTDVYINDPRFLPLEEVLTRADLLIVGAPHHQYRELGLPPGKPVVDI
FT                   WNLYGGGAAL"
FT   gene            124839..125870
FT                   /locus_tag="Isop_0087"
FT   CDS_pept        124839..125870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0087"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509; KEGG: mmi:MMAR_2310
FT                   UDP-glucose 4-epimerase, GalE5; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: UDP-glucose 4-epimerase,
FT                   GalE5; manually curated; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60684"
FT                   /db_xref="GOA:E8R5E3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E3"
FT                   /protein_id="ADV60684.1"
FT                   /translation="MPRTLVTGAAGFIGGYVVEELLRRGHEVVGLDNYSKYGPVSHRFD
FT                   TDPRYRFVQGDAKDVELVKQLVVDCDHFIAGAAIIGGIALFHQRAYDLMAENERIAAAA
FT                   FDAAIAAHDQGRGRLVKITVVSSSMVYERAEVFPTPEGHQRECPPPLSTYGFQKLALEY
FT                   FAQGAWEQYRLPYTIVRPFNCVGLGEKRAVGDYDVTSGDIKLAMSHVVPDLCQKVLKGQ
FT                   DPLRILGDGHQVRHYTHGSDLARGIVLAVESPAALNEDFNLSTDRSTTVLELAQLIWRK
FT                   VKGPDVPFRYESDPPFTYDVQQRIPDVSKARRLLGFEAKIELEDMLDELIPWIRRQIEV
FT                   GGI"
FT   gene            125918..128383
FT                   /locus_tag="Isop_0088"
FT   CDS_pept        125918..128383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0088"
FT                   /product="peptidase S9B dipeptidylpeptidase IV domain
FT                   protein"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; InterPro IPR002469;
FT                   KEGG: hoh:Hoch_4258 peptidase S9B dipeptidylpeptidase IV
FT                   domain protein; PFAM: peptidase S9B dipeptidylpeptidase IV
FT                   domain protein; SPTR: Peptidase S9B dipeptidylpeptidase IV
FT                   domain protein; PFAM: Prolyl oligopeptidase family;
FT                   Dipeptidyl peptidase IV (DPP IV) N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60685"
FT                   /db_xref="GOA:E8R5E4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E4"
FT                   /protein_id="ADV60685.1"
FT                   /translation="MQLFEYSLIWMLVWRSASLIGLEPSGSIIRVLPTSWMVATPTCAA
FT                   EFPAMTTPSPLPSPRPQFSARRVLSVSRRQDRAGTLDVATAARLPAPGLAMPSGFEFDS
FT                   TGQTLWYLKSEGTELDQVVWRFEVTRPQEPPRVVTRPPDRGDTDANLPLAEQLRRERQR
FT                   QRVTGVSRFLPAPEGHRLLIPLQGDLYLQEGDGPLQRLTNTESPELDPQWSPRGDRVAF
FT                   VRDGELVVLDLTTRRETALTAGAEEGMVHGLAEFIAQEELGRSSGFWWSPQGSKLAYQI
FT                   TDERHIPPLTIVYPAADESDPRRLETHRYPFAGEANARVALAVVPVNGGPARRLDLAVG
FT                   MEDFYLARVDWETETRVLVQTLSRDQTRLVLSRHHLDCDPIKVEILIDERQEPWINLHD
FT                   DLRVIEETGELLWTSERTGYRHLELRDAQGRLVRVLTAGEWMVDEVVHVDAARREVWFT
FT                   AWSGLTDPTGSGLFRVSLDGQGPSNDGPPSPQPVPTGHEGMLTSVVVAPDASKFVAVGS
FT                   RLDRPPTAVLYDRQGHPLATLADGRDDPRLEALGLVPPVPHRFEHDGWTFHGLLYRPRS
FT                   NALQRDGLAPLVVMLYGGPHAQYVQNSWNQTADLVAQLLAERGFAVWKMDNRGSARRGR
FT                   GFEAALHRRMGSVEVADQVAGVAYLLNHEPGLDGRRVGVYGWSYGGYLTLKCLMGAPET
FT                   FHAGVAVAPVFSWDGYDTAYTERYMGTPHSNPEGYRASSVASDVERLEGALLVLHGMID
FT                   ENVHFRHTARLTAALIAAGKPFQVMPYPEGRHSIRKPEERRDLLERLVVHFENALGPCP
FT                   PRGSGSSTR"
FT   sig_peptide     125918..125974
FT                   /locus_tag="Isop_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            128505..131234
FT                   /locus_tag="Isop_0089"
FT   CDS_pept        128505..131234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0089"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="COGs: COG1331 Highly conserved protein containing a
FT                   thioredoxin domain; InterPro IPR010819; KEGG: bts:Btus_0399
FT                   protein of unknown function DUF255; PFAM: N-acylglucosamine
FT                   2-epimerase; SPTR: Putative uncharacterized protein; PFAM:
FT                   N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); Protein
FT                   of unknown function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60686"
FT                   /db_xref="GOA:E8R5E5"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E5"
FT                   /protein_id="ADV60686.1"
FT                   /translation="MTTRGIAERRSRLRISDGTATESRTLWRGIMGISVSAIAFCATPG
FT                   SSPAVQPPDVSDPIAAPSPSHNHLAGETSAHLRRHADTPVDWWPWGDEAFARARAEDKP
FT                   VFLSSGYLACHWCHVMERECFRDPAIAARLNRDFVCIKLDREERPDVDQTYLTALRTFG
FT                   TGGWPMSIFLTPEGKPFYGGTYFPPEDRPGLTGFSTVLDRVARAWREDRDRIERVAGEL
FT                   DAMVGRILVRRAASSVLGPPPVLSSDLTDACYLILCGEFDPEYGGFGFDRTNPRRPKFP
FT                   EPSRLLFLLERHAALKERPRPVKTPARSLLMLDPGPAAAPLIRRAPLDMALFTLDRIAR
FT                   GGLRDHVGGGYHRYCVSRFWIVPHFEKTLYDNAQLARVFVRAFELTGDPRWRDEAEAIF
FT                   DFVAREMTLPEGGFLSALDAESRDEDGGEYYLWTRPQVEQALANPEESRIVLQVYGMLR
FT                   DPNFEGGRYVLLEPRERSEHARALGLELPELTRRLDAARRRLHQVRDQRPAPRKDDKAI
FT                   AGWNGLMIAALAEAGRVCDHNRDRYLKAAQRAAEFAWTQFRREQDRLARTWRQGVAKGE
FT                   GFAEDYAFLAEGLLRLYRADGDPRWLERARRLTERMRHDFGDPDPNRGGLFFASRRDAR
FT                   LPARFKDPLDSVLPSANAVAARVLIELGRLDDDPQRYDQAEAILREFLPDLARRPGVWP
FT                   MMMVALEELLQVRPELSKAHFSAPSVDNPLDGKLTSRNTLPVQARLEALEEAVQFLRRG
FT                   REAEVKLILTIRPGWSVLSANPFPLTPRRNVASASGLVTLPNREGEDAIPQPLAIELDP
FT                   DAAQHFELVDVRFPPGRLKPLETPRTEAAASNADRPASLGRTIEVYEARVEVIARLRPH
FT                   AQRSNFARLGFRIRYQACEDRVWSAPAELSVEKDLEPR"
FT   gene            131307..132593
FT                   /locus_tag="Isop_0090"
FT   CDS_pept        131307..132593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0090"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000253: IPR000160; KEGG: afw:Anae109_4141 diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein;
FT                   Forkhead-associated protein; SMART: GGDEF domain containing
FT                   protein; Forkhead-associated protein; SPTR: Diguanylate
FT                   cyclase; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain;
FT                   FHA domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60687"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E6"
FT                   /protein_id="ADV60687.1"
FT                   /translation="MNPSAAVDQGPFPRRDPTWVVKLGASRDEDGNVSLQYSGHTTPVL
FT                   IAQPAKNRAETAPCLIVYDGALAGAIHKLSQLRTQVGRSAYSDLRFLERTVSRRHALLE
FT                   INPLGQVVLTDLGSTAGTFVNGLRLPAHRSRLLTPGDQIRFGEQVVVCFNQLDPLEEEA
FT                   YRERFRRAVSDPLTGLYNRLYFLEEIYHWVERHPRRSSGLALLLIDLDHFKNVNDEHGH
FT                   AVGDRVLRLVAEVLERALGEEALLSRFGGEEFIAAMEVSDLDAACALANRVREEVARRP
FT                   YRPFGYGGSVQLSLTLSVGVAYLPPRGDPVEPDQMIRAADLCLGQAKRRGRNRVISERE
FT                   YAPARLIGLEFDTTTLMGQAITERIVPVSPPKAVPPPEQAAKPSQASESSTPRHIGSLS
FT                   DSSEHWVRAFRRRMLEADQLDRPAQPSPE"
FT   gene            complement(132672..133523)
FT                   /locus_tag="Isop_0091"
FT   CDS_pept        complement(132672..133523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0091"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307; KEGG: plm:Plim_3631 xylose isomerase
FT                   domain protein TIM barrel; PFAM: Xylose isomerase
FT                   domain-containing protein TIM barrel; SPTR: Xylose
FT                   isomerase domain protein TIM barrel; PFAM: Xylose
FT                   isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60688"
FT                   /db_xref="GOA:E8R5E7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E7"
FT                   /protein_id="ADV60688.1"
FT                   /translation="MIGLAICNELFENWEFERVCDTVKALGYDGLEIAPFTLAPRISAV
FT                   GLAERNRLARVMTDRGLRCVGLHWLLAKTEGFGLTHPDPSIRRATADYLIELAEATGDL
FT                   GGSLMVLGSPKQRDLAPGVTYEQGVAYLIEAIEHLLPTLERRGVDLCLEPLAPAETNFL
FT                   NTCAQTVAILERLGHPERVKLHLDVKAQSSETEADVPTLIGRYAKFAGHFHANDVNLRG
FT                   PGMGEVDFKPILAALVASGYDRFVSVEVFDFSPGAEETARISIQTLKDARDAAIRSPTI
FT                   AS"
FT   gene            complement(133520..134440)
FT                   /locus_tag="Isop_0092"
FT   CDS_pept        complement(133520..134440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0092"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+); methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="COGs: COG0190 5 10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase;
FT                   InterPro IPR000672: IPR020867: IPR020630: IPR020631; KEGG:
FT                   acr:Acry_2656 methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+)); PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain; PRIAM: Methenyltetrahydrofolate cyclohydrolase;
FT                   SPTR: Bifunctional protein folD; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60689"
FT                   /db_xref="GOA:E8R5E8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E8"
FT                   /protein_id="ADV60689.1"
FT                   /translation="MMARVIDGKTHAARERAELAQKVATFRRVVGYAPRLDVVLVGDHP
FT                   ASAVYVRNKEKAREQAGMEGRVHRLPAETAQHELAALVADLNHDPNVHGILVQLPLPAH
FT                   LDAQAILEAIDPRKDVDGFHPENVGLLALGRPRFVPCTPLGVMRLLKAEGIATTGREAV
FT                   VLGRSAIVGLPMSLLLAARGTGDATTTICHTATPDPRAVARRADLLIVAMGRAETVDAD
FT                   WIKPGAVVIDVGIHKRDDGRLVGDVVFESAARVATAITPVPGGVGPMTIAMLLNNTYEA
FT                   ARAALAHSGGVGLLASLSEEGCVST"
FT   gene            complement(134560..135090)
FT                   /locus_tag="Isop_0093"
FT   CDS_pept        complement(134560..135090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0093"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="InterPro IPR002645; KEGG: tle:Tlet_0344
FT                   anti-sigma-factor antagonist; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR:
FT                   Anti-sigma factor antagonist; PFAM: STAS domain; TIGRFAM:
FT                   anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60690"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5E9"
FT                   /protein_id="ADV60690.1"
FT                   /translation="MLKPSLQTKVEEGFLIGEFWDCRRLDLKPVEELARVFESHLAHGG
FT                   HPELVIDLSGVEYAGSTVLGTLLRMQKMAVSRGGLVILCRVDPSVREPFLAVRVEGLFR
FT                   FVAELEDALALARERAAARKARGQDGANPGRARQGLSTITRRAGPLRRARRQVNSNPEP
FT                   GDPSPEGVSSGEE"
FT   gene            135419..136711
FT                   /locus_tag="Isop_0094"
FT   CDS_pept        135419..136711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_3676 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60691"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F0"
FT                   /protein_id="ADV60691.1"
FT                   /translation="MKSQGDGGESMVVGLDFGARYTKALFRSSDPNDRIPRLLRFSERA
FT                   SDGEDLPFAAFSAIAFSNGTVTFGTEAMRKPANQRHDLLKLGIVDTERFRRRATASGPP
FT                   VEVMAALFLAWALGRVRRSLEAEHPGASFVVNVAAPMDHRGDVRIKQRYRRILHAAWTM
FT                   AMDAEEPEIGDAVSQYTAVGRAERLLSEHPQDDGIARWRIVPETIPPIVSILRTPGSRS
FT                   QCEGIFINVDMGAATTQVSINRLNDAYPHATPSGRVICLADESHRLGCDEFSGSYEAEK
FT                   ATKLAKLLAEVHRGSLERQETELRQMAWDHRRLVVFTTGGGCRRSDVRFSLQERFAQWG
FT                   RSESEAGHSADEGRALRFLNHEPVVHGLVSEKELALRSFLTVAHGLCWDRWEVWPTFVE
FT                   SSQADAEPTNEQAASNAAPIPPNTPWIGSHH"
FT   gene            137010..138683
FT                   /locus_tag="Isop_0095"
FT   CDS_pept        137010..138683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0095"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase; InterPro
FT                   IPR000891: IPR005675: IPR002034: IPR013709; KEGG:
FT                   plm:Plim_2070 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation)
FT                   domain-containing protein; SPTR: 2-isopropylmalate
FT                   synthase; TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: LeuA allosteric
FT                   (dimerisation) domain; HMGL-like; TIGRFAM:
FT                   2-isopropylmalate synthase/homocitrate synthase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60692"
FT                   /db_xref="GOA:E8R5F1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F1"
FT                   /protein_id="ADV60692.1"
FT                   /translation="MARRITLYDTTLRDGSQGEGINFSLQDKLLVTRRLDELGIDLIEG
FT                   GYPLSNPKDAEYFRAARELDLKHARIAAFGMTRRKGIDPSRDVGLRALVEALTPVVTVV
FT                   GKSWDLHATEVLEVSLEENLAMIADSVAFLKAAAHRPELVYDAEHFFDGYRHNPDYALR
FT                   TIHAAAEAGANWIVLCDTNGGALPEQVARAVAAVRAALPATVGLGIHTHNDGDLAVANT
FT                   LAAVLNGADQVQGTINGIGERCGNVDLCSVIANLALKYDGFDLLQPGRLAKLTEVSRYV
FT                   YEIANLNLRNGQAFVGPSAFAHKGGMHVHGVRKVASSYEHINPELVGNERRVLVSELSG
FT                   KSNIAEKMKEYRLDSDPALMAKVLDTVQDLENQGWQFEAAEASFVLLVEKLAGRFRPHF
FT                   ECLSYRVAVVGERGAGFAPVTEATVKVKVGEVVEFTVSEGDGPVNALDSALRKALEPHF
FT                   PVLAEMRLVDFKVRVINERAATAARVRVVIESRDHDALWGTIGVSENMIDASWQALVDA
FT                   FEHKLAKEDRRSGLVSASTSTSTLAPLPARPAAASPAVST"
FT   gene            138899..141697
FT                   /locus_tag="Isop_0096"
FT   CDS_pept        138899..141697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0096"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="COGs: COG0525 Valyl-tRNA synthetase;
FT                   InterProIPR002303: IPR019754: IPR001412: IPR002300: IPR
FT                   013155: IPR019499; KEGG: plm:Plim_2069 valyl-tRNA
FT                   synthetase; PFAM: aminoacyl-tRNA synthetase class Ia; tRNA
FT                   synthetase valyl/leucyl anticodon-binding; Valyl-tRNA
FT                   synthetase, class Ia, tRNA binding arm; SPTR: Valyl-tRNA
FT                   synthetase; TIGRFAM: valyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (I, L, M and V); Anticodon-binding
FT                   domain; Valyl tRNA synthetase tRNA binding arm; TIGRFAM:
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60693"
FT                   /db_xref="GOA:E8R5F2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F2"
FT                   /protein_id="ADV60693.1"
FT                   /translation="MSAAAELPKQYDPRAAQERWYPFWLEQGYFQADPASSKPPYVIVI
FT                   PPPNVTGALHLGHALNNTIQDILIRWRRAQGYDALWLPGTDHAGIATQAVVEKRLFQEE
FT                   KKTRHDLGRDELVRRIWAWKEEYEARILNQLQRMGCSCDWSRTRFTLDEQCARAVRVAF
FT                   FRLFEAGLIYRGKRLVNWDTHLQTAVADDEITYSEVQSSIWTIAYPLADDPTTRLQVAT
FT                   TRPETMLGDTAVAVHPEDERYRHLIGRSVRLPLLGRTIPIIADGLLVDPSFGTGVVKVT
FT                   PAHDPNDYQTGLRHNLPMINLLNPDGTSNTQAGPYAGLPWAEVRKRVVADLEAQGLLVA
FT                   VQPHLNRVGFSDRSATPIEPYLSDQWFVAMSDLAQRAMDAVTSGQVRFHPERYAKSYLD
FT                   WLGEKRDWCISRQLWWGHRIPIWTCDQPDVTEEELRAAFGERSNLRWHQGEDGRWLICA
FT                   LEDLSPDALPGRTLTQDPDVLDTWFSSALWPHSTLGWPEATEDLKKYYPTSVLSTARDI
FT                   ITLWVARMVMFGQFNLNEVPFRDVYIHPVIQDGQGRRMSKSLGNGIDPVDVIELYGADA
FT                   LRFTLASSATETQDLRMPVEQVQLPDGRKVNTSERFEQGRTFPNKFWNAARFALMNLEG
FT                   HQALEYDRASLPVEDRWILSLLARASRTITADLEAFRFAEMAKTTRDFIWGDFCDWYLE
FT                   LVKGRLRNPETRPTAQRVLAGVLDQLCRLIQPMMPFVAEQVWQALGNLAPERSWGGPTT
FT                   RAAASVCVAPWPEWTEEAIDPAAEAVVERWREVIRTLRHLRSEREVPEAAKIAPVLIAS
FT                   ASVAVDLERGRSLIAALTNASDVMIVTPDSPHAVKPKEAAVAVLAEIEVVLPLEGLIDR
FT                   EAERQRQLKTLADLDKQLQAIRAKLNNAGFVERAPANVVQAQRDREAELLARKAAVEAL
FT                   LK"
FT   gene            complement(141790..142389)
FT                   /locus_tag="Isop_0097"
FT   CDS_pept        complement(141790..142389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0097"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR000086; KEGG: sus:Acid_0573 NUDIX
FT                   hydrolase; PFAM: NUDIX hydrolase; SPTR: NUDIX hydrolase;
FT                   PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60694"
FT                   /db_xref="GOA:E8R5F3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F3"
FT                   /protein_id="ADV60694.1"
FT                   /translation="MISMSQPRNDFNDHRDPIATAHDTIVFQTPWFAIATRSLTGDDRP
FT                   YYIMLVPDFVVVIARDCQGRWLLVEQERPAVGRRTWEWASGHVETARGETPEQAARREL
FT                   VEETGHDIDDDHLIPLGSFHPDTGRLANRMWCYLALDAAPVDPHDPRLAGREELDLRRV
FT                   MWDGSLAQLLQRPEFACGSHLGVVALAATQGRVTLT"
FT   gene            complement(142404..146579)
FT                   /locus_tag="Isop_0098"
FT   CDS_pept        complement(142404..146579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0098"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000719: IPR019782: IPR017986: IPR017441: IPR
FT                   008271: IPR019775: IPR017442: IPR019781: IPR020635:
FT                   IPR002290:I PR001680; KEGG: psl:Psta_3450 serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; WD40 repeat, subgroup; SMART: serine/threonine
FT                   protein kinase; Tyrosine-protein kinase, catalytic domain;
FT                   WD-40 repeat-containing protein; SPTR: Serine/threonine
FT                   protein kinase; PFAM: Protein kinase domain; WD domain,
FT                   G-beta repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60695"
FT                   /db_xref="GOA:E8R5F4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F4"
FT                   /protein_id="ADV60695.1"
FT                   /translation="MGNATHFEQVSLEFLERFRRGERPQISEYAQRFPEFAEEIQDRFP
FT                   LLVARELFQGPGRFPCVESLPNASCPHPNDTLPKGHPLENGSGWPRETVPPAPTEREVE
FT                   RGRIGDYRIVGELGRGGMGIVYEAIDLKRGGAVALKTLWSSLDQRRRDRFLREAHAART
FT                   LRHPHIVPVEEIGEDHLGRPFYTMRIIRGPTLDLVLEELRNLAYGRTPESDRLTKSPAN
FT                   DSSHLGSHSNSSASSSGSTPHRSDDPSTLGLDNLLNPRKPAAPLSATSVAKARAQRRLD
FT                   AREIARRLWNGELPVVENRHHPPDPDPRRHYFRAVAELTLQVAEALGYAHDHGIVHRDI
FT                   KPSNLLIDHTGRVFIVDFGLAKLIEPAEDLEPLTKTHEMAGTLRYMSPERFDGIQDARC
FT                   DVYALGITLYEFLTLRPAFEDETPHRLMERILHEDPPRPRQLDYRVPRDLETIVLAAIA
FT                   KVPGDRYPNARRMAQDLRRFRDNQPIPTRRASTSRRVWRWFERHPVKGGLSVTLALIMI
FT                   FGLIGFVHDWHDSIIKDAHIQTIEQSVLTQRRLNEETHRNWRRELRHARLQSYLGHVTA
FT                   AHYALTGPLNDAASAREHLKRARALTSPNTQSGPIDPSLVIPGGFELGLLENFTQGHLF
FT                   EVNHDQEKDLSPLCATFHPEGAILAIGYGHRYSHNPGRDQRHGVVTLVSATSGARYSDL
FT                   GNLNASPTTLAFDRSGRRLAATLIDLVDPNQPTRIGIWEWEAVESGSHADRALAIVTTR
FT                   PRRFYELADAGLPAGERFGATTLAFLHDDHTLVGPGKGGVVRFWNLLTGDLTRHPWARG
FT                   GSIPARRFTVNPADGSVLAELSEGRLVQWIATRRVNAIRRRFGSIDGLARSPDGRRLAV
FT                   AEGAVAHVIDLNRPDPILSLNGHARTIRALRFSPDGRRLATAGDDRSVRVWDTRTGETL
FT                   AIHRGHVGMVVDLCFSPDGRSLASVGEEDHVKVWDATQPSEARLLPTGERERRLELWFW
FT                   DAQRLATSSQGHPWSLWNLPSNRRLAEPAMPSIAYPAFPGRLVDANPKVGYLAAVAGSA
FT                   PEERCSVILFETTQGHPLARLVGHTLPIRAVTLGPSGRRLVTSAFDRGQPHRGELFLWN
FT                   LGAIVASTDEPRAPSSLAPLALPIDSGQVTALAFHPSGDLLAIARQRLESLEGVTRTSC
FT                   QVGLVHLESTGPSVEWLPHPHSAQVAALAWTPDGNRLLSGDLEGDLHLHDLQRRSEVRV
FT                   FHQPHGIECLDVDRDGLRVAIASREAVLLWHLDAERDSLTLPYPETLPGDYAFHPRARF
FT                   SPDGHLLAAIDAKGNLVVWDGRPDPDGTLRQQRRDLFFAPLQRMRWHLDQARQGMNDLE
FT                   WSRLLHHLGWVGRILTTPAIPSSPQPVAVAGVAPPAPLVPVPGDGRLR"
FT   gene            146983..147822
FT                   /locus_tag="Isop_0099"
FT   CDS_pept        146983..147822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0099"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284: IPR007627: IPR013249; KEGG: psl:Psta_2330 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; SPTR:
FT                   RNA polymerase, sigma-24 subunit, ECF subfamily; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70, region 4; Sigma-70 region 2; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60696"
FT                   /db_xref="GOA:E8R5F5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F5"
FT                   /protein_id="ADV60696.1"
FT                   /translation="MSEAQAPQRGAGDLSDEALLARYRDLGRTEDFAILVKRYERELFR
FT                   YLARYLNDPVLADDVFQNTFLQIHLKRGMYEDGRPVRPWLYAIATHQAVDALRKIKRHA
FT                   AVSLDQPSGTAAEGETDPGALVEVLVSLEQGPLARLEATERRQIVRDAIERLPETLRHT
FT                   LRLAYYQELKYREIADILEIPVGTVKSRLHAALAKLAEMVKAALNTDATEDSPRSPASN
FT                   PPRSAVSERGPSAEPAGLDAPLTTETLVASPVALASEHPYLPSPPSSGEAHDPRSPR"
FT   gene            147800..149323
FT                   /locus_tag="Isop_0100"
FT   CDS_pept        147800..149323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmi:CMM_0482 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60697"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F6"
FT                   /protein_id="ADV60697.1"
FT                   /translation="MIPDPLVDPFGRVIPKEVSDPAARPDAQPEPIPLDEADDQAFRAL
FT                   VARFPLLDEALAEDPHDDGDGSDSQDRVARTLECLARHRCWERIFEDQLPIDPAGDLER
FT                   LQQAARGLSLIWDHLGAIEIDCDVDEPPTAAVDPAETVLLPPWMRSSVETASNRDAGAD
FT                   SCEATSRADLTLRTLERVVLADHPQAAERLLETVLTAGRPAPILAGPGASKESVSQTEW
FT                   QAQPIQTRLERGVAWLLDDGLEFEPRRDLARRTLARLDRRLVVGPFTETQSRPIVSRRD
FT                   GWVAAALVALAVLATLPALVRARDEARELRQHDHLRAVGMDLLHFQALTGTSLSQPAAW
FT                   EAVSGDSSSNLLERLAEARRMGLLDQVPTSATFVDFQTAPASNRVQRAATGDAPHPETL
FT                   RRLFQDAQNQLMMGYLFPALRTTANSAATRLGGQSSRASLPASEPLVTLIGDRAAPPLF
FT                   QTLGETRPVFHDDGHLATERLGRAGFSARLPHEPGFLLVPVAQSDSCSY"
FT   gene            complement(149496..150653)
FT                   /locus_tag="Isop_0101"
FT   CDS_pept        complement(149496..150653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0101"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: psl:Psta_1334
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase; PRIAM: Methionine adenosyltransferase; SPTR:
FT                   S-adenosylmethionine synthase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; manually curated; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60698"
FT                   /db_xref="GOA:E8R5F7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F7"
FT                   /protein_id="ADV60698.1"
FT                   /translation="MSSSAADRFLFTSESVSMGHPDKMADQISDGVLDAILSQDATARV
FT                   ACETLLTTGLICLAGEITTTAIIDYPAVVRQIVKEIGYVSSDMGFDATTCAVMVALGKQ
FT                   SPDIALGVDRDGAGDQGLMFGFACDETDELMPLPIALSHRIINHLTEVRQAHKVDWLRP
FT                   DSKSQVTIEYDGLKPVRIDTVVVSTQHAPHVDQKTIREFVIDEVIKPVLPTSLINGAIT
FT                   YHINPTGNFVVGGPHGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYMARY
FT                   VAKNIVAAHLANRCEIQLAYAIGVAEPVSIHVNTYGTGKLPDSKLAEIVRRVFPLTPRG
FT                   IIKHLDLRRPIYRKTASGGHFGRNDPDFTWERVDQVEALRQAAGV"
FT   gene            150824..151081
FT                   /locus_tag="Isop_0102"
FT   CDS_pept        150824..151081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0102"
FT                   /product="F-box protein 8"
FT                   /note="KEGG: ptr:461611 F-box protein 8; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60699"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F8"
FT                   /protein_id="ADV60699.1"
FT                   /translation="MEVGAPREPWDDAIAWAISLSQTAVAENRSILAAAAVAAQTGGID
FT                   GVGRGQGVSGVQRGGQLVRVGWFNQGALTVHQRLDKHQSK"
FT   sig_peptide     150824..150907
FT                   /locus_tag="Isop_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(150983..151864)
FT                   /locus_tag="Isop_0103"
FT   CDS_pept        complement(150983..151864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0685 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60700"
FT                   /db_xref="GOA:E8R5F9"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5F9"
FT                   /protein_id="ADV60700.1"
FT                   /translation="MSTALPLVHLADSAGHQTTYTRDQVADLIARGELEPDTLFWIPGM
FT                   EDWRPIAEFAHHVPDVLKAQGRTRAGFTRDPAGLTRVVEWFLILQVVTGMVGLWTDWQH
FT                   IQLLEDPNPDPQAWKDNQARQEFIMLAQFLASVVGGLLFLKWVARATLNSAGFLPQGAA
FT                   PMRFSPTKAVVVWFIPFINLVRPYQVLADLFRIATHPTTDWNRQSAPFWLILWWLHRLA
FT                   CGVFAWRTTTILAAARTPDQLAEAMRLNLLAGVAGITVSLFGLVLVKALMNRQRALVEP
FT                   SNPDELATSLDT"
FT   gene            complement(152049..154199)
FT                   /locus_tag="Isop_0104"
FT   CDS_pept        complement(152049..154199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0104"
FT                   /product="sulfatase"
FT                   /note="COGs: COG3119 Arylsulfatase A; InterPro IPR000917;
FT                   KEGG: chl:Chy400_1467 sulfatase; PFAM: sulfatase; SPTR:
FT                   Sulfatase; PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60701"
FT                   /db_xref="GOA:E8R5G0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G0"
FT                   /protein_id="ADV60701.1"
FT                   /translation="MDAVPSAPVVGDYGSAGSITAASWSRARHIGWLDRARWVLAFVTV
FT                   GIGVGLAESGWLLYRQMRGDRLEIDVHPEFLWLTPLAQGAWGLLAGLLVAGFSWVLPRL
FT                   TAITAPFLLGFLGTLAIACWFAELEPWARLILSLGAGFQAARWLRGSSPSSISTGPQRP
FT                   SRVGEVDDPCFEQGDGDRLGLVARAAPIMICLSLGVMVWSLARQEWRQRPQGASSFPPV
FT                   ATIPGPELHATTPAASANTATAPPLPTNRTAIRNVVWIVLDTVRADALSHLGYHRETTP
FT                   KLDAWARRGVTFERAIAPCSWTFPSHASMFTGLTQESYDPDLKLVLPDRAYTIAERYSD
FT                   ADYRTAGFVGNSSCCTQWFGLHQGFQRFDTHLLDPIVALRQPASGRRLLNVLAQSWDWV
FT                   ARKLDLPAPQRIPPLYRRFHSANDLNAKALAWLRRHDDRPFFLFLNYYDVHAPFLPKTT
FT                   TNPRFGRPIEHWYEYAIVRMFYDLDPSRTAPSVLQFVRDAYDQCLADLDSAIDELLSEL
FT                   ERTGRLEETLVIITSDHGESFGEHGQFGHGRLLHQEESWVPLILIAPGSPALPAGKRIS
FT                   TPVSLLDLPATVLDLTNHANDGTCRPAFPGQSLRRFWSQTTAQREESLPSDTTEAVYSE
FT                   LLPLTPDFLQHPTHHNRPLRLLVAGRYTFFRNREGREWLFDLENDPGETVNLIDSDDPV
FT                   HQEAAQRLRAALAERIGRQTRF"
FT   gene            complement(154555..158265)
FT                   /locus_tag="Isop_0105"
FT   CDS_pept        complement(154555..158265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0105"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit; InterProIPR010243: IPR007121:
FT                   IPR007644: IPR007642: IPR 007645: IPR019462: IPR007120:
FT                   IPR007641; KEGG: psl:Psta_2551 DNA-directed RNA polymerase,
FT                   beta subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA
FT                   polymerase Rpb2 domain 3; RNA polymerase Rpb2 domain 2; RNA
FT                   polymerase beta subunit; DNA-directed RNA polymerase, beta
FT                   subunit, external 1 domain; RNA polymerase Rpb2 domain 7;
FT                   SPTR: DNA-directed RNA polymerase subunit beta; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta subunit; PFAM: RNA
FT                   polymerase Rpb2, domain 3; RNA polymerase Rpb2, domain 6;
FT                   RNA polymerase beta subunit external 1 domain; RNA
FT                   polymerase Rpb2, domain 2; RNA polymerase beta subunit; RNA
FT                   polymerase Rpb2, domain 7; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60702"
FT                   /db_xref="GOA:E8R5G1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G1"
FT                   /protein_id="ADV60702.1"
FT                   /translation="MSTGSTIRRIVPSVKKFFGRIRDDFPIPDLTQIQTESYARFLQED
FT                   TPPEQRKDQGLEAVFREIFPIESYGDKTLRLEYIKYELGKPRYDPDECRRLSLTYGRPL
FT                   NVWLRLWKGDESIEDHVYLGDMPIMIGGGEFIINGAERVVVSQLHRSPGVDFVVDTESG
FT                   DKKLHACRIIPERGSWIELQVNKKDALEVRIDQSGKFSAMTLLRAMDPAYSTDEAILRA
FT                   FYDTETIHTSEEGAAARLENKIACGDVVDPETGEVLCDSGARIDRVRAQLFVDHNLGAI
FT                   EVMVEVKDPLILHSLQMDPTSDHESALLKIYQRLRPGNPPQLDKARDLFREKFYDTNRY
FT                   RLGRVGRFRINRKFNLDLPEDKMTLDAADYVHAIRYIIDLRRNKGHIDDIDHLGNRRLR
FT                   TIDELAADEIRKGFLKLRRTVQERMTMKDAEDLNPRSLINQKSISAAIDYFFGRGELSQ
FT                   VVDQTNPLAQLTHERRLSALGPGGLNRKRAGFEVRDVHISHYGRICPIETPEGTNIGLI
FT                   SSLANYARVDEYGFLVCPYRVVENGKPTNEVRWMRADDENDVYLAPADVPLDEHGRIKG
FT                   PNTIARYQSDIHMIPSDKVQYIDISPRQVVGVSAGLIPFLEHDDANRALMGSNMQRQAV
FT                   PLLVAEPPLVATGLEGAVAMNSGMVVRAREDGVVTEVDSTKVVIDGVHVYKLRKYIGLN
FT                   ERTCLNQKPVVSVGQQVKKGDLLADGASTYQGELALGRNVLVAFMSWDGYNFEDAIILS
FT                   ERLVKEDVYTSIHIEEFEADIRETKLGREEFTRDIPNVSEKALRHLDENGIVAVGTYVK
FT                   PGDILVGKVAPKSKSELSPEEKLLHAIFGRSGEDVKNDSLEVPSGVEGIVLSTQRFSRR
FT                   TSLTEEERKAHDKEIKDTEQAESIKIAEAYRQMIKELEEVIGGPVVHKETARPYGREKD
FT                   PVALAEESQSFKLEHIDLHGPDILSKAREVHRRHAVRIDNLRDEKERKLNSLKLGDELQ
FT                   TGVLQMVKIYVATKRVISVGDKMAGRHGNKGVIAKILPEEDMPFLADGTPVEILLNPLG
FT                   VPSRMNVGQILETHLGWAAAKLGFRAICPVFDGADESVIRQHLKEAGLPENGKAQLYDG
FT                   RTGEPFDQKVTVGYMYMLKLHHLVDDKIHARATGPYSLITQQPLGGKARFGGQRFGEME
FT                   VWALEAYGAAYILQELLTVKSDDVEGRTKIYESMVKGENTLEAGTPASFDVLTNEIRGL
FT                   ALNMQLEKKRV"
FT   gene            complement(158685..159089)
FT                   /locus_tag="Isop_0106"
FT   CDS_pept        complement(158685..159089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0106"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="COGs: COG0222 Ribosomal protein L7/L12; InterPro
FT                   IPR000206: IPR013823; KEGG: rmr:Rmar_1107 ribosomal protein
FT                   L7/L12; PFAM: Ribosomal protein L7/L12; SPTR: 50S ribosomal
FT                   protein L7/L12; TIGRFAM: ribosomal protein L7/L12; PFAM:
FT                   Ribosomal protein L7/L12 C-terminal domain; TIGRFAM:
FT                   ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60703"
FT                   /db_xref="GOA:E8R5G2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G2"
FT                   /protein_id="ADV60703.1"
FT                   /translation="MSQTTYADNIKALGDSLVKLTVLEAKALSDYMKDTYGLEAAAAPV
FT                   AMVAGPAAAAGEAAAPAAEKTEFDVILEAAGSQKINVIKVVRAATSLGLKEAKELVESA
FT                   PKPVKQGISKADAEKLKKELEEAGATVKIA"
FT   gene            complement(159275..159814)
FT                   /locus_tag="Isop_0107"
FT   CDS_pept        complement(159275..159814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0107"
FT                   /product="ribosomal protein L10"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790; KEGG: plm:Plim_0441 ribosomal protein L10-like
FT                   protein; PFAM: ribosomal protein L10; SPTR: Probable 50S
FT                   ribosomal protein L10; PFAM: Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60704"
FT                   /db_xref="GOA:E8R5G3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G3"
FT                   /protein_id="ADV60704.1"
FT                   /translation="MSKYVKELMCAELERDLGETTSALILDLKGLDAISEHKLRKDLRQ
FT                   KDIKIRVVRNNLARLVFEKKGMSGLDPFLTGPSVLVWGGSGIAELAKEISDQVKALKKP
FT                   VIKGGCVDGVAVGPDMVESLTKLPSRETLIAQVLALLMSPTRQVLAQLNAPISGVMSQV
FT                   KTLAERESGDTPSDQG"
FT   gene            complement(159840..160523)
FT                   /locus_tag="Isop_0108"
FT   CDS_pept        complement(159840..160523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0108"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR002143: IPR005878; KEGG: psl:Psta_2555 ribosomal protein
FT                   L1; PFAM: ribosomal protein L1; SPTR: 50S ribosomal protein
FT                   L1; TIGRFAM: ribosomal protein L1; PFAM: Ribosomal protein
FT                   L1p/L10e family; TIGRFAM: ribosomal protein L1,
FT                   bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60705"
FT                   /db_xref="GOA:E8R5G4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G4"
FT                   /protein_id="ADV60705.1"
FT                   /translation="MAKHSKRYRALLEKVPASREPMPLEDGLKLLKEFDTTKFVQTVEV
FT                   SAKLGIDPRQSDQNVRGSVALPHGIGKTVRVAVFAQGENAEKARAAGADLVGSDDLASQ
FT                   IKGGMMDFDVALATPDMMGIVGPLGRVLGPRGLMPSPRSGTVTTDIAAAVREFKAGKIE
FT                   FRNDKTGNVAVPVGKLNFEVPQLADNIQAFMNHLRSLKPSTAKGAFIRSVTISATMSPG
FT                   LRVDV"
FT   gene            complement(160849..161274)
FT                   /locus_tag="Isop_0109"
FT   CDS_pept        complement(160849..161274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0109"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR006519: IPR020784: IPR020783: IPR000911; KEGG:
FT                   tit:Thit_1987 ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; SMART: ribosomal protein L11; SPTR: 50S
FT                   ribosomal protein L11; TIGRFAM: ribosomal protein L11;
FT                   PFAM: Ribosomal protein L11, RNA binding domain; Ribosomal
FT                   protein L11, N-terminal domain; TIGRFAM: 50S ribosomal
FT                   protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60706"
FT                   /db_xref="GOA:E8R5G5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G5"
FT                   /protein_id="ADV60706.1"
FT                   /translation="MAKVMTAQVKLQCPGGQATPAPPVGPALGQHGINIGQFVQQFNDR
FT                   TKDMKGMTIPVIITIYNDRSFEFVLKSPPAAVLLKQAAGVASGSPTPNKTKVGSVTREQ
FT                   LRKIAETKMADLNARDLEHAMRVIAGTARSAGIEIKD"
FT   gene            complement(161525..162382)
FT                   /locus_tag="Isop_0110"
FT   CDS_pept        complement(161525..162382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0110"
FT                   /product="NusG antitermination factor"
FT                   /note="COGs: COG0250 Transcription antiterminator; InterPro
FT                   IPR001062: IPR006645: IPR005824; KEGG: plm:Plim_0438
FT                   transcription termination/antitermination factor NusG;
FT                   PFAM: NGN domain-containing protein; KOW domain protein;
FT                   SMART: NGN domain-containing protein; KOW domain protein;
FT                   SPTR: Transcription antitermination protein nusG; TIGRFAM:
FT                   transcription termination/antitermination factor NusG;
FT                   PFAM: Transcription termination factor nusG; KOW motif;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60707"
FT                   /db_xref="GOA:E8R5G6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G6"
FT                   /protein_id="ADV60707.1"
FT                   /translation="MNDPTTTPPDSDPTEWDDPDSQRGWHDGEMRSSDESEESLRPVVY
FT                   EERPDGGDDFDREEDDENEVEAHTAKHAARSAKAATGSGSASPPSPPSDPDAEPAPELS
FT                   WYVLKVQSSREDSIREAMLKRVRIQGLERFFGDVVVPKRKEVEIRNNKKKIVERKTYPG
FT                   YLLVQMELNERTWFTIRETPGVGDFVGPPGSPTKISPAEVQQILGTPSADEKVGIEEAS
FT                   AEPVKPKIDFERGDRVKIKDGPFENFEGTVEEVVPARGVVKVMIVIFNRPTPVDLEYWQ
FT                   IERI"
FT   gene            complement(162490..162993)
FT                   /locus_tag="Isop_0111"
FT   CDS_pept        complement(162490..162993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0111"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="InterPro IPR005807: IPR001901; KEGG: rba:RB7897 SecE
FT                   protein; PFAM: protein secE/sec61-gamma protein; SPTR:
FT                   Putative uncharacterized protein secE; TIGRFAM: preprotein
FT                   translocase, SecE subunit; PFAM: SecE/Sec61-gamma subunits
FT                   of protein translocation complex; TIGRFAM: preprotein
FT                   translocase, SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60708"
FT                   /db_xref="GOA:E8R5G7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G7"
FT                   /protein_id="ADV60708.1"
FT                   /translation="MGQVKDGSQTAAKAAARAEGDFGGSAKPKRQGPTYWTNLVSTDLY
FT                   KFNLGRKVRWTTFIALAILIVYGVQQLTVQLADQSLLVARVFPLGFGGLLLWIAFRTIQ
FT                   YPRFAEFLIATEAEMNKVSWISRDDLRTSTIVVLVCVVILSIYLFIVDIIWLKILELVG
FT                   VIQR"
FT   gene            complement(163208..163280)
FT                   /locus_tag="Isop_R0001"
FT   tRNA            complement(163208..163280)
FT                   /locus_tag="Isop_R0001"
FT                   /product="tRNA-Trp"
FT   gene            complement(163542..163694)
FT                   /locus_tag="Isop_0112"
FT   CDS_pept        complement(163542..163694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0112"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="InterPro IPR001705; KEGG: plm:Plim_0436 ribosomal
FT                   protein L33; PFAM: ribosomal protein L33; SPTR: 50S
FT                   ribosomal protein L33; TIGRFAM: ribosomal protein L33;
FT                   PFAM: Ribosomal protein L33; TIGRFAM: ribosomal protein
FT                   L33, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60709"
FT                   /db_xref="GOA:E8R5G8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G8"
FT                   /protein_id="ADV60709.1"
FT                   /translation="MREYVWLECTECGDRNYRVQKETRGAGRLELRKYCPRLRRHTLHK
FT                   ESRKK"
FT   gene            complement(164041..165261)
FT                   /locus_tag="Isop_0113"
FT   CDS_pept        complement(164041..165261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0113"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="COGs: COG0050 GTPase - translation elongation
FT                   factors; InterProIPR004541: IPR005225: IPR000795:
FT                   IPR004161: IPR 004160; KEGG: rba:RB7894 elongation factor
FT                   Tu; PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor Tu
FT                   domain-containing protein; SPTR: Elongation factor Tu;
FT                   TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; manually curated; PFAM: Elongation
FT                   factor Tu C-terminal domain; Elongation factor Tu domain 2;
FT                   Elongation factor Tu GTP binding domain; TIGRFAM: small
FT                   GTP-binding protein domain; translation elongation factor
FT                   TU"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60710"
FT                   /db_xref="GOA:E8R5G9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5G9"
FT                   /protein_id="ADV60710.1"
FT                   /translation="MAKETFQRTKPHVNVGTIGHIDHGKTTLTAALLKVLANQPWAGQT
FT                   KVKDYAEIAKGGTVRDATKTVTIAVSHVEYESEKRHYAHIDCPGHADYIKNMITGAAQM
FT                   DGAILVVSAADGPMPQTREHILLARQVGVPALVVFLNKIDLVDDEELLELVEMEIRELL
FT                   SKYKFPGDEIPIIRGCARPAYDDPTNPEKAKSILDLVKAMDEYIPDPVRDKDKPFLMPV
FT                   EDVFSIKGRGTVGTGKVERGVVKVGDPVEIIGFGANLKSTVTGVEMFQKVLEQGEAGDN
FT                   VGVLLRGIEKNQLERGQVICKPGSITPHTKFEAEVYVLSKDEGGRHTPFFKNYRPQFYF
FT                   RTTDVTGTVLNLLAEDGSEAQMCMPGDNIKMTVELQTPIAMEENLRFAIREGGRTVGAG
FT                   VVTKILA"
FT   gene            complement(165590..165662)
FT                   /locus_tag="Isop_R0002"
FT   tRNA            complement(165590..165662)
FT                   /locus_tag="Isop_R0002"
FT                   /product="tRNA-Thr"
FT   gene            complement(165840..165910)
FT                   /locus_tag="Isop_R0003"
FT   tRNA            complement(165840..165910)
FT                   /locus_tag="Isop_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(166029..166111)
FT                   /locus_tag="Isop_R0004"
FT   tRNA            complement(166029..166111)
FT                   /locus_tag="Isop_R0004"
FT                   /product="tRNA-Tyr"
FT   gene            complement(166186..166261)
FT                   /locus_tag="Isop_R0005"
FT   tRNA            complement(166186..166261)
FT                   /locus_tag="Isop_R0005"
FT                   /product="tRNA-Thr"
FT   gene            166507..167427
FT                   /locus_tag="Isop_0114"
FT   CDS_pept        166507..167427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:473093 similar to Gene model 996, (NCBI);
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60711"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H0"
FT                   /protein_id="ADV60711.1"
FT                   /translation="MGTTKPSGAGYRVIVFAGAERIELIRGIIGEATAAHPIDLALGAA
FT                   RLPGVWPWPVSQEAAQFIVERLEAFGIAAEARRADTFPVLGRPRAVSAVAVLKDGLRCE
FT                   GWRGEPTQYIPWSRVEVVVAGWIARPDAVAPASYSLPAADRVTGWRRLFTGLRSPTIRE
FT                   SVWLGGGGARLRQAVRRPRDPLGQALVVRREPTLCLRLSEDRLRWRGEVETLSSAEPAP
FT                   TSDRAGEPPGRRRFRLGIATILERSVQAGANVSARSWRFARTPAPPDGFAPEFDSPEAL
FT                   EDRATLETLARWHDHRADSAPLIGE"
FT   gene            167863..169023
FT                   /locus_tag="Isop_0115"
FT   CDS_pept        167863..169023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0115"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: phe:Phep_3646
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Putative
FT                   uncharacterized protein; PFAM: Oxidoreductase family,
FT                   C-terminal alpha/beta domain; Oxidoreductase family,
FT                   NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60712"
FT                   /db_xref="GOA:E8R5H1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H1"
FT                   /protein_id="ADV60712.1"
FT                   /translation="MTRKLRVGMVGGGGPGNFFGAPHRRAILMDNSAELTAGALRSDPA
FT                   GAIASAKELFFTRGYGDWASMIAEEAKLPEDQRIDYVTIVTPNHAHFGPADAAARAGMG
FT                   VLCEKPLTLTLDEALALRKTVKQHDTPFVVAYTYTAFPMVMMARELVHDGTLGEIRKCE
FT                   AWYPQGWLASKIEAQGQQQASWRVDPARSGASGCGGDIGTHAYEFIKFVAGLRAVRVQA
FT                   RTKTFVEGRALDDDFTVLAELSNGAIGTIAASQVTIGAQNDNGFRIIGTKGTLEWSITD
FT                   HNTLKHFEAGQPVRLFRLGAEYGYLPETVKPYVRVPSGHPEGFHEALANLHRCLEWTIR
FT                   ARRGETVPRACPLPGIDDGVEGMAFIAAAVESGREDGRWVAVKPLD"
FT   gene            169568..170158
FT                   /locus_tag="Isop_0116"
FT   CDS_pept        169568..170158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0116"
FT                   /product="TadE family protein"
FT                   /note="COGs: COG4961 Flp pilus assembly protein TadG;
FT                   InterPro IPR012495; KEGG: pca:Pcar_1749 Flp pilus assembly
FT                   protein TadG; PFAM: TadE family protein; SPTR: Flp pilus
FT                   assembly protein TadG; PFAM: TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60713"
FT                   /db_xref="GOA:E8R5H2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H2"
FT                   /protein_id="ADV60713.1"
FT                   /translation="MLVIPSSREPIAGGISGARRRGRGRWRRRRGVAIVEFAVVLPLML
FT                   ILVVGLFEVGQLVRVRMVLDSAVREGCRQASIGQRRAMTPDPVNPINSIRDVVEGYLAR
FT                   SGINTEGLEVQILGEGGSPIEPSTLNASINQPVADQFVVEVSLPFDRNGTQGNRLVDIN
FT                   YKIISYPRLTSRSQWYSMRDFPLLAEALDPPIE"
FT   gene            170265..170756
FT                   /locus_tag="Isop_0117"
FT   CDS_pept        170265..170756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0117"
FT                   /product="TadE family protein"
FT                   /note="InterPro IPR012495; KEGG: ctt:CtCNB1_2097 TadE-like
FT                   protein; PFAM: TadE family protein; SPTR: TadE family
FT                   protein; PFAM: TadE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60714"
FT                   /db_xref="GOA:E8R5H3"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H3"
FT                   /protein_id="ADV60714.1"
FT                   /translation="MVRLTRRVGCSPGATTPRLRRGVTVVEMAIVVMVVFMFLMGIIEF
FT                   SRILMTRVMWDNAARAGARLAVVSTDSLTDEELIQKIDSFLPAATKSTVVGGFNPNVNI
FT                   RVFRADENGNELGHWKSAGFGQAIAVEISGEVSIISPIAMGGRNSINLRAFHMMYSEAN
FT                   "
FT   gene            171258..174200
FT                   /locus_tag="Isop_0118"
FT   CDS_pept        171258..174200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_0521 von Willebrand factor type A;
FT                   SPTR: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60715"
FT                   /db_xref="GOA:E8R5H4"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H4"
FT                   /protein_id="ADV60715.1"
FT                   /translation="MRRDGIELMSRFGTLGTPTPRRARIRSRRGIVLPLIAACSVMLLG
FT                   MLALAIDLGVLAVAKAQAQNAADAAALGGARTLDGTRPPGIPSDAPITTADNNYANAGP
FT                   NAQAIAQANTILGQPIEANQVTITIGKYIFDATKSRFFKYGSDAVPLERDQITDAASIA
FT                   PTYSWSLAHARVTKQVPPFFSRVFGVTSIPVSATAAAVHRPRDVAIVMDFSTSMSNDSM
FT                   LGMGRWANNTNLLEGVGQVENRFCNNPDPAVPRFGHYSSPDARMVITHSNIRMADGGAD
FT                   RLEEFMACNWTVSHPLNRNRKPMLEGFYAGPSTAGSPAPLAFRAWGEGNAEGAVAGDRP
FT                   LMRAIGTTPNSDTQFAQTAQQALGATLIPHPMRFAPAWEANGYDLPAVNYRPYSGTRFQ
FT                   GFTEGPRYYGKTFFIWPPDPRPQFDWRRRFFLQLDRLTNTWVPLTNTALLFDSRGQFRS
FT                   PHYRGNDGAWNALTAEEWALASNPTDREFYRINYQAILAWIRNDDGQSGRNPFPNELRA
FT                   GRILYYNAIPTPSPAINEQWRTRNYGTGIDGHNARFWKEFIDHTLGLKDQGNSWRMLQV
FT                   GGGTPPEFLPSVANFVGYGRHFQWGPVKITSTAQLLAARANLTDPIPPYAYDDNPLRPR
FT                   THMWFGPMMMVDYIFNQNLGHYYAAATLPIQPDFAAKMGMQGALRYIQRNHPNDLVSLI
FT                   YFDSGNNGSRFRRPRVALGKDYTRMIGSLWYHPDVILNYNPTATPRANPTGGTGPLLMF
FT                   GMNSQVPYPMGGTNYTHPLMLVYNQFSENPGLRTFNPNRPLGDAGGNGRRGAQKLVVFV
FT                   TDGQPNSGSSAPFEASLQSNGANYSYYRVRFRESGGSSDNVTSAGGGAFNNPTLRAQIY
FT                   DVTQTICNDSEHPTRPGFSTPRKPVLVHCLGLGQVFDFSSPVQANGLRTLQQMEMIGRT
FT                   QGPGTNFPNPPPDWIPEWKLIIGSDEDIQNRLLNALKEIMRSGFQLSLIE"
FT   gene            174372..175220
FT                   /locus_tag="Isop_0119"
FT   CDS_pept        174372..175220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0119"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593; KEGG:
FT                   sru:SRU_1197 ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60716"
FT                   /db_xref="GOA:E8R5H5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H5"
FT                   /protein_id="ADV60716.1"
FT                   /translation="MTTTDTAPVERDRAVAVSEATPDPRMRPVAEFVEVVKDYPTNWLR
FT                   WGMLRAVDHVSLTIAPGEVFGLLGPNRAGKTTLVKILLSLTQPTSGTVKRFDQPTTNRE
FT                   TLKRIGYVHENQAFPRYLTATELLRYYGALSQLSTAKIEVIVPILLEKVGLADRAREPI
FT                   SRFSKGMVQRLGLAQALLNDPDLLVLDEPAEGLDLDGRRMVADLIAQRREAGKTVLLVT
FT                   HLLAEAERVCDRVAVILGGKIVRQGTVAELTNQGTTSLEETLSPIYAAGRTAVSAAAFN
FT                   G"
FT   gene            175339..176601
FT                   /locus_tag="Isop_0120"
FT   CDS_pept        175339..176601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_0817 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60717"
FT                   /db_xref="GOA:E8R5H6"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H6"
FT                   /protein_id="ADV60717.1"
FT                   /translation="MVRTLGWLIWDTFRQSLANRLFWLMLGVTILSVVFCLSISVPESA
FT                   PVRDPKDPLGELYLPNDRSLAEAVAKGEHVSSGAMTVGFGLMQVDFFRDSQSQVQFIRL
FT                   VMAIGVAGVVGTLLILIFTGGFLPEFLQPSAASVLLAKPAPRWILLVGKYLGVMTFVAF
FT                   HAALFVGLTWAAIGIRTSDWSPEYLLAFPLVLVHVGMIYGFSAFVGVLTRNPIAAVFGA
FT                   VVFWVMCFATNYARHSAVALPEITRIERQNQLELERGRKITEEAEARAKARAEERKAKG
FT                   LPEVEEMEPGMEIVPGVAGLDPESTADPHLVQGDLEEPKANSDGERNEGAGAVYEVAQQ
FT                   SSGLKWFTELSYWIMPKPADLAIVLERGIVGDLTHFASPQEFETVINMGEFHAGWSIAS
FT                   SLLMTLFWLGLAIHEFSKMDY"
FT   sig_peptide     175339..175473
FT                   /locus_tag="Isop_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(176639..177799)
FT                   /locus_tag="Isop_0121"
FT   CDS_pept        complement(176639..177799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0121"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="COGs: COG2170 conserved hypothetical protein;
FT                   InterPro IPR011793: IPR006336; KEGG: gvi:gll2294
FT                   hypothetical protein; PFAM: glutamate--cysteine ligase
FT                   GCS2; SPTR: Carboxylate-amine ligase PM8797T_05430; PFAM:
FT                   Glutamate-cysteine ligase family 2(GCS2); TIGRFAM:
FT                   uncharacterized enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60718"
FT                   /db_xref="GOA:E8R5H7"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H7"
FT                   /protein_id="ADV60718.1"
FT                   /translation="MTSPPLIFNHNDYPTLGVELEVQLVDHHTMGLVSAIEPILKNLPP
FT                   GLENRIKPELMQCYLEVNTDVCRTVDEVGIDLADKVAAVERAANPLGVKVHWSGTHPFS
FT                   NWRHQEVTNNARYHQLIEQMEDTARRLVTFGLHVHVGVDTGDKAIMICDRIVRHLPTLL
FT                   ALSSNSPFWNGRDTGLCSQRIKVLENLPTAGPPPLMRNWSEFVWLVRTLIKTGFIQTIR
FT                   EIWWDVRPHHGFGTVEVRVCDTPADLKTVLALTALVQCLVHALSKEIDNGVYFVDSHPM
FT                   MARQNRWRACRYGLDAELVDPFNQEPRPARKLVEQLVALLRPVADELGCTKHLETALEL
FT                   AAQPSGASRQRIDYAETHDLAEVVRRGLARSRLTPSSIPTPVTATV"
FT   gene            complement(177796..179160)
FT                   /locus_tag="Isop_0122"
FT   CDS_pept        complement(177796..179160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0122"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.47"
FT                   /note="COGs: COG1473 Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase; InterPro IPR017439:
FT                   IPR010168: IPR002933: IPR011650; KEGG: rba:RB4484 IAA-amino
FT                   acid hydrolase 1; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein; PRIAM: N-acetyldiaminopimelate
FT                   deacetylase; SPTR: IAA-amino acid hydrolase 1; TIGRFAM:
FT                   amidohydrolase; PFAM: Peptidase family M20/M25/M40;
FT                   Peptidase dimerisation domain; TIGRFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60719"
FT                   /db_xref="GOA:E8R5H8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H8"
FT                   /protein_id="ADV60719.1"
FT                   /translation="MSACDWRGVLDDEVDRLADRIRSVRRHLHAHPEPSGEEYATTAYL
FT                   TDQLRSEGIATRIAPSRRGLIADAPDSVLDAVATTTGKPLPTRARLAIRADIDALPIQD
FT                   VKSVPYRSLRPGVMHACGHDAHAAMALGATLALHRASQRQAPPWPVPWRTIFQPAEETA
FT                   TGAREMIQAGALDEVAAIVALHVDPERPVGTIGYRHGALTACVETLEVVVEGEGGHAAR
FT                   PHQCVDAIAAAVQFINAVYQGIPRSIDSRDPVVVSFGAVQGGASPNVIPAKVSLLGTIR
FT                   TLSRDTLARIRDRVHRIAQGVELTTQARIRVATHPVTDGVVNDGRVTRACVQAATRVVG
FT                   HQRVWPIELPSMGGEDFAAYLDHVPGCLLRLGVAPDQGGSPFLHSPHFDLDERALVIGA
FT                   RILAHVLAHLARPENHDESAEFAALPVAGRLPSSPASPSPCVSPSTPISREGIVR"
FT   gene            complement(179373..182606)
FT                   /locus_tag="Isop_0123"
FT   CDS_pept        complement(179373..182606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0123"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016160: IPR002872: IPR015590; KEGG:
FT                   psl:Psta_0870 delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; Proline
FT                   dehydrogenase; SPTR: 1-pyrroline-5 carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   dehydrogenase family; TIGRFAM:
FT                   delta-1-pyrroline-5-carboxylate dehydrogenase, group 2,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60720"
FT                   /db_xref="GOA:E8R5H9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="InterPro:IPR041514"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5H9"
FT                   /protein_id="ADV60720.1"
FT                   /translation="MTTPTTSTTDPPTSANGHIAHAAPEPKEEASAVAQPRARDPFAER
FT                   LEARTCEIGLELFQLIGRGPGPLERAYWDNVLMDQTLGDPVVKVQLFRFTDALPSLRSP
FT                   ESIRRHLYEYLAEAGDRVPWFMKLGLGLVPPGVLGDRLLAQAARVGATSMARRFIAGST
FT                   PDEALRTILRNRRHNLAFTADLLGEAVVTEAEADAYLNTCLDLLRGMAAQLDREPERPI
FT                   IDRDHQGPIPRLNLSVKLTGLTSRFDPVAVEATTNRVMDRLRPLARQAMRLGAFLHLDV
FT                   EHYAIKDLTYSIFKTLLSEPEFRGYPHFGIVSQAYLRDAERDLIDLNTFIADRGVPVTI
FT                   RLVKGAYWDYEVVHARAMDWPIPVWTEKWRSDACFERCARYLVDHHDRLRPAFGSHNLR
FT                   SLAHGLAYAELRGLDPRAVETQVLHGMGEPIARALVAMGRRVRMYTPYGAMLPGMAYLV
FT                   RRLLENTSNESFLKASFVDHADQRELLRDPEEVGAMFWNRKRAQSNGNGRGVVNPASNA
FT                   ESPASWPPFTNEPLTDFTRVEAREHLKQALERVEAKLGVEVPVWIGGQSRTEGDWFDSL
FT                   DPGDLSRVVARVRKGTVAEASEAVAAAHAAFGAWAATPVAERATILRRAAALMRRDRAE
FT                   LTAWIIYESAKPWKEADADVAEAIDFCEFYAREMVRLAHPRRRDVPGEENELVRMARGV
FT                   AVVIPPWNFPLAIPVGMTAAALVAGDPVVLKPSENAPAMAWHLCRVFREAGLPEGVLNL
FT                   VPGFGEVGAALVADPRVALIAFTGSKAVGLSINETAARTPAGQHHVKRVIAEMGGKNAI
FT                   IVDDDADLDEATLGVLHSAFGFAGQKCSACSRVIVLADVYDTFVKRLADAVGSLPIAPA
FT                   TDPDCVVNPLIDRKAFDRVTGYQARAASQGRIVAHVPVPETLRNKGHYVGPLIVADVDP
FT                   QAPIAQEEIFGPVLAVIKARDLDDALAIANGVEYALTGGLYSRSPAHIERVRREFLVGN
FT                   LYINRPITGALVDRQPFGGAKLSGIGTKAGGPDYLLEFTLAKSITENTLRRGFAPEVEA
FT                   ADHETDPAQLETASKPNSNLSPTPLGVGS"
FT   gene            complement(182910..189527)
FT                   /locus_tag="Isop_0124"
FT   CDS_pept        complement(182910..189527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0124"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2931 RTX toxins and related Ca2+-binding
FT                   protein; InterPro IPR018512: IPR018511: IPR001343; KEGG:
FT                   swp:swp_1383 hemolysin-type calcium-binding region; SPTR:
FT                   Type I secretion target repeat protein; PFAM:
FT                   Hemolysin-type calcium-binding repeat (2 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60721"
FT                   /db_xref="GOA:E8R5I0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5I0"
FT                   /protein_id="ADV60721.1"
FT                   /translation="MSRLFSASSRVLRFRSVGSPRRSLWRLQVRAARRVGLTRRPLEWL
FT                   EDRTLMTFSASLSGQTAFFLTNNPALFQTLAFERSGGLLTHNRAGDPGFVNEFDFDNTQ
FT                   PGVQSLPADAASSVRLFLGNANLELGTITGRADLLNARFFVDEAGQGGATVSFAAAAAQ
FT                   VVTADLDGVRNANLGLNLTILDRFVAGVQVIGSPAADRLNLLGVPEDQPFAFDGNGGVD
FT                   EVVVGSNGSLRDLQDDATLTNTGGFNTILLDNAGENVGREVTVDRVADKLRVTGLSLAP
FT                   GGGSPAILLTEDRAASLTIQLGAGNDLVRLNATLAANPGGNLTRIDTGAGNDVLEVSAL
FT                   GLGTGSDNQLVGGPGTQDRLVLNAGGQSVSVTPSAGVIEIDTLGRLDFATFELLELNNL
FT                   SEAFLQGSVNNDELTLQRFNPATLQATLTDAPVVRLPDTAPLTFRGGGGNDTATVDFLE
FT                   GPLGAGLFTFDGQIGSNNRLVLVNGVFDRVEHRLSGVGAGELDLTPTSGPVQRIAHLNV
FT                   AGVRDNSTANDRLYQFEAADDQIRLGAGPNPGVVVIEAPTALPVEFRAPDLSLAINAGA
FT                   GDDVMIVNNLGPFFPAATVVTFEGGPGLNRFRLEDDRPASAVAGTLLDPDRGIVAALRP
FT                   NANAARIVVDRGNGRYGAALELSGFDTETGLTILTNAAASGGAADVVVVHGLAEFGLGS
FT                   DRFFETNFGSDEIRVSDHQVAIDNATVGALLRVNLDPTRLAALVVRGGDESNATGDLFV
FT                   APAFSLNGVPILLDGGAPALGTVPGDRVELSGPAFEVFTDPVLGRPAVALRASGPGAPS
FT                   GRVTVLNMEAVQVQTDAVRVLGDRGAASGITEFDTFVVEGTGPRRFDLRINDLGGTTAP
FT                   LSFDLNFLGNSPSATRQLSLEGGRGDDRVSVTPFLGWEVAVQTDGGDGFNRLAFNGVVG
FT                   VAESILVEAAPDAAAAGSILSTAQTGPALVFASVQALNLNANPNEGDTLTLRATAGDDE
FT                   ALLQFSPQRVGGSSVNASGPNGFGGAPSDTGPEFADLRLVGRFDVVLDQGRGIANPDGS
FT                   PADAPILNGFGLVALDLSAGNDLARVNLTGPIPASVEVAILGGAGENRIEVVGNAGFDD
FT                   FTLAPGFDTRSGRVTIAGNDEGVFRFEDVATLDFLGDGGGDRLTLEGTINADLFEAVGG
FT                   GVRLNGGPRARPLDFGGGSLNLNGFAGVDRYVVEPGSFPGVSVIRVNPDDPLDAPGEDR
FT                   AELLGQPTDDLFNLTAGSPSAAVVTVASGATVDLRDVGRIDLDGLDGLDRLGLAGFGGD
FT                   NTVTTRPDPITGQPIIDAQLGGLAVVAVNFERLDFTSGGGADRVVLEGTEGDDTATATA
FT                   NSITVAGQTVSFVNPVESIEINLLGGNDQADLSAFAIQGVTLNGGDGSDTLRGTNFADR
FT                   INGDAGDDLVFGLAGNDTLDGGDGNDTLDGGAGDDLLHGGIGNDSLLGDSGDDTLEGGD
FT                   GDDTLEGGSGRNLLDGGAGDDLLVHRLDANGFDLMTGGPGNDTVSVLGTAGGDSFQLAP
FT                   LTNQPGRFSVAANGADRLEGGTVEVVALNGGVGDDRFVVADLAATGLQRVDLEGGAGND
FT                   AFTIQGTNGDDAILVSRPSVGGPVEVAGLAALARVIDPAGFTETLRVEGLVGNDLILTD
FT                   SPASLALRLIFDGGDGNDTLGFADPVPPGPAGGVSLLGGDGNDLLQGGAGDDSLLGGDG
FT                   NDTLLGGDGNDLLQGGAGDDSLLGGDGNDTLWGGLVGETSDLTNDTLRGGAGNDQLHGT
FT                   RGDNLLDGGPGDDLIRGVAGRNTLLGGDGNDTLLGGVGSDTIEGGDGNDLILGDADINL
FT                   ATGRLFTLEAGGADFLDGGDGNDTLNGGGGNDTLFGGGGNDLLGVVTLPASLGGAVFDE
FT                   PGRDLLDGGDGNDTIRGGPGDDTLNGGGGDDFLDGGAGDDLLDGGDGNDTLSGGAGNDT
FT                   IRGGSGNDLLFGRDGDDLLDGGTGDDLLFGGNGNDTLFGGAGNDTLSGGAGNDLLRGGA
FT                   GNDLLFGNEGNDTLFGGAGDDTLQGGAGDDLLVGGEAIRPVGARVAPGQPSDGNDVLAG
FT                   GDGRDTLHGGTGDNIMDAGLDSFRERMFASQGRHVIFNRFLRPGTRNFRVDDAATLPNR
FT                   GRGSRIAHNRQLFEIVEPVEPAAEPGIAPPFIDDRAQRLQLGRFLRRRGIAPAARPDGP
FT                   IARFVLWRDPKRPRLASAGESSERPTLSVKGAGQVL"
FT   sig_peptide     complement(189435..189527)
FT                   /locus_tag="Isop_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(190037..191383)
FT                   /locus_tag="Isop_0125"
FT   CDS_pept        complement(190037..191383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0125"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR019734: IPR013026: IPR001440; KEGG:
FT                   cyb:CYB_1571 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60722"
FT                   /db_xref="GOA:E8R5I1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5I1"
FT                   /protein_id="ADV60722.1"
FT                   /translation="MTAASHQPEPPAPSSERSESPRHDLAAQEASKSDPIPSTKGSLGI
FT                   NLMLAVVALALGGGGVWWVLGESGGDIGATRLRQIEQARRLLEAGRPDQALNQVADIRD
FT                   DGPGAAEAMRIAGQALIALEDYGGARNALERSVILNPNQPQVFQLLAALALGASDAQRG
FT                   ADYLERAAQLDPNQPRTWRALGIVRHQLGESAASVDAYQKALALAPDDWAVRVNLIAGL
FT                   LDLTRLDEASQALAQAEMLRPGDSMILGLRARLALAEGKLDEALTLADQCLQADPKNLD
FT                   ALSTRARLAIQHDDPHTAKALYQRLLEIDSENLGALQALAAAARAAGDAETARDAAQRH
FT                   RDVTNRRRAMDDLVQQIAQNPDDPRPRHQLGLLAVEANQTTLAVDSFQAALMVDPKFEP
FT                   AREQLRQLARRFPNQAPSGLLDRLGTNATPIIARPPATESETQPIPLDP"
FT   gene            complement(191669..192781)
FT                   /locus_tag="Isop_0126"
FT   CDS_pept        complement(191669..192781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0126"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902: IPR001120; KEGG: plm:Plim_0377
FT                   protein of unknown function DUF1559; SPTR: Putative
FT                   uncharacterized protein; PFAM: Prokaryotic N-terminal
FT                   methylation motif; Protein of unknown function (DUF1559);
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60723"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR027558"
FT                   /db_xref="UniProtKB/TrEMBL:E8R5I2"
FT                   /protein_id="ADV60723.1"
FT                   /translation="MIRLRRSTRSGFTLIELLVVIAIIAVLIALLLPAVQSAREAARRA
FT                   QCVNNLKQIGLALYNYESANGSFPASYPCRNISNPAEVRETWGTFSPQALMLGYIEGGA
FT                   IANSLNFQICNRDNAAGQIQNQTGISIRIQTFLCPSSVPPVGTDGGRLRPGNNYFASVG
FT                   ASLSFRSRPDMGAGRPNGLFSVFGNNGGDTITIASITDGTSNTIAFGEWRTGDFNESRY
FT                   SLQDVINLRQPPPNAGWASPNLNMPAGAVGFRTWIEQCAGLGQNPSTLGDWRINMSYLG
FT                   SSWHQGMFGWSLGNALLPPNSPYPNCRTCSWDGDWDCEGMYTMSSFHPGGGNILMADGS
FT                   VRFLKTTTAWPVLWGLGSRAGGEIISADTF"
FT   sig_peptide     complement(192671..192781)
FT                   /locus_tag="Isop_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            193916..194710
FT                   /locus_tag="Isop_0127"
FT   CDS_pept        193916..194710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tth:TT_P0178 hemin transport system permease
FT                   protein HmuU; SPTR: Hemin transport system permease protein
FT                   hmuU"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60724"
FT                   /db_xref="GOA:E8R629"
FT                   /db_xref="UniProtKB/TrEMBL:E8R629"
FT                   /protein_id="ADV60724.1"
FT                   /translation="MVDLVASAPARSGAAPRTPLMWLGLVAAALLSTALSWFTADRLAQ
FT                   VVRVEADEKASSDPYAFEQLNAELIRVNSRDAGARYAALGGVTGLVFAVLGLALGRKPV
FT                   AGMIGVVTGVVIGAAVGWATVQKLYPSLYEMERDPAAVQIHLIILGHWAMWGGAGLAAG
FT                   LGYAWGAGRFKALPWTILGGVFGVGSVGLLYELIIPMIFPTLPDVSHALPEEFIARLII
FT                   WIAVPLGAAIGIGAALSLGNGSPPKPPSLAMGSDPVSPNPSA"
FT   sig_peptide     193916..194023
FT                   /locus_tag="Isop_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            194950..195633
FT                   /locus_tag="Isop_0128"
FT   CDS_pept        194950..195633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0128"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="InterPro IPR000866; KEGG: sus:Acid_3880 redoxin
FT                   domain-containing protein; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; SPTR:
FT                   Peroxiredoxin-like protein; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60725"
FT                   /db_xref="GOA:E8R630"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R630"
FT                   /protein_id="ADV60725.1"
FT                   /translation="MKQHILIGLVFLVGIGGSVYIYATRDAARKNAALLQARAHVAKQI
FT                   EVGSHRVTQEMERKAREVARTAAAELSAVADDGVVMTLADVTEQGTKPAVLIFIKDKCP
FT                   CSAAAEPYYAQLHRAYGHALNFVGVIDGDLDVARQWRSFHDTPYPILCDPDLAIVRNYH
FT                   VTNSAYVALITPQGIIETLWPGFSDDLLQEMGRTFAAKAGIDPVPLVFQDAPAQPYAGC
FT                   PFFLD"
FT   sig_peptide     194950..195018
FT                   /locus_tag="Isop_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            195692..197029
FT                   /locus_tag="Isop_0129"
FT   CDS_pept        195692..197029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0129"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COGs: COG0128 5-enolpyruvylshikimate-3-phosphate
FT                   synthase; InterPro IPR016228: IPR006264: IPR001986; KEGG:
FT                   psl:Psta_2422 3-phosphoshikimate 1-carboxyvinyltransferase;
FT                   PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase); PRIAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; SPTR: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60726"
FT                   /db_xref="GOA:E8R631"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E8R631"
FT                   /protein_id="ADV60726.1"
FT                   /translation="MSETSSQVATRLLPRWTQPPRDLEARVPGSKSLTNRALILAAVAR
FT                   GRSVLTGALDSDDTRVMRRALDRLGVSVRAADGGSTLTVDGCSGRFPRETAELECGNSG
FT                   TSLRFLAAMLAAAGRGPYRLDGNPRMRQRPAADLIQALNGLGAFASSELGTGYPPLLIR
FT                   VEEPGLDGGFAFVKGDVSSQFLSALLMALPLAKGPSSIEVEGDLVSKPYVTMTMKMMEH
FT                   FGVIISNRDFKRFNIRPSAYTAAHCAIEPDASAASYFWALAAISGGSVRVVGLDDASVQ
FT                   GDVAFVQVLEHMGCRVDRNARGIQVAGGPLRGVDVDMNAISDTVMTLAVVALFAEGPTR
FT                   IRRVGHIRHKETDRIAALATELRKFGAEAIAHPDGLTILPPSDPAQLVPARVSTYDDHR
FT                   MAMAFALTSARLEGVIIEDPGCVAKTYPGFWEDFEALRLQAQASRE"
FT   gene            197133..197732
FT                   /locus_tag="Isop_0130"
FT   CDS_pept        197133..197732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0130"
FT                   /product="Uncharacterized protein family UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509; KEGG:
FT                   psl:Psta_2264 protein of unknown function UPF0102; PFAM:
FT                   Uncharacterised protein family UPF0102; SPTR: UPF0102
FT                   protein PM8797T_28449; PFAM: Uncharacterised protein family
FT                   UPF0102; TIGRFAM: conserved hypothetical protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60727"
FT                   /db_xref="GOA:E8R632"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E8R632"
FT                   /protein_id="ADV60727.1"
FT                   /translation="MDGKAGASARSRASLMKMNERNRRDPAQGDRAGEARRPPAVVETG
FT                   PPPTRPTPKRWMPESWWWRWHCWCCRRERRLPLGTRGERAAARWLQRRGLRILARNFRV
FT                   GRDEIDLIAREGDVLVFIEVKTRARGNPAEAVDLNKQRKLARAGAKFAHRFEVDQVPQR
FT                   FDVVAVVWSRRREENGDPPEMVHHRHAFVPNESMNV"
FT   gene            198135..199280
FT                   /locus_tag="Isop_0131"
FT   CDS_pept        198135..199280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0131"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR000644: IPR004800:
FT                   IPR018506: IPR001347; KEGG: psl:Psta_0845 KpsF/GutQ family
FT                   protein; PFAM: sugar isomerase (SIS); CBS domain containing
FT                   protein; PRIAM: Arabinose-5-phosphate isomerase; SPTR:
FT                   KpsF/GutQ family protein; TIGRFAM: KpsF/GutQ family
FT                   protein; PFAM: CBS domain; SIS domain; TIGRFAM: KpsF/GutQ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60728"
FT                   /db_xref="GOA:E8R633"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E8R633"
FT                   /protein_id="ADV60728.1"
FT                   /translation="MAPVRAAGIVEEAVNGVGGSPLADRGKDRPFTDAEALEFARRVVR
FT                   IEAATLERVADRLDEGLVRVADRLGSGRALVFVLGVGKSGLVGEKLAATLASTGTRAFP
FT                   LHPAEALHGDLGRVREGDVALLLSASGETEELLKIVPPLKALGAVLVAITCHERSALAR
FT                   KADERIILGPIEEACPLGLAPSATTTAMMAVGDALALLVSRCRGFDARGFVKFHPGGAL
FT                   GRKLTRVEEVMRSGPHVRIARESEITREVLVRLGGASRRAGAILIVDDRGVLTGIFTDS
FT                   DLARLFERQRDYLLERPIVEAMTRAPSLIRAGRSLAEALDALQARKLSELPVIDEAGRP
FT                   IGLIDVTDLLGMVPPHLLQAETDEPAKTVAAASSESGEEVP"
FT   gene            199277..199852
FT                   /locus_tag="Isop_0132"
FT   CDS_pept        199277..199852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0132"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="COGs: COG1778 Low specificity phosphatase (HAD
FT                   superfamily); InterPro IPR010023: IPR006549; KEGG:
FT                   psl:Psta_0844 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; PRIAM:
FT                   3-deoxy-manno-octulosonate-8-phosphatase; SPTR: Phosphatase
FT                   kdsC; TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   8-phosphate phosphatase, YrbI family; HAD-superfamily
FT                   hydrolase, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60729"
FT                   /db_xref="GOA:E8R634"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R634"
FT                   /protein_id="ADV60729.1"
FT                   /translation="MSFEFDDLSDASSDTVAAGNRSLGLRERCQRMELLVLDVDGVLTD
FT                   GVIALDDRGIELKRFSVRDGAGISYWRKAGGKVAILSGRRSRAVDLRAAELGITPVIQG
FT                   AKAKLEPFLGLLEDLGIPAERTVYMGDDLADLPPMGLAGLAACPSDAAAEVIRAADHVT
FT                   RAPGGRGAVRELVEFLLDARGGWPPRDA"
FT   gene            200234..204325
FT                   /locus_tag="Isop_0133"
FT   CDS_pept        200234..204325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_3739 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60730"
FT                   /db_xref="UniProtKB/TrEMBL:E8R635"
FT                   /protein_id="ADV60730.1"
FT                   /translation="MARSLLRTVVVGILLVALHQGYLRAYVWLEQALRPNRSGLTIETL
FT                   RPSASKQEAMRLARLAFGEDHWTTPADLPWRYYNSARGYWLYAREQALSADRKTVTFSP
FT                   FALIWRSEGGSTEGDPLDDPNFNLITVLAERAEVVLDQPLNAKNTGRAGGLGNRIVTAR
FT                   IDGDVLARDHRKTIGDPRDDLIVKMPYLEYVERDFLIRSDAPVILWDQDFQISGVNLTI
FT                   ELIPSVSEETGVPSGTAGFAGVNLIRLDRDVHIYARETGGDSFLPGRPRPRVRAVVAER
FT                   RPVQGQEQERGGEGQSTSGGLALEVALAAESERDVLPELPLAVDSAAAKGRPGEPIPVE
FT                   LRCDGAMRIVPPFVVQPNRDPNRDGPAPTMAYFTRNVKVSRGFENAVDQLNCDDLTITL
FT                   VPEPRLAIDPTASAATHAVLQGAALGIGQFGVGVSLAWSAHAGILATCSTAATTGLAKA
FT                   SPARSDSAPATRSKANSPLDSRMTASFERLTPRRVLAEGHAVWLQSQGLGLKARGTKLT
FT                   YDRPGSGRPDRAVLDAGPTSRVFVEQVDLDPRDPAKIRSVATVRSRQVTILDDGSPGGP
FT                   INLRAQGPGTLEEREEAGQPARRTVSWDELLELRSPAQDQRILILTGRPALYDARSGTL
FT                   QARDRIVAWLQAQPRPVNAEAPVAAATRHPRDSGSFRIERLQAFNQVKLDAPGQSLMAR
FT                   DRLDAFFETPEAVHQVQTTTARLTGPPVDTAVGPVAARWVVQEANALANPAAGAGTQGA
FT                   GRGEAAPAAAPSTWKVEAQMVWARLTARSNPTRSAARGDNAGEAAAFTPLTPTANGVVG
FT                   GDGAWDLEQAFLRGGVAVRQEFPADSPQAGTGLRVEGAAVDVERKAEDRHLLKIVGDEA
FT                   RPVARVWNSQFDLRGPKMVVNQLKEFAYVEGAGELTTWGEGPLGGSVKAAGPVATARRA
FT                   ALQDDEETPAAAASSSQARPKTIRWTRLMTFEGRVVESDGVERPARARFDGGVRGDLGD
FT                   ADIACERLTAYLDQAVSFAGVASLLEPPGANREPRLQPRAVGEAGARPEANATPPPLQV
FT                   AWVRAEGGVALTHRPMNARIGRVDQIVRASGPVIVFDRGSGAYQIEGAGMVRHHQWKIE
FT                   RREPTTRVEPQPDGSARTVTVAAAERSFWQATRVTFQKGMMGRVGLDSSGVGFNIRGDQ
FT                   PQRAEFLGDVDLIQARVETADEDLNPDAPPPDFVRLSAARMIVDTLPPPPDAPADVKQW
FT                   LLMEAIGSANARTRDTSIQGATIKYDSLRSTCLVQGARGRDVLVVRQDQPGAGVSYGQS
FT                   GSVLVNLKTRDVALVDPKSGDLLTRPGAPLVAPPPVTPRPDRLRDRFPRPSQRNDRERS
FT                   DVGAGQRVLNGAGGNNGFLP"
FT   sig_peptide     200234..200308
FT                   /locus_tag="Isop_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            204712..204900
FT                   /locus_tag="Isop_0134"
FT   CDS_pept        204712..204900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0134"
FT                   /product="Flp/Fap pilin component"
FT                   /note="InterPro IPR007047; KEGG: psl:Psta_2071 Flp/Fap
FT                   pilin component; PFAM: Flp/Fap pilin component; SPTR:
FT                   Flp/Fap pilin component; PFAM: Flp/Fap pilin component"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60731"
FT                   /db_xref="GOA:E8R636"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:E8R636"
FT                   /protein_id="ADV60731.1"
FT                   /translation="MSIRKHIVDFLKAEDGPTAVEYAVMVALIIVVCIAAITTLGQSAN
FT                   ETFTIAGDAVQAGNNAS"
FT   sig_peptide     204712..204816
FT                   /locus_tag="Isop_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            205398..206207
FT                   /locus_tag="Isop_0135"
FT   CDS_pept        205398..206207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0135"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="InterPro IPR000045; KEGG: plm:Plim_0796 peptidase
FT                   A24A prepilin type IV; PFAM: peptidase A24A prepilin type
FT                   IV; SPTR: Peptidase A24A prepilin type IV; PFAM: Type IV
FT                   leader peptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60732"
FT                   /db_xref="GOA:E8R637"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:E8R637"
FT                   /protein_id="ADV60732.1"
FT                   /translation="MWFSTAVVPDPTALPLAVLVVICAVMIEAAIIDGWKLKVPNWLTY
FT                   NFLGAGILYWTVTSGWAGFQFAMLGFLAGFVLYPLCLVGGMGAGDVKLLFGIGAWTGWY
FT                   ATLVIFALCAVVGGIMAVIMMAREGQLAHRLLNLQIILSEWWSLKNPENLEKVQASALE
FT                   RKQADLKKKMLLPYGIPMVIAAVSYLSYIWVDANGLSSARAAVPTVTASTGGQPITPST
FT                   MGPALRSTSTPSVARDVPSESSSSAESAVGSEPAASSPSTEAADARS"
FT   sig_peptide     205398..205484
FT                   /locus_tag="Isop_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            206448..207758
FT                   /locus_tag="Isop_0136"
FT   CDS_pept        206448..207758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0136"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="COGs: COG3745 Flp pilus assembly protein CpaB;
FT                   InterPro IPR017592; KEGG: bbt:BBta_7030 putative pilus
FT                   assembly protein, CpaB; SPTR: Putative pilus assembly
FT                   protein, cpaB; TIGRFAM: Flp pilus assembly protein CpaB;
FT                   TIGRFAM: Flp pilus assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60733"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:E8R638"
FT                   /protein_id="ADV60733.1"
FT                   /translation="MSRGVLTLVLALVVGGAAMFLARSYLKTGPQPPKKYFVVVARQTI
FT                   TPGTSLNEIDEALSQTPNPFRYLDLREITPEELFAELKQPFPDLSAVGGGSQSASSAGE
FT                   TQNQPSAEGKQQAAPPAEGGNTPQSLASTGGKDTLTPEQRAELERRMRELPVFFDRAGL
FT                   QRLADAKSPYWASQTIGKGEIITRDMLGDPATIPGVYTNVRPGYRGISIKVTPETGGGG
FT                   HVLPGNYVDVGAVYTNQRTAKILLQNVKVLAVGEAIKPDPKKAAMNAQTVVLELKPEEA
FT                   NLLQVAVGQRGTLRLLIRGNKDDQLLSEDKLEVVYGESEAERLDLRQKLEDLDLKHNMF
FT                   LAEKVDELKGGKPTTPTATVKAKAEPSARRNGVLVVTTPGKAQTVNAGGGGETNPGTVF
FT                   SSVPGQAGTLNAATPNPGQFINPGPPPVNYGQPSGQP"
FT   sig_peptide     206448..206519
FT                   /locus_tag="Isop_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            208304..209527
FT                   /locus_tag="Isop_0137"
FT   CDS_pept        208304..209527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0137"
FT                   /product="response regulator receiver"
FT                   /note="COGs: COG4963 Flp pilus assembly protein ATPase
FT                   CpaE; KEGG: plm:Plim_0793 response regulator receiver;
FT                   SPTR: Response regulator receiver protein; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60734"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R639"
FT                   /protein_id="ADV60734.1"
FT                   /translation="MNKGVIRVVLIDPNEESRKTLQRMLGSLNNLWLADVCTAYSNAAA
FT                   TVAESPPDLTVIVMDNNPEEALGVIAGIYKVVPDALVLPACTAALIQPDMLMRLMRFKT
FT                   APVLPLPTEMDQLIKAIEDQVRPGAQDQSDSSVPKLVAVTGASGGVGCTSLAVNVGAML
FT                   ARSHPNQSVALLDFDMLFGTVDSCLDLIPERTVMDMLRDLDRLDQTSMRQILLSDESGL
FT                   HVLPHPVSMEESAQINPEALRRMVGMLKVSFDTVLIDCSKSLQAPDFIAFELADIILLV
FT                   VQLDLNNLRNSARLLSLFRQPEFEWGDKIRVVVNRYGSHTQEITPRRAQEVLETPISWQ
FT                   IPNDTATYSAAMSRGRPIDVVNPKCPARKVIQDIVETLAKPVESGSGPSNGATGPKIPF
FT                   RSKTRSRF"
FT   sig_peptide     208304..208420
FT                   /locus_tag="Isop_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209772..211355
FT                   /locus_tag="Isop_0138"
FT   CDS_pept        209772..211355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0138"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG4962 Flp pilus assembly protein ATPase
FT                   CpaF; InterPro IPR017975: IPR001482; KEGG: plm:Plim_1918
FT                   type II secretion system protein E; PFAM: type II secretion
FT                   system protein E; SPTR: Type II secretion system protein E;
FT                   PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60735"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R640"
FT                   /protein_id="ADV60735.1"
FT                   /translation="MGLGNTGRPFGNTGFGGRFGNRGGLSSPATGAPGVTGATGAPGVT
FT                   GVTGVTGAPGVTGVTGVTGGVTGIPGRTGITGGVTAGGTPIGGAGLKPGGDREVDAPGD
FT                   KFDSLKRQIHLQLVDKLDFSKLGEMDQGTLKTEVKALIETLIDEQNPIINRQKRSEIVK
FT                   EIMDEVFGFGPLELLLKDDKIGDIMINGPKTIFIEKGGKIQKTDVVFKDNQHLLQIIDR
FT                   IVARVGRRVDETSPMVDARLPNGSRFNAIIPPLALDGPAVTIRVFGSKPLGKEDLLKFK
FT                   AFTPEMILMLEGAMKARLNVVISGGTGSGKTTLLNTLSSFIPHDERVITIEDAAELQLQ
FT                   QPHVVRLETRPANIEGKGAVTATDLVKNALRMRPDRIIIGECRGAETLDMIQAMNTGHE
FT                   GSMTTVHANTPRDAIARLETMISMAGLELPIRALRQQFASAIDLIIQANRLQGGPRKVT
FT                   SITEVVNMEGDTIIMQEIFGFKQTHVDETGRAHGQFWCHGIRPTFMDRLEAKGFHVPPD
FT                   FFRQRMLLED"
FT   gene            211650..212645
FT                   /locus_tag="Isop_0139"
FT   CDS_pept        211650..212645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0139"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG4965 Flp pilus assembly protein TadB;
FT                   InterPro IPR018076; KEGG: rba:RB5941 secretion system
FT                   protein TadB; PFAM: Type II secretion system F domain;
FT                   SPTR: Secretion system protein TadB; PFAM: Bacterial type
FT                   II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60736"
FT                   /db_xref="GOA:E8R641"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E8R641"
FT                   /protein_id="ADV60736.1"
FT                   /translation="MPISPEMLILGLIGLAAIILVFGVSQLLATPRNNAEDRLKKVISA
FT                   QKAPQGPKASAISVVKQEVMPSDNPLLKMLPKLDSIADLYEQAHLGIPFTNFLVIVAAL
FT                   MALPMVVYLATTTLGYAGILPFYVFPIASVLFGVMSIAFLNYMKKKRINDFTAAMPEAL
FT                   ELTGRALRAGHGLGSGLKMVADEMTGPIAEEFGRVFEEQNLGIPMEEALRAMANRIPTM
FT                   DVRFFVTAVVIQRQTGGDLGEVLDKISHLIRQRFEIKGQVAALTGEGRLSGAVLLAMPP
FT                   LLLLYLFMTNRPYVMPLFTDPELGQPMLIGAAVLQILGALAIRKIVDIKV"
FT   sig_peptide     211650..211736
FT                   /locus_tag="Isop_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            212749..213705
FT                   /locus_tag="Isop_0140"
FT   CDS_pept        212749..213705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0140"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG2064 Flp pilus assembly protein TadC;
FT                   InterPro IPR018076; KEGG: plm:Plim_1916 type II secretion
FT                   system protein; PFAM: Type II secretion system F domain;
FT                   SPTR: Type II secretion system protein; PFAM: Bacterial
FT                   type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60737"
FT                   /db_xref="GOA:E8R642"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8R642"
FT                   /protein_id="ADV60737.1"
FT                   /translation="MAGLSPEMMTTVVQLVVALCGALAVVGLMTMLAPKEKDRLGELLK
FT                   RDKAGPSRLAEERAKKKNEEVKKKIAKVVEEIGKNSAASEKDMSQIKLDLINAGFRSPN
FT                   AVSIFMGVKLIFFLTSVAVVVPLVYTNYGFTTTGILYMAIGAAIGMIAPSFFLGYLKSR
FT                   RQEQIFLTLPDALDLMVVCVEAGLGLDAAFNRIASELQTAAPVLCEEFAIANFQIRMGR
FT                   PRREVLRDLGVRTGVADLRALAAVLIQAERFGSSIASALRVQSDSMRIKRRQIAEEKAA
FT                   KTAVKLLFPLVLFIFPGIFVVLVGPAAISIKQNLVQK"
FT   sig_peptide     212749..212847
FT                   /locus_tag="Isop_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            213750..214103
FT                   /locus_tag="Isop_0141"
FT   CDS_pept        213750..214103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eat:EAT1b_1475 arginine/ornithine antiporter;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60738"
FT                   /db_xref="GOA:E8R643"
FT                   /db_xref="UniProtKB/TrEMBL:E8R643"
FT                   /protein_id="ADV60738.1"
FT                   /translation="MSRSFQEIKPPPEIKGNRGLIRTILALLLIFSPVLLDCAWVVASW
FT                   WQPFLGVGPVKGDFNTPFLDALGAITGFSSEQAAFVWGDFRDQVFMTPTVGITVFLAIS
FT                   GVMMLFMSAARNR"
FT   sig_peptide     213750..213878
FT                   /locus_tag="Isop_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(214310..215002)
FT                   /locus_tag="Isop_0142"
FT   CDS_pept        complement(214310..215002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gga:423772 similar to KIAA0592 protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60739"
FT                   /db_xref="UniProtKB/TrEMBL:E8R644"
FT                   /protein_id="ADV60739.1"
FT                   /translation="MIRCRFGWGRLGLLLALGMLGHGLGIASAGAQDQQPDPNLVKLDP
FT                   KAISLEPLGEKVGHFRLRNVSNQIEPDGATISTVAWLVVPPGAIAPTNDPQNPSATVSP
FT                   LTILEGSTGFNEDELKVLLGEGLKDNQAVQAIGLEFGDQGFAPEGVLNFALSTPPSLEG
FT                   DQLNLTDALVTGRWNQPLVPPSNQPADTNPVIPDPIPEPTSVLFWLGMTAVAATRLRAR
FT                   QRRIGVSA"
FT   sig_peptide     complement(214910..215002)
FT                   /locus_tag="Isop_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            215831..216499
FT                   /locus_tag="Isop_0143"
FT   CDS_pept        215831..216499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0143"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog;
FT                   InterProIPR014284: IPR018247: IPR000838: IPR007627: IPR
FT                   013249; KEGG: sth:STH2677 RNA polymerase ECF-type sigma
FT                   factor; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; SPTR: RNA polymerase, sigma-24 subunit,
FT                   ECF subfamily; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60740"
FT                   /db_xref="GOA:E8R645"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8R645"
FT                   /protein_id="ADV60740.1"
FT                   /translation="MTATFAQAKTATDETLVELARRNCAPAREELFRRHWVVSRRIAIR
FT                   LLGQESDAEDVVQAAMIKALAHLDDFDGRSQFRTWLLRIVTNTALDAGRRRGRGLARRI
FT                   HRGELDRGEPIQDLDPSRTLQLEDLRRALDDALNQLSPTLRTTFVLFADAELSYKEIAE
FT                   TLGIPIGTVMSRIHQARRKLQEHLRDTLQADWDLTTPASRPERSPAEPQPNTSASIPLD
FT                   "
FT   gene            216612..217310
FT                   /locus_tag="Isop_0144"
FT   CDS_pept        216612..217310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hoh:Hoch_3681 serine/threonine protein kinase;
FT                   SPTR: Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60741"
FT                   /db_xref="UniProtKB/TrEMBL:E8R646"
FT                   /protein_id="ADV60741.1"
FT                   /translation="MHEPFPPPRRGQPEWPNGTLAALHKPKTLPNPSSDSDWARELGND
FT                   PDANRLADLWRVTRPNDPDDDAWAHTWSVIEARAAAHAKARRLKPLWLLPTALRPHGRQ
FT                   SWAVASVLLAASLLTALGLGWLRPIGSGPGSNSTQSQPHAPAMLTISLEVGQLGLLDLS
FT                   GATPTVHTLDTDRLLLAAWGQLDPDADPVDLINEFKNNPAERDLAMGLVVAEFQIFNHM
FT                   ESIADSEGSW"
FT   gene            217304..218200
FT                   /locus_tag="Isop_0145"
FT   CDS_pept        217304..218200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL3065 hypothetical protein; SPTR: Fork
FT                   head transcription factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60742"
FT                   /db_xref="UniProtKB/TrEMBL:E8R647"
FT                   /protein_id="ADV60742.1"
FT                   /translation="MVTPSPPGDAILESPNHPDTFLRTPRCMRRIVMSISRGLALATMM
FT                   IVTFAWNAPSPVWAWTLDDPPAKEQVESPRNPDHPAPASPQEDEHKVDTPDAQADETTD
FT                   TSSKTARQAGTRPNPPKRRAAGGIETQLGAALNDLGLGRVAQGAVVNSRQVTLFAIVAD
FT                   PHDRSIDPKLREIEPLLSRSLPHHGFRLIDARTLRLKPGEAIHCGLTAEARTMLSQPML
FT                   PEGWPPMPATATPVVARAELVSAWTNRGKVEFRLALLGADGAPQVASLVSTPPNQLFFV
FT                   NNPLPNGGRLLIGLGAR"
FT   gene            complement(218315..219643)
FT                   /locus_tag="Isop_0146"
FT   CDS_pept        complement(218315..219643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0146"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="COGs: COG0265 Trypsin-like serine protease typically
FT                   periplasmic contain C-terminal PDZ domain; InterPro
FT                   IPR001940: IPR001254; KEGG: plm:Plim_3737 peptidase S1 and
FT                   S6 chymotrypsin/Hap; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; SPTR: 2-alkenal reductase; PFAM: Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60743"
FT                   /db_xref="GOA:E8R648"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8R648"
FT                   /protein_id="ADV60743.1"
FT                   /translation="MRDEWSVSSRDARRTGAFPEGGRLEPERLGRREADVVWFAPRAAL
FT                   IVSAIFLMALGIGALTTLTPVSQPTSEATAAATGSQPGTRSVQPPGPALGQRDNTAYTL
FT                   PPIAPPALSPEPAAIVAADERNNVEIYAAVNKSVVNITTAAVVPGLFGDDVTEGSGSGF
FT                   VIDRAGYILTNHHVIERAEAIQVTLYDGTTLPAEVIGQDPPTDVAVLRVKTTPDKLVPV
FT                   ALGDSSTLQVGMKVLVLGNPFGLDRTLTTGIISSLDRSLKGRSDARPLKGLIQTDAAIN
FT                   PGNSGGPVLNSRGQVIGMSTAIYSRVGQSSGIGFAVPINSIKRILSPLITQGKVIRADL
FT                   GIVQVAVTEVGLRVYRIVEGGPADLAGIRPVRIVTERISPYTIRRRLDTAFADIIVAID
FT                   GKKVTTVDDLLTAVEEHEPGERVTVTVLRDGELVNLLVVLGAS"
FT   gene            complement(220286..223969)
FT                   /locus_tag="Isop_0147"
FT   CDS_pept        complement(220286..223969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0147"
FT                   /product="membrane-bound dehydrogenase domain protein"
FT                   /note="COGs: COG2133 Glucose/sorbosone dehydrogenase;
FT                   InterPro IPR009056: IPR013428: IPR013427; KEGG:
FT                   sli:Slin_5811 membrane-bound dehydrogenase domain protein;
FT                   SPTR: Membrane-bound dehydrogenase domain protein; TIGRFAM:
FT                   membrane-bound dehydrogenase domain protein; heme-binding
FT                   protein; PFAM: Cytochrome c; HEAT repeat; TIGRFAM: putative
FT                   membrane-bound dehydrogenase domain; putative heme-binding
FT                   domain, Pirellula/Verrucomicrobium type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60744"
FT                   /db_xref="GOA:E8R649"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR013428"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8R649"
FT                   /protein_id="ADV60744.1"
FT                   /translation="MSPRALIALLVLGLIVGSFSGSWNGGPAVCRAQMPPEQTVTTLKP
FT                   AEGLEVILFAAEPMVVNPTNIDVDSRGRVWVTEGLNYRLYRNEKGEIVRQHGADRIKIL
FT                   EDTDLDGRADKVTVFAEGITPVPMGLAVEERYDDHGRYLGCRVYVGNSPNLMVFEDTNG
FT                   DDKADRIEPLLTGFGGIDSDHGVHGMVLALDGKLYFTHGDGCCSVQPDKSQKTQNFDVV
FT                   DHSGRHVRSDQLANTLRVNRDGTEFEIIADRQRNNYEIALDSFGGMFVSDNDDDGRQGC
FT                   RIIHVFDGGSYGYRTPGSPRHWGEEVPGNLPKLVGTGNGSPCGLRVCETNALGDRFLGA
FT                   LLEAEAGTRQINVFPLTRMGATYRTTSGETLLRGDDPWFRPVDVTLDHDGSALVADWYD
FT                   GGVGGHAFQDQTTGRIYRVAPKGWQPSRPSHDFGTPDGLLAALKSPVTATQDAAARALV
FT                   AQGPAACATVAQLALNGSPIERARALWVWTRIDGLDPAVTLANDPDPRVREQAARILGR
FT                   DVSRMGDVTFTRPEAQRPLRALERLDDLLTLVDDPDAGVRKEVILALRDLPTNHDGGKV
FT                   GQALRRLTASWDGQDRWYLEALGLALQHREPAFITDLLGDPRSGAGGVFGPLDLEQTAR
FT                   QGDVALPPYFPADRNDAYLTPEDQFGPVTPLSRSLGLAWRLNRAETAAWVAEVLPSLDH
FT                   PALRRVAEEILGRASDPAIGVRLARLATNDLTTDPNRARSAIATLASKLGGDWRAARDH
FT                   QAVSDLITRALATPSLRGDALKLIAATKSPRYVNTLIDLIGGQDPELRADALETLARLS
FT                   PETARPLVEEALERARGQSASNPLADASARALIRLADSPEKARDRLRDLLTDENLPLGL
FT                   RREALKSLAGFQQGIDTILDLGRTQALPSELIGEARLILASHPDPRMRQRAAADLPASA
FT                   SKGRDFSDLIELAARNGDAQRGRAQFLAGSQACAGCHRVQGKGEWIGPDLSTIGVKYAK
FT                   ADLLRHILAPNEAIGYNYRTVVVALNDGQILSGLPVEDSAERLILKTADGRRITIPVAE
FT                   IEERSQSDVSLMPEGLLDQWDDQAIVDLLEYLSSLTATVAVVGELEVVEPNDASSVNRL
FT                   TANVEGLFDLSSLWATNPNSNQPDAARSVTLRVGLTSPGVQTARLVLDHGPGWRVAVAL
FT                   DGQPLTLDPHSETTLELPAGRVADLTLILKRSPQANDDASRSTLGVAVVADRPVRTTLR
FT                   RP"
FT   sig_peptide     complement(223904..223969)
FT                   /locus_tag="Isop_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(224387..225214)
FT                   /locus_tag="Isop_0148"
FT   CDS_pept        complement(224387..225214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0148"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COGs: COG0101 Pseudouridylate synthase; InterPro
FT                   IPR001406: IPR020097; KEGG: psl:Psta_4219 tRNA
FT                   pseudouridine synthase A; PFAM: Pseudouridine synthase I,
FT                   TruA, alpha/beta domain; PRIAM: tRNA-pseudouridine synthase
FT                   I; SPTR: tRNA pseudouridine synthase A; TIGRFAM: tRNA
FT                   pseudouridine synthase A; PFAM: tRNA pseudouridine
FT                   synthase; TIGRFAM: pseudouridylate synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60745"
FT                   /db_xref="GOA:E8R650"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E8R650"
FT                   /protein_id="ADV60745.1"
FT                   /translation="MLRTLKLILAYDGTEFSGWQRQPGHRTVQEVVESALRPLTGEPVA
FT                   VTASGRTDAGVHALGQVAHFHTIARHPPEVFLKALNATLPPDVRVVWAEEAPQSFHATL
FT                   DAQSKRYRYVIDNGPFADPFLRRTAWHLFRPLDAPRMNRAVQALRGRHDFRSFETNWPN
FT                   RMSSVRTILDVQVRRIDHRVELEVEADGFLYNMVRSIAGTAVLVGLGDRPETFVAEVLH
FT                   AQDRRLAGPTAPPQGLFLLQVRYGLRDRVARSLGRNGQPPGRFIPSPPFPNPT"
FT   gene            complement(225331..226344)
FT                   /locus_tag="Isop_0149"
FT   CDS_pept        complement(225331..226344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0149"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="COGs: COG0136 Aspartate-semialdehyde dehydrogenase;
FT                   InterProIPR012080: IPR005986: IPR000319: IPR000534: IPR
FT                   012280; KEGG: dma:DMR_16050 aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding; PRIAM: Aspartate-semialdehyde dehydrogenase; SPTR:
FT                   Aspartate-semialdehyde dehydrogenase; TIGRFAM:
FT                   aspartate-semialdehyde dehydrogenase; PFAM: Semialdehyde
FT                   dehydrogenase, dimerisation domain; Semialdehyde
FT                   dehydrogenase, NAD binding domain; TIGRFAM:
FT                   aspartate-semialdehyde dehydrogenase (peptidoglycan
FT                   organisms)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60746"
FT                   /db_xref="GOA:E8R651"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R651"
FT                   /protein_id="ADV60746.1"
FT                   /translation="MRLRRVAIVGATGAVGAVFLKLLEERAFPLDSLRLLASGRSAGRA
FT                   IRFRGIDHPVEELRPEAFEGIDLVLSSTPASVSKTYSPLAVQAGAVVVDNSSAWRMDPE
FT                   VPLVVPEVNPEAIAQHRGIIANPNCSTIQMVVALKPLHDFARIRQIVVSTYQSVSGAGQ
FT                   TGLNELESQRRALAAGQPLPPPAKFPHPIVNACLPQIDEFDADGYTKEEWKMIRETRKI
FT                   LGDDTIQVAPTCVRVPVPMCHSESIRVETERPIEPDQARALWKQAPGVELLDDPAAKRY
FT                   PLADQAAGRDPVYVGRVRRDPDDPHALLFWCVADNLRKGAALNAVQIAEHLQRHGS"
FT   sig_peptide     complement(226264..226344)
FT                   /locus_tag="Isop_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            226602..228257
FT                   /locus_tag="Isop_0150"
FT   CDS_pept        226602..228257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0150"
FT                   /product="ABC-1 domain-containing protein"
FT                   /note="COGs: COG0661 unusual protein kinase; InterPro
FT                   IPR004147; KEGG: cvi:CV_2967 ubiquinone biosynthesis
FT                   protein; PFAM: ABC-1 domain-containing protein; SPTR:
FT                   Probable ubiquinone biosynthesis protein; PFAM: ABC1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60747"
FT                   /db_xref="GOA:E8R652"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8R652"
FT                   /protein_id="ADV60747.1"
FT                   /translation="MLRETVGHLRDLPRYTQILSSLARYGYHDLLNALNLEILAKPLEW
FT                   VTLGEEAPPPERSKRLRLLLESLGPTFVKLGQLLSTRPDLLPEPYLSELALLRDQVAPF
FT                   PYEEVEATLVREFGAPVEQLFAEFDPVPVASASISQVHRARLADGRVVAVKVRRPDIEE
FT                   LVQADLDILKHLAESAERHVSFLRPYGPRSLAREFERGLLRELDLGLERRTMERVREQF
FT                   RDDPDVWIPQPIRERSCSCVLTMEFAQGLRIDDVNGLREAGIDPCLVAARGARIMIKQI
FT                   FEHGFFHADAHPGNMRVRRDGVIIPLDHGMYGYLDRATRERIADLLDGLMRQEADVVLR
FT                   ALDDLNVRGVRLDPVSLRRDVSELVASYSDLSLDNLELRFLLGDLFAVIRSHKLRLPPD
FT                   LVLLIRALVTIESTGRMLNPNFDIATELRPALRRLTVGRYSPRRLFVESARATRDLRQV
FT                   AMMLPDVLSHSLESIRRGELTLKFDLQHFDSMVRRIVLAANILSMGIVLAGLLVASSLL
FT                   MTVESQRFTMLGTVGLILAGALAVVLFFTMARRV"
FT   gene            complement(228291..229253)
FT                   /locus_tag="Isop_0151"
FT   CDS_pept        complement(228291..229253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0151"
FT                   /product="triphosphoribosyl-dephospho-CoA protein"
FT                   /note="COGs: COG1767 Triphosphoribosyl-dephospho-CoA
FT                   synthetase; InterPro IPR002736; KEGG: psl:Psta_4265
FT                   triphosphoribosyl-dephospho-CoA protein; PFAM:
FT                   triphosphoribosyl-dephospho-CoA protein; SPTR:
FT                   Triphosphoribosyl-dephospho-CoA protein; PFAM:
FT                   ATP:dephospho-CoA triphosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60748"
FT                   /db_xref="GOA:E8R653"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:E8R653"
FT                   /protein_id="ADV60748.1"
FT                   /translation="MKISSNWTVRDPLTIARAARLACEWEATAFKPGNVHPHARFDDLT
FT                   YDDFLRSAAAIEPIFARLDHPTLPENPRGGLGLGLGLGRLVLDAVVATRGVVATNTNLG
FT                   ILLLIAPLALVPTGENLAEGVGRVLDHANEQDAAAIFEAIRRAQPGGLGRGEDYGLPEG
FT                   FDVTCATPSGPTASLDQAMRAASHRDAIARQYSERFADLFAFGLPRLARDVQRGRPLPQ
FT                   AITLNALAWQAAFPDTLIQRKRGLSVALEASRRAREVLESGWPDRSEARLSLSGFDAWL
FT                   RADGHARNPGATADLVAATLFAALRLGLLGDDPGRFTLA"
FT   gene            complement(229294..230241)
FT                   /locus_tag="Isop_0152"
FT   CDS_pept        complement(229294..230241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0152"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="COGs: COG0189 Glutathione synthase/Ribosomal protein
FT                   S6 modification enzyme (glutaminyl transferase); InterPro
FT                   IPR011761: IPR004666: IPR013651; KEGG: psl:Psta_3185
FT                   alpha-L-glutamate ligase, RimK family; PFAM: RimK domain
FT                   protein ATP-grasp; SPTR: Probable ribosomal protein S6
FT                   modification protein; TIGRFAM: alpha-L-glutamate ligase,
FT                   RimK family; PFAM: RimK-like ATP-grasp domain; TIGRFAM:
FT                   alpha-L-glutamate ligases, RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60749"
FT                   /db_xref="GOA:E8R654"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E8R654"
FT                   /protein_id="ADV60749.1"
FT                   /translation="MTPPLLALAGRTRTGRWGWHVRDLARAAARLNLRFEPVEFQRLRA
FT                   TIAPLGRPGRVEADGWELTGPEVAGVLVRAMPSSSLERIVFRMDALRRVEAAGTPILNP
FT                   PRAIETAVDKYLTLVRLEAAGLPTPETWVGETSREALDAFDRLGGEVVVKPLFGSEGRG
FT                   LIRVGQRELARRTFAAIEATQGLLYLQRFVAGPGWDVRVFVLDARVVGAIRRFPASHDW
FT                   RANVSTGGTAEPFHVDAETERLAIRATEAVGARLAGVDLLPLGGIPHGWVIPEVNAAPG
FT                   WRALGACLRLDVAAFILEALRETPRLAPQQAPTP"
FT   gene            complement(230238..233240)
FT                   /locus_tag="Isop_0153"
FT   CDS_pept        complement(230238..233240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0153"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000719: IPR017441: IPR008271: IPR017442: IPR
FT                   020635: IPR002290; KEGG: psl:Psta_1107 serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; SPTR:
FT                   Serine/threonine protein kinase; PFAM: Protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60750"
FT                   /db_xref="GOA:E8R655"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8R655"
FT                   /protein_id="ADV60750.1"
FT                   /translation="MTFLPIISFIKILIQRGLFAKMDAITLTCPYCSAVIRPSRLRAGQ
FT                   FKPTCPKCGRTFRLTVSGTEPSWNVKVEPLETEPSVAPASATAANRPAATATVSAAASP
FT                   QVGAGDSLGYAVNSNPAAASNPVADSSPLRAASSIPGLTGGVDPLGDSDSVGEATGSAL
FT                   TDATPSSHGDTPEGLATLGGYRVLKLLGRGGMGQVYLARQITLDRPVALKVMRPDLARN
FT                   PRFLARFVREAYAAAQLSHHNVVQIHDFGEDRSIRFFSMEYVNGESLDQLIRRRGPLPV
FT                   NEAVGLILQAARGLEFAHRQGMVHRDIKPANLLLTDYGILKVADLGLVKTGRPSDDYEP
FT                   APTATETSHDSTSSPTTPSGSQAPTSPLDALVKGTEPLTLAHGAMGTASFMAPEQAEDA
FT                   SKVDARADIYSLGCTLYVLLTGRPPFTGTTFAQLVSQHAHAPFPPLRKALPQTPPELDA
FT                   ILNRMVAKRPEDRYPNTTALIADLERFLQTQLGRPTGPTAQEVADLEAAVADFQAAPAR
FT                   AYRAPAVLGFLAFNLGMAALTLMAGGYRGALGFLMAIPATWLAFLVIQTIRKRSDLGRR
FT                   LRADLWNLSWREAINLALALLTLAVAVSVLKLTGIVIGFGLYAIAAALAYVFLIDIPLR
FT                   NQRHESLTLLENTLKGMRLRGLDEDRIRQFVRDHAGDAWEEVFEELFGYTAKLEARPGA
FT                   LPATGGRPRPRFAPWRDRLMTWLDRRELKRRQRRDQALLVDVEKARLLDEGKDLYEAVR
FT                   QAERTARAMVALAEEYRRQAEQARAEAERAGATRSAATLAGPSDFKTALDRLAAQSKTS
FT                   FGMGRFDPDADRPSRLDQLARLLVGPSTRFLVGTLILIGFFLWMSQNNLLPDAAAVSER
FT                   VEAIVQTDDPVQTVTTETAREAAQLARDEAERVAALVRKRLEDGTVQPLKLPGVPEALT
FT                   RWFNGLGTGVAGLILIVSSFFSGVRIALFVVPAALVALAGPRLGLKPEAISIGLALGLA
FT                   VAGVVLGRSRR"
FT   sig_peptide     complement(233181..233240)
FT                   /locus_tag="Isop_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            233460..233951
FT                   /locus_tag="Isop_0154"
FT   CDS_pept        233460..233951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0154"
FT                   /product="protein of unknown function DUF55"
FT                   /note="COGs: COG2947 conserved hypothetical protein;
FT                   InterPro IPR002740; KEGG: tel:tlr0743 hypothetical protein;
FT                   PFAM: protein of unknown function DUF55; SPTR: Tlr0743
FT                   protein; PFAM: Protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60751"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E8R656"
FT                   /protein_id="ADV60751.1"
FT                   /translation="MAYWLFKSEPSVFSFADLMAAPDRRTGWDGVRNHQARNFLRDQIQ
FT                   VGDGILFYHSNADPPAIVGVARVTRAGHPDPTAFNPDDPHFDPKSDPARPTWYQVEIEG
FT                   IVAIAPPLELPRLRKETRLEGMELLRKGSRLSVQPVSPEHFEVIMNLAGLDRHRLGLTG
FT                   "
FT   gene            complement(234089..234559)
FT                   /locus_tag="Isop_0155"
FT   CDS_pept        complement(234089..234559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_2797 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60752"
FT                   /db_xref="UniProtKB/TrEMBL:E8R657"
FT                   /protein_id="ADV60752.1"
FT                   /translation="MTQVPDPTPSLPPTSKPRDKDKAKLKEKEDKDKEKESPTTGGSLT
FT                   GSGSDRSASEREWTNRKASEQAIRAANARRNSGRRRFIDPTTCERDYSSDELEFMQAMQ
FT                   EYKKKSGRMFPTWSEVLEVLRSLGYEKSGDLNDFDLMKSSPGGSTPGSQPRA"
FT   gene            complement(235572..236213)
FT                   /locus_tag="Isop_0156"
FT   CDS_pept        complement(235572..236213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0156"
FT                   /product="GtrA family protein"
FT                   /note="InterPro IPR007267; KEGG: sat:SYN_02391 cell wall
FT                   biogenesis glycosyltransferase; PFAM: GtrA family protein;
FT                   SPTR: Glycosyltransferase involved in cell wall biogenesis;
FT                   PFAM: GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60753"
FT                   /db_xref="GOA:E8R658"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E8R658"
FT                   /protein_id="ADV60753.1"
FT                   /translation="MPLPHPHNTAAHSSDSSADQIVSFPHPRTDTVASSSKRSANGTVG
FT                   WARTIKQRSDERFGNASRLAQFCAVGFSGMIIDLTCYAVFRAALETTWLGNRPSNLLGL
FT                   GLPTSVVVARASAILVALIWNFTLNRRVTFNDAPKTGLIRQFAAYALGNALAIAVSFGC
FT                   SVALPARIPFFQDRLQLAAVVGIVVSTSISFSTSRWLVFRKTPSLPSHSP"
FT   sig_peptide     complement(236160..236213)
FT                   /locus_tag="Isop_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(236357..237562)
FT                   /locus_tag="Isop_0157"
FT   CDS_pept        complement(236357..237562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0157"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR004506;
FT                   KEGG: plm:Plim_4028 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   SPTR: tRNA-specific 2-thiouridylase mnmA; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA methyl transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60754"
FT                   /db_xref="GOA:E8R659"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E8R659"
FT                   /protein_id="ADV60754.1"
FT                   /translation="MNRPRVVLAMSGGVDSSVAAGLLKNQGYDVVGLFMRTGVHFDDPT
FT                   RRAKTCCSQFDALDAQAVADRLDIPFHALDFEADFGRIMEDFTEEYLRGRTPNPCVMCN
FT                   IWLKFGKLWAYGKKVGADFVATGHYARVVQDESGRPRIARGVDRAKDQSYVLSGVRREI
FT                   LQRMLLPVGGFTKEEIRAKARDWNLPVHSKADSQEICFIPDHDYVKFIRERRPNLETAG
FT                   EVVDESGRVVGTHDGYEGFTVGQRKGLKIAFGEPRYVIQIDPRRRQVVVGDRTALVKPG
FT                   LIADRFNWHLDPPEPGQVWEVVAQIRSQHAGVPALLERLEPSARSEGGERVVVRFAEPQ
FT                   SAITPGQVVTLYDCYERVVGGGWIERPLEADASTAPAKVISTTLQDALDAEQTVASVRN
FT                   GR"
FT   sig_peptide     complement(237506..237562)
FT                   /locus_tag="Isop_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            237916..238899
FT                   /locus_tag="Isop_0158"
FT   CDS_pept        237916..238899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_1356 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60755"
FT                   /db_xref="GOA:E8R660"
FT                   /db_xref="UniProtKB/TrEMBL:E8R660"
FT                   /protein_id="ADV60755.1"
FT                   /translation="MDRPTSPVPVQVAQPFVSERPTLEQLRARVHKPRHRQRGNRLAIH
FT                   WGRPAAVYGTWLAIRWGLSAHAVTLGAVLTTLLAALALARGGLWGWIGGALLLHVAFWL
FT                   DHVDGQVARWRGTSGLDGVYFDYLYHHLWSLVVGFSLGWGVARVWEQPLGIVAGFLVAL
FT                   GWVLLGLHNDCRYKAFFERLKRVGAEPEERIALADPLPTGWTFQARLDHPDRPETIAAS
FT                   DPIDQPPLQPAPIRSLMTQAALVACEPHQVVIALTLLALVGAMVGTEAGAVLMAAYLGS
FT                   MALLAPTLAVARITRAIVGGRIEQGFAAWFMAVPSPTHRRNEAEAH"
FT   gene            complement(238847..239902)
FT                   /locus_tag="Isop_0159"
FT   CDS_pept        complement(238847..239902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0159"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR006140: IPR006139; KEGG:
FT                   aco:Amico_1309 D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding protein; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; PRIAM:
FT                   Phosphoglycerate dehydrogenase; SPTR: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60756"
FT                   /db_xref="GOA:E8R661"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R661"
FT                   /protein_id="ADV60756.1"
FT                   /translation="MSLTSPRPRFWVLVADFLDEAAIETEILGDLADLTLAQAFDETAL
FT                   SPYLEPQGAGSDAQGPDAVLLFHDLKRLSAASFKRMPRCKVVVRAGVGFDNVDLDAANQ
FT                   AGIPVCNVPDYGTEEVADHALMLLLAVARRLIDCDRPLRQGRWNASFVHGAPRLRGKTL
FT                   GLVGCGRIGTAMVLRAKPLGLRVMVHDPKAVRGLDKALGVERVETLAELAAQADFLSLH
FT                   CPLDSSTYHLINHAIFSVMKPGAILINTARGPVVDETALLEALERGPLAGAGLDVLESE
FT                   PPAAERLTALLNHPRVIVTPHVAFYSVEGYCELRHKAAHEVRRALLGQPLWNVVNAPQP
FT                   RSGGELGWERP"
FT   gene            complement(239985..240803)
FT                   /locus_tag="Isop_0160"
FT   CDS_pept        complement(239985..240803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4215 GntR family regulatory protein;
FT                   SPTR: Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60757"
FT                   /db_xref="GOA:E8R662"
FT                   /db_xref="UniProtKB/TrEMBL:E8R662"
FT                   /protein_id="ADV60757.1"
FT                   /translation="MLPFFRETTRVTSNDSTIFDEETRRSNEVRLAFGRAVMYSTVVLT
FT                   LLYELLVIVVLQRQFGFSLLKSLVGSLLFLPQGLFGSFLISLALCGLLAVMVRMVLRPV
FT                   VTLWYHPSRPQNEGMLEFRLGAGETIRQELPIRWRWLDHTGRRGWSIGTLALTNRRLWI
FT                   LPQRWDQEPHAIDLSEVVALEIGQPPRFLGGLVEGLPPTVTLVLKQGEGPTLATLAPQT
FT                   IVSWFPDRPLRRGFFVDDKRVLETIDELAANRSRERPRPHAPADQNLRIL"
FT   gene            complement(241166..241462)
FT                   /locus_tag="Isop_0161"
FT   CDS_pept        complement(241166..241462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_1010 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60758"
FT                   /db_xref="InterPro:IPR040807"
FT                   /db_xref="UniProtKB/TrEMBL:E8R663"
FT                   /protein_id="ADV60758.1"
FT                   /translation="MTRLREGRDFYYDSDGRMVLTAEFLAARGHCCGSGCRHCPYPPRT
FT                   DTPSANSNDTRDETIDPNWVAMSATHPHRNAFAEQERSHGLTSSSSPLLDKVA"
FT   gene            241710..242504
FT                   /locus_tag="Isop_0162"
FT   CDS_pept        241710..242504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0162"
FT                   /product="peptidase C26"
FT                   /note="COGs: COG2071 glutamine amidotransferase; InterPro
FT                   IPR017926: IPR011697; KEGG: gau:GAU_1361 glutamine
FT                   amidotransferase class-I family protein; PFAM: peptidase
FT                   C26; SPTR: Glutamine amidotransferase class-I family
FT                   protein; PFAM: Peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60759"
FT                   /db_xref="GOA:E8R664"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8R664"
FT                   /protein_id="ADV60759.1"
FT                   /translation="MERRPRIGLVTSNQDPMGHGCPPTWGVGHNYSRAITQAGGLPWLI
FT                   PACPSDPAALRAIFEDLDGLCLAGGHDIHPESYGQERSPLCRRHDRDRDRVELTLTRWA
FT                   VAEGVPVLGICRGMQLLNVALGGTLYQDVAQEYSPWLDHDCFPGPDNAHQRSSLIHHVE
FT                   MVRGSRIHDALERPVAPVPVNSMHHQGIRGLAPGLTATAHAPDGLIEAVEHTDHAFVVG
FT                   VQWHPEELVMEHASMRALYRSFIAQARYRALARYGNAALRAS"
FT   gene            complement(242645..243835)
FT                   /locus_tag="Isop_0163"
FT   CDS_pept        complement(242645..243835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0163"
FT                   /product="protein of unknown function DUF1573"
FT                   /note="InterPro IPR011467; KEGG: rba:RB1699 signal peptide;
FT                   PFAM: protein of unknown function DUF1573; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1573)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60760"
FT                   /db_xref="GOA:E8R665"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E8R665"
FT                   /protein_id="ADV60760.1"
FT                   /translation="MGWTIVTTASGSTWARRPPSTSTLSGGGGRTWSKPCRWLLTAVLA
FT                   ATVGGWLVPLTFCAQAQTMLGGGLFGRSSARDLVEQPHHDFGVVPRGARMTHAFNVANP
FT                   LSVPLTIERLEASCGCTLARPEQTTIPPGESSRIIASFDTAKFVGPKQVRLTVTLSDPQ
FT                   GRLKELSLKLSAVIRPDLTLSPGQLDFGRVDPERVIERTLTLARVQGPDDFAPTRMISA
FT                   CRFLDAELAELQRRPGLTRYLLTARLKPGGPAGPFREEIRILTNDPDAPSITIPVVGEV
FT                   PEVLVASPRHLALGRLEPGRVVETRVLIRGPAPFRVTGIDGLGDGVECVDPPWEGSAAA
FT                   RPVQVLTLRFTPPVPPSDRHPFPSPPGDWHRVLVVRTDLPAAPSLDLPISATLAHP"
FT   sig_peptide     complement(243791..243835)
FT                   /locus_tag="Isop_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            244225..244755
FT                   /locus_tag="Isop_0164"
FT   CDS_pept        244225..244755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0164"
FT                   /product="ATP dependent peptidase CodWX, CodW component"
FT                   /note="COGs: COG5405 ATP-dependent protease HslVU (ClpYQ)
FT                   peptidase subunit; InterPro IPR001353; KEGG: dhd:Dhaf_3713
FT                   ATP-dependent protease peptidase subunit; PFAM: 20S
FT                   proteasome A and B subunits; SPTR: ATP-dependent protease
FT                   peptidase subunit; manually curated; PFAM: Proteasome
FT                   subunit; TIGRFAM: ATP-dependent protease HslVU, peptidase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60761"
FT                   /db_xref="GOA:E8R666"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E8R666"
FT                   /protein_id="ADV60761.1"
FT                   /translation="MWRRTTILTARRGNRVALGGDGQVTLGATIMKADASKIRRLLDGK
FT                   VLVGFAGGAADGLALVEKFEAKLKDHPDNLPRAAVELAKLWRTDRLLRRLEAMLIAADA
FT                   RHSLLISGSGDVIQPNDGLVAAGSGGMFALAAARALVKHTDLDPAALVREALTIAAGID
FT                   IYTNDQLIVEELA"
FT   gene            244752..246377
FT                   /locus_tag="Isop_0165"
FT   CDS_pept        244752..246377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0165"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="COGs: COG1220 ATP-dependent protease HslVU (ClpYQ)
FT                   ATPase subunit; InterPro IPR004491: IPR013093: IPR003593;
FT                   KEGG: adg:Adeg_0577 ATP-dependent protease ATP-binding
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase; SPTR: ATP-dependent protease ATPase subunit HslU;
FT                   TIGRFAM: heat shock protein HslVU, ATPase subunit HslU;
FT                   PFAM: AAA domain (Cdc48 subfamily); C-terminal, D2-small
FT                   domain, of ClpB protein; TIGRFAM: ATP-dependent protease
FT                   HslVU, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60762"
FT                   /db_xref="GOA:E8R667"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R667"
FT                   /protein_id="ADV60762.1"
FT                   /translation="MTPTEPPRQDAFDTTDLGDPDSTSPASSSASGPRPIRGREDEEEP
FT                   IGADLTPRRIVEELDRDIVGQDRAKRAVALALRDRWRRRRLPEETRRWITPKNILMIGP
FT                   TGVGKTEIARRLAQLVGAPFVKVEATKYTEVGYIGRDVESMVRDLVEAAISLVKERERK
FT                   RVASQAQARAEERLIDLLLPGSASSSATGWGGGSPRRPPAAPPFVSPFGFPFGTSAPAA
FT                   SDSDAATDSEDAAARERRQRSRDKLRAQLREGKADHLEVELVLPGRAAPPVSIIGAAGA
FT                   EQMEMELQSMFERMMPRPARPQRMTVAEARPILIEREVEALLDPETIQRSAIRLAEESG
FT                   IIFIDEIDKVAGEEGAGGGGRGPDVSRGGVQRDLLPIVEGTTVTTKYGPVKTDYVLFIA
FT                   AGAFHKARPSDLMPELQGRFPIRVELDDLTRDDFARILREPRVSLLNQYQALLAVEGVQ
FT                   LQFTPDAIDAMAEIAYQVNRSTQNIGARRLHTILERVVEEISFNAPDQVAQTEDPLVVT
FT                   IDAAEVRRKLDPLVRDDDLSRFIL"
FT   gene            246624..247184
FT                   /locus_tag="Isop_0166"
FT   CDS_pept        246624..247184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppa:PAS_chr2-1_0824 hypothetical protein;
FT                   SPTR: GATA zinc finger domain-containing protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60763"
FT                   /db_xref="UniProtKB/TrEMBL:E8R668"
FT                   /protein_id="ADV60763.1"
FT                   /translation="MADLPRTDESLLNIYEVELDGQIRHLIGFLAPEVAHRLGIASRKI
FT                   VGEFRPTPDGEFDPATFEVNPEFIAAYTEFMNEDVVRNPELMMLAMNQPDRYLTLIDPR
FT                   HPYDAPDLEVPIVNKVGRFRSTPDGFIQENSFQYNQKHRWFDPEYGVSGVFLNREFYDW
FT                   LNQDALLESESDGFSVSHESSKS"
FT   gene            247445..247678
FT                   /locus_tag="Isop_0167"
FT   CDS_pept        247445..247678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dpe:Dper_GL15605 GL15605 gene product from
FT                   transcript GL15605-RA; SPTR: GL15605"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60764"
FT                   /db_xref="UniProtKB/TrEMBL:E8R669"
FT                   /protein_id="ADV60764.1"
FT                   /translation="MSPDLTKVTVQKPPGSPASVAQHRDFPQIRGEGADPREAVVVLES
FT                   QLVRTLDTALTTYRRAEIEQALADVRAFMAKN"
FT   gene            247844..249919
FT                   /locus_tag="Isop_0168"
FT   CDS_pept        247844..249919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0168"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="COGs: COG0072 Phenylalanyl-tRNA synthetase beta
FT                   subunit; InterPro IPR005121: IPR004532: IPR005146:
FT                   IPR005147; KEGG: rba:RB7112 phenylalanyl-tRNA synthetase
FT                   beta chain; PFAM: B3/4 domain protein; tRNA synthetase B5;
FT                   ferredoxin-fold anticodon-binding; SPTR: Phenylalanyl-tRNA
FT                   synthetase beta chain; TIGRFAM: phenylalanyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase B5 domain;
FT                   B3/4 domain; Ferredoxin-fold anticodon binding domain;
FT                   TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit,
FT                   non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60765"
FT                   /db_xref="GOA:E8R670"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E8R670"
FT                   /protein_id="ADV60765.1"
FT                   /translation="MIVSWNWLSQYLRLDMSVEDLTNRLSLTGLNHEATEEIDGDLAID
FT                   LEVTSNRSDCLGHLGIAREIAAVFGKPPVVMPDPNPPVGGPDVASLAAVENHEPDLCPR
FT                   FTARLLTGVRVGPSPWWLVRRLKTLGQDSVNNVVDLTNYVLYERGQPLHAYDFDRLEGR
FT                   RLIVRRASAGEKLHALDKTEYSLTPDMLVIADAQRPVALAGVMGGLATGIQHDTVNVLL
FT                   ESAAFHPLTVRKTARALGLSSASSFRFERPIDPEAVDWASRRCAELILEVAGGQLHPGV
FT                   LDTRPQPIPPRPPVTLRLAQIERVLGITLDRDRVIGILEALGIPLCSQPEAEPLVFQPP
FT                   SWRLDVDREIDLIEEVARIHGYEQIPEDRVVPMACSRRSPRERVESTVRETLTALGFDE
FT                   AYTFSLVSERLIAPLQPDSIAVQPPLRTEHSSRSRENLLRPSLVPSLLQARRHNEAHGV
FT                   TDADLFEIAHVFLPRAGHEVPLELPRLAWVTGRSFLEAKGCVEALLRRLHIDAPLTATP
FT                   VRRDLFAEGRAAVLTLEGDHLGFLGELSEAWRDRLDLRKVCRAVELELECLIRRSQTTA
FT                   VYRPIPTTPSIERELSIMVPRDLEWARVQEAVREAGGPLLTAITFLDTFESEQLERYRG
FT                   GLEGPIHSLHFGMTFQDPERTLTGAEVDEVVARIFRTCHERFRAEVAGPRPSWTST"
FT   gene            complement(249999..251255)
FT                   /locus_tag="Isop_0169"
FT   CDS_pept        complement(249999..251255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0169"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: sti:Sthe_0904 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60766"
FT                   /db_xref="GOA:E8R671"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8R671"
FT                   /protein_id="ADV60766.1"
FT                   /translation="MRLVIDGRRLTPERTGVGRYLETLLEEWAVVGPPWEPVMVALADP
FT                   TAPARLPRIDGLEYRVVGANWPGLIWERFGLGRLLQRGDFLFAPANFVPTHWRGPTVSV
FT                   IHDVIQFVQPSSFSWRVRAWYGWRYRLTASRSHRILTPSHATARDVMSRLKVPPQRVVV
FT                   AHPGIGPEFLPVRRDSVRSRETRRAAGLRDEDRYFLFLGKRTRRRRIDLLIEAYQAARL
FT                   QRPHLAERLVLGGKPSFAGDALPATLPEGVLDLGYLPESQLRVWLSGATALIYPSDYEG
FT                   FGLPVIEAMACGCPVVTCRNSALTEAGGDAAIYLDRLDVESLAQTLLRLAEDTDQRQFH
FT                   IDRGLRHVAAFSRSRFARIVADELVEVRDAFASRLDRRARRAGSFLWRTFPEVPRHVEP
FT                   TRDFPDWRTEHVPDHRHVS"
FT   gene            251382..251882
FT                   /locus_tag="Isop_0170"
FT   CDS_pept        251382..251882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0170"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="InterPro IPR004360; KEGG: bpy:Bphyt_1430
FT                   glyoxalase/bleomycin resistance protein/dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; SPTR:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; PFAM:
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60767"
FT                   /db_xref="GOA:E8R672"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E8R672"
FT                   /protein_id="ADV60767.1"
FT                   /translation="MNPTPTTQTPGLNPSVNPTMRLYMIEATVRDHAAAVSWLRDVVGF
FT                   ALLWHDVPRRFALFEIAPGGVHLAVKTRSSNHLAADTTWDPSEQPLAFPQRITFETDDL
FT                   EATVAALSARNARLGPITDHPDEGYRKVKLLPPPGVELEVAIFGWTSDKVRGSITAHAA
FT                   EAR"
FT   gene            252212..253990
FT                   /locus_tag="Isop_0171"
FT   CDS_pept        252212..253990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB5189 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60768"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E8R673"
FT                   /protein_id="ADV60768.1"
FT                   /translation="MSVLCAANRTTLLGTTLLIVASGLVLALPGANQSAFHPLRDDEEP
FT                   PRVGGDLTLVGSLRLPPRLTTETPAGQNAGESTPTPALTLPPPLLLNLPVAGNESRRGT
FT                   EPSGPLIVTPDHVFQPTSDQRRSAPASLVGELPPWLEGTRFGFSNSVASDHHQPRAVTP
FT                   SETIRESPRRIEESTRDDQKETSDLESKWRLSHDPDRGLRLELREPNGPPSSYDLTIGF
FT                   QNQIRYFGFVPGARQWTDSTGAKRSITPQSQFQYVRGRLTFEGHAITPRLGFLTTIDFN
FT                   TVQANPQVTFQVGWLSYDLSERWRLHIGKGRVPGVREWQEPHRFVLGVDRTMATTFFRP
FT                   GFSPGIWLRGDLGQDWPLILFLGNGYDAGTLSVNDLDLNPVVSANLAWEPLGAFGNGYS
FT                   DLETEQGLRIRLGHTLTASRQGRSLQQSLGNFGPEETRVRLTDGTPLTAPSALGPGITV
FT                   QRYNLMLATVDAAIKSGRGWSLSGEYFFRTIDGIETNAPAVTTSLFQHGFFAQGGWFLV
FT                   PERLELFGRTSWVFGGQGTAREYVMGVNLRPTGSFNWCVTGDVVLIEDSAAEQVRTNYR
FT                   AGDTGTLVRIQMVTAF"
FT   sig_peptide     252212..252304
FT                   /locus_tag="Isop_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            254133..255473
FT                   /locus_tag="Isop_0172"
FT   CDS_pept        254133..255473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0172"
FT                   /product="sulfatase"
FT                   /note="COGs: COG3119 Arylsulfatase A; InterPro IPR000917;
FT                   KEGG: psl:Psta_3646 sulfatase; PFAM: sulfatase; SPTR:
FT                   Sulfatase; PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60769"
FT                   /db_xref="GOA:E8R674"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8R674"
FT                   /protein_id="ADV60769.1"
FT                   /translation="MCGRRPIPLGIVGWVALGSSAAAAEWPQAEPGPPNVLMIVSDDQG
FT                   WRDHGFMGSRQVRTPHLDRLAREGAVFVNGSVPTSLCRASLATLLTGRYAHQHKICCND
FT                   PPKGIDRDRMLPYLSHAPTIPRLLAQRGYACLQTGKFWEGHYSNGGFTHGMTTEGRHGG
FT                   PGLAIGRETLEPIDEFLDRDRQGKPFFIWYAPMMPHLPHNPPQRLLERNQAIGNDPRLA
FT                   KYHAMCEWFDETVGQVLSRLETRGLLENLLVVYVVDNGWVQAEGPPRPNDQFLTRSKNS
FT                   PYDAGLRTPIIFWRPGVIPPGRYEDLVSTIDLAPTILAACGVDWPHELDRPPGLDLNPR
FT                   AQGGPPLEREAVFGELFTHDCVELGKPRLSLTHRWIRRGNDKLIVPTGEAAPELYDLAT
FT                   DPDEQTNLAAQRPEVVAELRRLIDAWWDPQAIEADVPATPRDSGSSP"
FT   sig_peptide     254133..254201
FT                   /locus_tag="Isop_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            255581..256465
FT                   /locus_tag="Isop_0173"
FT   CDS_pept        255581..256465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0173"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR004838:
FT                   IPR013216; KEGG: bcv:Bcav_2198 methyltransferase type 11;
FT                   PFAM: Methyltransferase type 11; SPTR: Methyltransferase
FT                   type 11; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60770"
FT                   /db_xref="GOA:E8R675"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E8R675"
FT                   /protein_id="ADV60770.1"
FT                   /translation="MSSTATTMTDPAESARLGLALPPVSARSCLPLPSPSRLGWESSLP
FT                   ARVWRAWRRGGLPYLRHKAMRRLLERWPGLKRRWLYADPRDYWTLRGGHDYFLEQEGQP
FT                   ARARRAEWMAERVAQLRPRSILEVGCGYGKQLVALRRRLGEEVRLVGVDFSPSQLDTAR
FT                   RHLDDHGVRRVDLVQADGVCLPFADASFDLVFTSAVILHNPPQQAEAIRREVVRVARRF
FT                   AVHNEDVNITYNRYGYDTAAWYRARGIVLIECTPIPLDQAEEAAVSQFCVACLDRDEQT
FT                   RIDADAHPCLLDH"
FT   gene            256481..258043
FT                   /locus_tag="Isop_0174"
FT   CDS_pept        256481..258043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: clj:CLJU_c05530 putative polysaccharide
FT                   biosynthesis protein; SPTR: Membrane protein involved in
FT                   the export of O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60771"
FT                   /db_xref="GOA:E8R676"
FT                   /db_xref="UniProtKB/TrEMBL:E8R676"
FT                   /protein_id="ADV60771.1"
FT                   /translation="MATVPDPPAAEPRSEDHQALRHSLIVVVGGQLERVLGTLTALALR
FT                   WGLTPELLGVYTGLRLYLDNANRSSLGVSLAAGQEVPLHLAAGRIERAERIQNVAHTVN
FT                   SISVWIYALGLLGLVCWNAAWRNPALPTDPLATEWTYGLIAVALIAPLKRYQDYLIVMQ
FT                   RARKGFQVTTEVQVLDSLVFALLAVIGLAVAGLWGLLGAVGALMVFNIGYLQWRRPLRL
FT                   AFEWDRREAVRLMVVGFPIWLNTLLFMLVTSTDRLVILWLADQPERSVGLYTVALMGTG
FT                   WALDLAGRIVLVMGTYFQSTLGRTNDPAAVARQAIRATEAQATPLFAGSAIAYVAGPTF
FT                   LSWLMPGYEAGVEAIHPLLPGMILLGLALGARQLLISLERVWSLAGVTTLGWLTVTALS
FT                   VAWVGESGIVGVAWGVSLGALVTFLLTTALAYRPILGASAWSLHLGRLIKRSLWWVVGG
FT                   ALAAHPPLPLPQTWATIGWQGLVEFVIRTGFLILWAMPALYLWGRDHDWGGLSPRPRRR
FT                   AKR"
FT   gene            258040..260049
FT                   /locus_tag="Isop_0175"
FT   CDS_pept        258040..260049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0175"
FT                   /product="glycosyl transferase family 39"
FT                   /note="InterPro IPR003342; KEGG: psl:Psta_0545 hypothetical
FT                   protein; PFAM: glycosyl transferase family 39; SPTR:
FT                   Dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   protein; PFAM: Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60772"
FT                   /db_xref="GOA:E8R677"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:E8R677"
FT                   /protein_id="ADV60772.1"
FT                   /translation="MTINAWPPFESATNRASDPWAWIGHPNAGAILADLGFVLLTALWS
FT                   IRVGTWLVAACRVGTPDRPALDRVERIALGIPLALGLLALTTLVLGLIGGLNRGQLTVG
FT                   IGLLTLGAAALGRRANRCSKVGDAEVFPAEFRRRPPRLAVGPLALAGLGTLLNALAPPT
FT                   DGDALCYHLQVPKQFLIDGRVGYNPDQFETIYPMLTEMLYAVGLEFGGPVACRLIHWWL
FT                   GVAGVVATFALGRRCGGPAVGWWAAAIAGLTPAATAGMVAPLNDVALASFSVAAVLAWV
FT                   IVMTSDGAKTCPSSRDAVLAGVMLGLALGVKYPALILAGLLTVATLIRTPRHVGTYLLA
FT                   ALLVGGVWFGRAFLATGNPVYPFLHEIFGAGLAEASEARWRPLEPSPLNLMGALIPLSL
FT                   DPLRFESRPHQLGPLWLMTLPLLVLVRPRPHRWVVGLVALGWLFIALSMSQRQSPRFLL
FT                   PALGPLAVGAGWVVAALAARCDPRARLAVGLIAGVLLLQAAWAMARARSGWAYLAGEES
FT                   ALAYLEKREPTVVVGRWMAAHLPKEAVVVGQDHRGFYLPRRYVMELAHRRRTRWGRDPN
FT                   QPPGSPGQIVATLRARGFTHLLTAQPVPLDAVEFDPTLTSWLAPLLEASPPRWQAVLTD
FT                   GDGVTRRYRVDDLADLADRATETQAAAFRFNQVE"
FT   gene            260103..261071
FT                   /locus_tag="Isop_0176"
FT   CDS_pept        260103..261071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0176"
FT                   /product="Ureidoglycolate lyase"
FT                   /EC_number="4.3.2.3"
FT                   /note="COGs: COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
FT                   (catechol pathway); InterPro IPR002529; KEGG: rme:Rmet_5199
FT                   fumarylacetoacetate hydrolase; PFAM: fumarylacetoacetate
FT                   (FAA) hydrolase; PRIAM: Ureidoglycolate lyase; SPTR:
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; PFAM:
FT                   Fumarylacetoacetate (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60773"
FT                   /db_xref="GOA:E8R678"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E8R678"
FT                   /protein_id="ADV60773.1"
FT                   /translation="MIRLCRFVDDDLELAGFYRDDLIVPLVRAVEAYSEATGQDVPPPA
FT                   SEEEDLLEYLPPDGEYAPLVAKVAAWLETHTAEALGDLAIPLEQVTLRTPIPAPGKILL
FT                   LAGNYSEHVAEQGGVAAERLETFPYVFMKPLTTLNDPFGPIVIPKVSPDRIDWECELGV
FT                   VIGRTCRHVEASEALEYVAGYTVVNDVSDRGFKPNPGRKPRERDRFFDWLHGKWHDTFL
FT                   PVGPCILAAGPRVDPQGFRLTLRVNDEVKQNDTTAKMVFPVAEIVSFLSRMMTLEPGDL
FT                   IATGTPSGVGNATGTFLKPGDVVRAAIEGIGVLENPVESEE"
FT   gene            261443..262972
FT                   /locus_tag="Isop_0177"
FT   CDS_pept        261443..262972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA4323 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60774"
FT                   /db_xref="GOA:E8R679"
FT                   /db_xref="UniProtKB/TrEMBL:E8R679"
FT                   /protein_id="ADV60774.1"
FT                   /translation="MALSPLDKKSAPPTTTPPTPTLPHRLFQPDRRREPEMWSSQGRDE
FT                   STTSVRHPVRPILDEEDLLPPEARARAERRMDRIAFYKIEALLILLTGLAYAYRLEGRA
FT                   FQIVLTMVAIGLPIYEALGERWRRPFVAWLTVVALGWVFGPVAAALVVGLTLGLIGICL
FT                   APIPWAVRAGIVAGVGVSLMALRNQPGLPVPAVFWPVAGSFLMFRMVIYLYELKHAKKP
FT                   ESFLDAVNYFLLPPNACFIHFPVVDYRTMQRTWLMGGLRETQREGLRMIFRGMIHLLGY
FT                   RIIYHELLIAPGDVEDPATLARFLVCNYLLYLRVSGQFHIACGIIHLFGWRLPETHHNY
FT                   LLANSFTDYWRRINIYWKDFMVRVFFNPTVFRLKRWPQPLALAAATVVVFLATWLLHAY
FT                   QSFWLRGSWGFSTTDGLFWGILGVLVLINVQIDARRTRAGRRFRPLKATEGRSASVWRR
FT                   AGALAKHSLQVAATFTTIAVLWSLWSSPGVGEWLEMMGRGLGLTIGSGRGG"
FT   gene            262976..264166
FT                   /locus_tag="Isop_0178"
FT   CDS_pept        262976..264166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA4323 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60775"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E8R680"
FT                   /protein_id="ADV60775.1"
FT                   /translation="MRPLTLVDRLSVAAALGLALLAVLPTEQWTSASLVLRFKGAVRND
FT                   GPNQIDLEQRERGYYEKVLEVHRGLDRIDGGWGDPIGTESENQPQPFRHGGLVQDVADV
FT                   RDYVLKPNLDTRYWDGVRWSTNARGMRDREYAIPKPPGVTRYALVGDSIGCGWGVDQSE
FT                   SFEAITEAQLDREARAFGRGGFELLNHSVPGHAPGQRWADFLANDGWRDELDGVIVQAT
FT                   PAEVGWDERRLRVLLARGPGFGFDAPMYAETLAQAGARPGDRVDGYRRRLEPWRWAILE
FT                   GVYRHIAQECRARGVRSWYILVPRVGKTTTPSQRRELLSLAARCGFDEVHDLTGVIPES
FT                   DPARYALSPRDYHPNALGHRLLAEALIARLRPAATSAGTASAFRWGFSNRRAELHQ"
FT   sig_peptide     262976..263071
FT                   /locus_tag="Isop_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            264163..265422
FT                   /locus_tag="Isop_0179"
FT   CDS_pept        264163..265422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA4323 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60776"
FT                   /db_xref="GOA:E8R681"
FT                   /db_xref="UniProtKB/TrEMBL:E8R681"
FT                   /protein_id="ADV60776.1"
FT                   /translation="MSRPKSPPWRMVDEAEEVGYALRVAAVALLLGVVGLSVALGEEVR
FT                   WLRAARNPDPNRADLESAAGGYYVALIDGGGDHDGDSRPGPGGGLNDALVGRPAGWLRF
FT                   PEAGVSRHMPQDFRQHVLIPNLKRELYSASFSTNSRGLRDREYALEKPPGVFRIVLMGA
FT                   SIDMGWGVPDALTYENRLEDWLNHVARRERLGRRFEVINFSVAAYSPAQRVDTLGDDAL
FT                   RYDPDLVLLVGTTLDPRLTEIHLRSLVRHGADLRSAAIREAITRLGISSDEEKGGPAAR
FT                   RDLERRSIKSEFKRQAALVIWEIIEGSLAEARTLCDKHGVPLVLVLIPRVGAADAPRTR
FT                   RQTEAAYLERAAKLGLTVINLLDTFDGRGRSSLEIAPWDDHPNALGHELLFIALAQTIE
FT                   RDPRLCSLVLGPAYRPRPPR"
FT   sig_peptide     264163..264285
FT                   /locus_tag="Isop_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            265484..267229
FT                   /locus_tag="Isop_0180"
FT   CDS_pept        265484..267229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0180"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR010071:
FT                   IPR020845: IPR000873; KEGG: eba:ebA4326 putative acyl-CoA
FT                   synthetase; PFAM: AMP-dependent synthetase and ligase;
FT                   SPTR: Putative acyl-CoA synthetase; TIGRFAM: amino acid
FT                   adenylation domain protein; PFAM: AMP-binding enzyme;
FT                   TIGRFAM: amino acid adenylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60777"
FT                   /db_xref="GOA:E8R682"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E8R682"
FT                   /protein_id="ADV60777.1"
FT                   /translation="MMSLPPPPFPLVPSPVFVSSSCREDRKPGFRSRFTHLAELLEFVA
FT                   RVYPERPAIETEEGRIWSYAQLNETVERLAATLEEWGVGRGDRVGVAIPKSPEAVAAIH
FT                   AVLRVGAAYVPVDPTSPAVRGATILRDAEVAAWLAAPEQAAGLLKEWPKAPRLIHLDAA
FT                   PGGSALADGSHTSFRPGDRAWNEVMESFHRQLTPPRDRDRHPDDDAYLLYTSGSTGTPK
FT                   GVRLTHRNAFCFLDWCFSTLNLPPGGRFSSHAPFHFDLSVFDLYASCASVGTLVIVGEA
FT                   LGKDPQRLGAFLKARPVDVWYSAPSILNLLARFGGAVEPGFPAPGLVLFAGEVFPIEPL
FT                   KTLRLAWSDSEMWNLYGPTETNVCTAYRVPDRLDPTRRDPLPIGPVCPPLRARIIDEAG
FT                   RDVAVGQLGELVIAGPGVMRGYWNRPDLDATVFLQDAEGTRWYRTGDLAIDPGDGVFVF
FT                   KGRRDRMVKRRGFRIELGEIEAAIHRHEDVEQAAAIARDDPDTQGVAIEAFVALKPERR
FT                   RSIIAMKRHLVGQLPHYMIPDTIRFLDRLPQTSTAKVDYAKLKWLAESGESSGSTVSAG
FT                   CDAVR"
FT   gene            267275..268594
FT                   /locus_tag="Isop_0181"
FT   CDS_pept        267275..268594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0181"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1560 Lauroyl/myristoyl acyltransferase;
FT                   KEGG: aeh:Mlg_2805 lipid A biosynthesis lauroyl (or
FT                   palmitoleoyl) acyltransferase; SPTR: Lipid A biosynthesis
FT                   acyltransferase; PFAM: Bacterial lipid A biosynthesis
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60778"
FT                   /db_xref="GOA:E8R683"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:E8R683"
FT                   /protein_id="ADV60778.1"
FT                   /translation="MRRKHERLRRFNPSTITVFDESSVLPASGFRVGGRVQPIGPAGKG
FT                   SGPTVTVRDAMTWKYWFYEVWLPRLARIPSDRAARGLDRLGRLLAVWPGRFAQTLDQVR
FT                   RVRLALNVEWDDRQVTQRLLEGLPRFHARDYLLDHCDLNQLDQLFDVEGWEPVARLMES
FT                   GTGVVLLGSHLGAHLCGVHWLLRRRDAIRLLVQRPCHVSSFLNEVFDRCGDLPQREFFL
FT                   KRGLPPALAIERVMTARSALRKGMSIYLNGDIPWYGPNTRVGRLLGQPHRLISLWADLA
FT                   AVARAPVVTMFCGYRPGGRHRLVFDPPRTILPGQESQAVRDYLIRLELEIARYPHEAVA
FT                   HLLWPCFGPPREASSSTASACNPASTPSSSTPPLSWPAQAGEAGTDQEPAPGGLPVVPR
FT                   PHSAVVTAAGAATLTDDLPCRPSASVRLEMTCKSAEPFNP"
FT   gene            complement(268668..269582)
FT                   /locus_tag="Isop_0182"
FT   CDS_pept        complement(268668..269582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB9030 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60779"
FT                   /db_xref="UniProtKB/TrEMBL:E8R684"
FT                   /protein_id="ADV60779.1"
FT                   /translation="MSQRVPPSDSGAAGGGSSGPGGGGLIPGRPMAHVPMGPMMPGHMP
FT                   VGVAIAVDSQEGAVTARQAGGLIDLRLQVSPLRVPLPVALQNVAKAVNIAFQTNFAENM
FT                   LETVYQAAIVRKREVLVVHKDYFGYGTGWFSMFGRLLKSMELTLQGPDPVSPEFQRLVE
FT                   QKKPRTISGLLNLLFRKLDIVPEYEDRVPFYFQQMFDRLEASGIIVGWNREEWSIRTTK
FT                   IGLDIRVEPAEWVWAELEARELEAKAAQAERITKAKRRLEDARQAQTQAESSRESPPRP
FT                   SSQIEPTPEAATDEVGTGQQPSG"
FT   gene            270100..272289
FT                   /locus_tag="Isop_0183"
FT   CDS_pept        270100..272289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0183"
FT                   /product="WD40-like beta Propeller containing protein"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; InterPro IPR011659;
FT                   KEGG: mxa:MXAN_6601 S9C family peptidase; PFAM: WD40-like
FT                   beta Propeller containing protein; SPTR: Prolyl
FT                   oligopeptidase family protein; PFAM: Prolyl oligopeptidase
FT                   family; WD40-like Beta Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60780"
FT                   /db_xref="GOA:E8R685"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8R685"
FT                   /protein_id="ADV60780.1"
FT                   /translation="MPPQDKRLPRRGRAVQAVGVKRFGSLAILAALVVGPLVTRPVHSA
FT                   LPAFSPTPAQPPAAKAPRAMTINDLLAVQVVSDPQVSPQGDRIVYTVKVIDRETGRSNT
FT                   DLWLVDRQGKTPRQLTSHPGSDRHPRWSPDGRSVAFLSDRSGSTQVWLLPMDQSGEARQ
FT                   LTRLPLDVEGPIWSPQGDRLAAMVSVLPGKSFEETAETLRQRREAKSQAKIYDDLMVRH
FT                   WDTWDDGTRQHVILIDVADGSARDLIPDWTAHAPPFFSGSSTDYAFSPDGEELAFISEP
FT                   LTEHPWTTNKDVWIVSTRPGENGRSATPRNLTAGSLGAEAAPSYSPDGRFLAFLRQERA
FT                   GFEADQWVLTLFDRQTSGVRPLTLKLDRPIEEYAWTADSQAIVATIDDRGSVALVRLDH
FT                   PAQREYGPDLPRLTPTGTHRGIRPLPDGGVVMVRHHSAAPGELFVLPAGSDAQLQPLTH
FT                   HNADLIASLDLNRAELFTFKGAEGTDVTGWLVKPPGFDPSRSYPVLCCIHGGPQGAWHD
FT                   EWHERWNYALFAAPGYAVVAINPRGSTGFGQTFTDQISRDWTGRVYEDLMLGLDHALAT
FT                   YPFLDGDRVAALGGSYGGFMVNWIAGHTDRFKALVSHAGVFDLTSMYFTTEELWFPEWE
FT                   FGGPPWNAADPKLYRAMSPSTYVESMRTPTLVIHGALDFRVPDSQGLAMFTALRRQGVP
FT                   ARYVWFPDENHWILKPANRIVWWREVHNWLDRYLR"
FT   sig_peptide     270100..270231
FT                   /locus_tag="Isop_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            272455..273021
FT                   /locus_tag="Isop_0184"
FT   CDS_pept        272455..273021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_2531 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: DinB family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60781"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E8R686"
FT                   /protein_id="ADV60781.1"
FT                   /translation="MNSNSAPLAPRPRSASSQADKPPSLRLVERYEAGAPLVGYAIAHL
FT                   TSEQLTTRLSPGTWSIAEVVVHLLDSELTFSDRFKRILAETDPVLQAFDESRWLVEIPP
FT                   HELLPLEEAAQMIELNRRWTARILKRLQPADFGRSGRHSVNGRVTLASILAYAVGHLDH
FT                   HLRFLYGKRGNLGSSIEPRYTPDVV"
FT   gene            273146..275254
FT                   /locus_tag="Isop_0185"
FT   CDS_pept        273146..275254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0185"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="COGs: COG1686 D-alanyl-D-alanine carboxypeptidase;
FT                   InterPro IPR018044: IPR001466: IPR002477: IPR001967; KEGG:
FT                   psl:Psta_1647 peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Peptidoglycan-binding domain 1 protein;
FT                   beta-lactamase; SPTR: Peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; PFAM: Putative peptidoglycan binding
FT                   domain; D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60782"
FT                   /db_xref="GOA:E8R687"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E8R687"
FT                   /protein_id="ADV60782.1"
FT                   /translation="MRGLWMSAWVIVWAWVDGVAFEAAAQVHAQRPEASGSPGLERRLR
FT                   PLIAAHKGDVGVMVKHLGTGETFAHRADAPMPTASLIKFPLLIEAYRRVATGALDLKTP
FT                   VTLHDEDKVPGAGILTYHFSQGTTIPLRDVLRLMIVYSDNTATNLALDAVGLDAVNAEM
FT                   ARLGLKRTKFHSKVYRRDTSIDPEGSREFGLGVTTAAEMITLWERLHLKKLAEGNEALC
FT                   DAMLDHLLHCDDKSMLVKELPPGTKVAQKTGAVSDVRTAAGILYTPSGPIAVCVLTARN
FT                   QDQRWTPDNAAERFSARLAREVYDHFQQAADLKEAGRDDSPLAFGATGPRVERLQRLLN
FT                   RRLEPSPGLVVDGDFGPATQEAVIRFQKERHLGDNGVVTPEVWRALGELPPDPAGDPQA
FT                   EADPAQLNAEFATLRPEPAEPAANDPTAVPFVTARAWVAIDADTGRVLGGREPERPLDM
FT                   ASTTKIMTAHLVLKELAAHPEARDEVVTFSARAAATPGSSSEVREGERVRVGELLYGLM
FT                   LPSGNDAAVALAEQFGQRLAARDGSDGLDPLEAFVAAMNREAQALGLSATRFVNPHGLT
FT                   APNHQASALDLARLTRVALENPEFAALVATRRRAARLIDGEGKGRTIVWSNTNELLKIE
FT                   GFAGVKTGTTSSAGACLVALGQQGERRVIVVVLGSAASASRYADARNLFRWAFHQPVAA
FT                   PIETGDGR"
FT   sig_peptide     273146..273232
FT                   /locus_tag="Isop_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            275424..277058
FT                   /locus_tag="Isop_0186"
FT   CDS_pept        275424..277058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0186"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; InterPro IPR006236: IPR006140:
FT                   IPR006139: IPR002912; KEGG: plm:Plim_2827
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; amino
FT                   acid-binding ACT domain protein; PRIAM: Phosphoglycerate
FT                   dehydrogenase; SPTR: D-3-phosphoglycerate dehydrogenase;
FT                   TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain;
FT                   ACT domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; TIGRFAM: D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60783"
FT                   /db_xref="GOA:E8R688"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R688"
FT                   /protein_id="ADV60783.1"
FT                   /translation="MAATYRVLVTDKLASEGLEVLKADPRFEVVVDSKLAGDPQALRTA
FT                   LGEADGVVIRSGTMLTPEVLRGQTRLKAIVRAGVGVDNIDVTTATRQGIVVMNTPGGNT
FT                   LSTAEHTLALLLALSRNIAPACASLKAGRWDRSKYTGSQLAGKTLGIIGLGRVGQAVAQ
FT                   RAIGFGMKVLGHDPFLSPDRARELGIEPTPLAEMWCRCDYLTLHVPLTEETRHLIGPAQ
FT                   FAAMKPGVRIVNCARGGLIDEPALIAALDAGKVAGAAIDVFEPEPPPADDPLVRHPKVL
FT                   VTPHLGASTEEAQISVAVEAARLLIDFLGEGRVRFAVNMPNLDKAELDELRHHLELGRR
FT                   LGMLHAQMDRGAARSVKLDYRGDIASRNTRLISAAFTAGWMETALTESVNLVNALVLAQ
FT                   ERGIQITESHSRDTEDFGSLISAEVVTDRKTYHASAALFGRQRMRLVGLGPYQIDCDLE
FT                   GVMLIFTHLDRPGLIGSIGTLMGNHNVNIAQMNVGRAVKGGEAIGVVNLDSIPPEEALE
FT                   ALRALPDLYSVTVIQLPERGELPAWLL"
FT   gene            complement(277123..278682)
FT                   /locus_tag="Isop_0187"
FT   CDS_pept        complement(277123..278682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0187"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COGs: COG1570 Exonuclease VII large subunit;
FT                   InterPro IPR003753: IPR004365: IPR020579; KEGG:
FT                   plm:Plim_0430 exodeoxyribonuclease VII, large subunit;
FT                   PFAM: Exonuclease VII, large subunit-like; nucleic acid
FT                   binding OB-fold tRNA/helicase-type; PRIAM:
FT                   Exodeoxyribonuclease VII; SPTR: Exodeoxyribonuclease 7
FT                   large subunit; TIGRFAM: exodeoxyribonuclease VII, large
FT                   subunit; PFAM: Exonuclease VII, large subunit; OB-fold
FT                   nucleic acid binding domain; TIGRFAM: exodeoxyribonuclease
FT                   VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60784"
FT                   /db_xref="GOA:E8R689"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:E8R689"
FT                   /protein_id="ADV60784.1"
FT                   /translation="MTQRTLHLFEGDEDPPCDDTRGGDPASTPVASSGRPRRRARSASP
FT                   ATTTAPSQQAAPPVKRRDRTTIVRAVPPPVANATPTLEPDSASSQEGNLPGPAELPILS
FT                   VTELTALIDGVLRTDFSAVAVRGELSRISRAQSGHLYFRIKDDFAVIDAVIWRSTAARL
FT                   PFDLTEGLEVEARGGLEVYAPRGSYQLVLTAIEPRGVGALDLAYRQRLARFQAEGLFDP
FT                   ARKRSRPAFPMRIVVVTSPVGAAVRDILQILGRRWPLAEVIVVPTVVQGAEAAPQIAQA
FT                   LLMADRLLRPDVMIVGRGGGSVEDLWAFNEEVVVRAIAACEHMVISAVGHEVDFTLADL
FT                   VADQRAATPSEAAELCAPLAEKLREALVATRTRLDRALARRLHEASARLALARSGLERA
FT                   GRALILQTRNRVERLADRLDRAMRADLLRRRATLRALAGRLDALSPLAILARGYSLTLL
FT                   EDDSATCGPPQRPLVVRDATCLKPGDRLRTRLAQGMVLSRVEAVEAGDEPNKEHAVTSC
FT                   NT"
FT   gene            complement(278764..279810)
FT                   /locus_tag="Isop_0188"
FT   CDS_pept        complement(278764..279810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpv:cgd1_590 hypothetical protein; SPTR:
FT                   Subtilisin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60785"
FT                   /db_xref="UniProtKB/TrEMBL:E8R690"
FT                   /protein_id="ADV60785.1"
FT                   /translation="MSILKSDWNPSLKPEDGLPSRWSADAASCRWRSSRRAGSWRRLVF
FT                   KSDHAAPLMIILVMVTLGLTALDRHRRLGLERERADSLARQLEVAVALNEGRSPPPSTR
FT                   SIHIVQRPVWGASASGRDKADSFPTARVPTARSDDPAATRRDRETTTWLAFPDLPRTNP
FT                   SPSSTSPDQSRASATPAAFGVASVSADGPPLPNLENLEQSLGRRLAAAAFAEAMGWQTN
FT                   RDQQRRLGLELPRDVPASLELAWKTWSLLQSAQRLAGWAGNRRRATPGGDMPSSPASAS
FT                   ELSLRDQEPWTPPPPIALNSDRPTVLNSPAVLAETIHRDPLESDLDQAPAPPILAPRTI
FT                   PWPGRFDF"
FT   gene            280285..280932
FT                   /locus_tag="Isop_0189"
FT   CDS_pept        280285..280932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0189"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; InterPro IPR006674; KEGG:
FT                   cfa:488744 HD domain containing 3; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SPTR: HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60786"
FT                   /db_xref="GOA:E8R691"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:E8R691"
FT                   /protein_id="ADV60786.1"
FT                   /translation="MNASSAASSVEGRRGDLFEDSSGGSDVGLQTLMEAIAFAARVHHG
FT                   ATRKDGRTPYVSHVARVTLVVRHVFGIADEQVLCAAALHDVLEDTATDFDDVAERFGTQ
FT                   VARWVAVLSKDSRLPEPEREEAYRQALSRSPWQVRVVKLADMLDNLYDRASLPTAQHAR
FT                   ILTKLEGYLDALRVEVGDPAREAWEMVRERLARAREAVRLDEGGGTLQESVS"
FT   gene            complement(281320..283191)
FT                   /locus_tag="Isop_0190"
FT   CDS_pept        complement(281320..283191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_2888 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60787"
FT                   /db_xref="GOA:E8R692"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:E8R692"
FT                   /protein_id="ADV60787.1"
FT                   /translation="MLEATDSRLASPSDHNTVFSPPHRVTSAHAPGSPDSLVPNTPGPG
FT                   IGLASRDDRDRAARRAFQYLQRRLAFNLTRSAIAESRLRLAIIVFCSIFFWATLFTFFR
FT                   QAFTFLSKFDLFAESLLDYAFSMYFLSIAGMLTFSTGIIGYNSLFLARESEFLLTLPAP
FT                   SDRVFAARFREAMLFSCWGFILIGTPLLVAYGLSEQAGALYYALILLFLIGFVLTPGAV
FT                   GMLGAFLVGYFLPRRYKTVLVLAILAVIAFVGFVGAQLLQSEEGGFNADWLDNAMGRLA
FT                   FSQSEWIPSVWITRGLMAAADGEVGEALTYLWVTWANGGMAYLCAALAARLFYRPAFSR
FT                   VQGGRSSRRFAGQWSSAFDRGFHRCAGFVDRPIRLLMLKDFRILRRDPTQWSQLLILVG
FT                   LLGFYFLTVRRLGSDQSPPSWRSMLSFLNLAVTALLLSTFTSRFVYPLMSLEGRNFWVL
FT                   GLFPVQRDSILWGKFAFASGLSIVATGAMVIASDILLRVGPLMIVMHVGLMSLICLGLA
FT                   GISVGLGARFPNLRESDPSKIAAGFGGTLNLLLSLVFILLIVLTVGLPTHLAVSTTETV
FT                   LSTTMLLQDARLSWTLGLALTACLIVGLLAVILPMRAGLKAFRDAEL"
FT   gene            283478..284488
FT                   /locus_tag="Isop_0191"
FT   CDS_pept        283478..284488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_0878 protein kinases, catalytic domain;
FT                   region: PKc_like; cl09925; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60788"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8R693"
FT                   /protein_id="ADV60788.1"
FT                   /translation="MTIPTPAALDAAESLATRHRPSTFRALGPNEPPEQIEVGGVTYQR
FT                   EIIWKHDSWAATGLYVEVETTIDRDRSNTAPSPVPRRVVAKFNRIQPIGPLPTRWLGRR
FT                   LAANEERLLRLMADWPGVPDWAGPVRVEGAPCLHAVARVFIPGRPLRRDDRVDDRFFPD
FT                   LAATLAELHRRGAAYVDLHKRENILVGDDGRPYLIDFQISHAPRRAYWPMSRVLKRLQM
FT                   SDWYHFDKHYARLRPDQFGKGPEAVAAARPWWIKLHRLVAQPFRRLRRRLLSCLKVRDA
FT                   SGRAHSEVFPEIAVMLERETAAARVAPGGDRPAPRGPVRRVETIGEAEPLTTVSH"
FT   gene            complement(284482..285291)
FT                   /locus_tag="Isop_0192"
FT   CDS_pept        complement(284482..285291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0192"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR017871: IPR003593;
FT                   KEGG: gau:GAU_0826 putative ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Putative ABC transporter ATP-binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60789"
FT                   /db_xref="GOA:E8R694"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R694"
FT                   /protein_id="ADV60789.1"
FT                   /translation="MIELRGVTKTFGAKTAVQNLSLTVEAGELFAFLGPNGAGKTTTIK
FT                   MVCGLLKPTQGTVLVGGHPADTAEARRLIAYVPDSPFLYDKLTGREFLKFVVEMYGIDP
FT                   RRGAEKIEELIAIFEMSDYVDNLCENYSHGMKQRVVFASALVHDPKVLIVDEPLVGLDP
FT                   RNARIVKDLFLSQARSGVAVLMSTHLLSIAEELADTIGIIDQGRLLAKGTLAEIRRQTA
FT                   IEHGALEDLFLRMTGGDRPFARALRGSTSSALTEAEAVEAAESVGSQ"
FT   gene            complement(285288..286331)
FT                   /locus_tag="Isop_0193"
FT   CDS_pept        complement(285288..286331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afo:Afer_1728
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60790"
FT                   /db_xref="UniProtKB/TrEMBL:E8R695"
FT                   /protein_id="ADV60790.1"
FT                   /translation="MPGRFTCTLIVLAWLGAVGLLVQRDLLPRWRAGDPPRVVVARAIT
FT                   DLDGPLDQIEPPRSESSRWSLLVGTDLQPIGELTTESEPRDIGGSRLSSRLELDSAALL
FT                   AKTPFGGRLPLFGGTAGFESPAPSTVAVADPETPPPPTRLVVRTQMILDREGSMVRFET
FT                   RVGDLQGNNLLTMKGLRQGLSLEVQAETSNGVVLFREKVPYAQGAGVQNGLGPYLAYRD
FT                   LKVGQSWRGPVVNPLTSSVQTAQVEVKEIAPLVWNGRPHLCHVIVSTLGPIVARTWVRV
FT                   EDGVVLRQDVPVPFIKLTLERIDDPAQTETQAPETGSPATTNGSSDPAHPASSNNPLPP
FT                   KSSETLR"
FT   sig_peptide     complement(286275..286331)
FT                   /locus_tag="Isop_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            286707..287909
FT                   /locus_tag="Isop_0194"
FT   CDS_pept        286707..287909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0194"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR004383: IPR007197; KEGG: plm:Plim_2783 radical SAM
FT                   enzyme, Cfr family; PFAM: Radical SAM domain protein; SPTR:
FT                   Ribosomal RNA large subunit methyltransferase N; TIGRFAM:
FT                   radical SAM enzyme, Cfr family; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: radical SAM enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60791"
FT                   /db_xref="GOA:E8R696"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E8R696"
FT                   /protein_id="ADV60791.1"
FT                   /translation="MLGSPASVLELDSRTAWSGAGREGADHGTPAARRAGATLPGLTAW
FT                   LAERGEPAYRSDQVARWIFQKRARSFAVMTDLPAGLRLALESSWAVYQTRVIRRQTATD
FT                   GTDKLLLECRDGRRIETVLMREEDRRTVCVSSQVGCGMGCVFCASGLKGVERNLTVGEI
FT                   TEELLHARDLLPEHERLTNIVVMGMGESLANLENLIAALDRICSPSGLGLSQRAVTIST
FT                   VGLPEKIKRLAALDRRYHLAVSLHAPTEELRDQLVPINHKVGLRAVMEAADHYFAVTGR
FT                   QVTFEYVLLGGINDRDRDARDLVALLAGRKAHVNLIPYNPVAGLPYERPAPRDLDRFVR
FT                   RCRQGGLSVSVRKTKGKRIDAACGQLRRRIAEATIPASAGNAGAAIELATPGGSIARLG
FT                   G"
FT   gene            288093..288833
FT                   /locus_tag="Isop_0195"
FT   CDS_pept        288093..288833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0195"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="COGs: COG1595 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24 homolog; InterPro
FT                   IPR014284: IPR007627: IPR013249; KEGG: psl:Psta_1783 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; SPTR:
FT                   RNA polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70
FT                   region 2; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60792"
FT                   /db_xref="GOA:E8QWA5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWA5"
FT                   /protein_id="ADV60792.1"
FT                   /translation="MSRPTLDGAPPSNPSPLPMSSGLGGVAGIPGGPECWNHWLADPDP
FT                   LTRDWAARDPDVRLMLATRAGVPGAFERIVSHYQDRLLGIVAHLVGRGSGTSDETEDLV
FT                   QEIFLRVHRARTSYTPRSKFSTWLFTIANHVVANHLRSKGRRPWVTASATTMAPTGVLA
FT                   SAPSREATPSTQLKRDELARVVQEALNELSEDQKLAVLLQKFEDLGYAEIAAILGKSEA
FT                   AVKSLLARARRTLRERLQAYLDGD"
FT   gene            288855..289757
FT                   /locus_tag="Isop_0196"
FT   CDS_pept        288855..289757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0196"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG1040 amidophosphoribosyltransferase;
FT                   InterPro IPR000836; KEGG: cja:CJA_0425 competence protein
FT                   ComF; PFAM: phosphoribosyltransferase; SPTR:
FT                   Phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain; TIGRFAM: comF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60793"
FT                   /db_xref="GOA:E8QWA6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWA6"
FT                   /protein_id="ADV60793.1"
FT                   /translation="MSHIASLDADPDRSAAAGAESDGVARSLFALNLNPADPRRGWRGW
FT                   LREVGASLDRVLFVQGCQICGGHVDDDPRAAPWCLDCRAELIESVPHCCLRCGQAVGPF
FT                   ASATLKQGCARCRGRSLGFEGVVALGPYQGPIRALCLHLKRASGAWLGAWLMDLTIESR
FT                   FERLRSLELKTDPDGRPPLVTSIPLHWRRRWARGYNQADDLAARLAQRLDLPWRRVLRR
FT                   IRPTPKLAGRSPTERLDLMRRAFQVISSRRSCLERRDILLVDDVLTTGATTGAAARVLK
FT                   RAGAARVFVVVIARTEPNR"
FT   gene            289890..290888
FT                   /locus_tag="Isop_0197"
FT   CDS_pept        289890..290888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0197"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COGs: COG0181 Porphobilinogen deaminase; InterPro
FT                   IPR000860; KEGG: psl:Psta_2360 porphobilinogen deaminase;
FT                   PFAM: Porphobilinogen deaminase; SPTR: Porphobilinogen
FT                   deaminase; TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase, C-terminal domain;
FT                   Porphobilinogen deaminase, dipyromethane cofactor binding
FT                   domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60794"
FT                   /db_xref="GOA:E8QWA7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWA7"
FT                   /protein_id="ADV60794.1"
FT                   /translation="MLSPTTACSSSPLPSHRRVRIGTRGSPLARWQAEWVAARLRDAWP
FT                   GLTVELVEIKTLGDRDRNSPLASIGGAGLFTKEIQRALLDCRVEIAVHSLKDLPTQPVE
FT                   GLILGAVPPREEPRDALIAPAHGLLEHLPAAARVGTGSLRRRAQLLWMRPDLEVVGVRG
FT                   NVETRLNHALEGRLDAVLLAVAGLRRLGLDSAITQTLGPPDFLPAVGQGALGIECRGDD
FT                   PDTLALLAPLDDPASRASVLAERALLADLEAGCMVPLGAWGRSEADGLLALDAAVLDPA
FT                   GRQRLAAHASGPANDPQTLGLAVAAELRRQGAEALLRPCGEEPAKEPSSSH"
FT   sig_peptide     289890..289988
FT                   /locus_tag="Isop_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(291043..292218)
FT                   /locus_tag="Isop_0198"
FT   CDS_pept        complement(291043..292218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0198"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR001176: IPR004838: IPR004839;
FT                   KEGG: ttr:Tter_0434 aminotransferase class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase
FT                   class I and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60795"
FT                   /db_xref="GOA:E8QWA8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWA8"
FT                   /protein_id="ADV60795.1"
FT                   /translation="MNSPLLATKTARFAESVIRGMSIEAARHQAVNLAQGMPDFPAPRE
FT                   IKEAACQAIQSDINQYAITWGARALREAIAEHAGWHLHLPIDPETEITVTCGSTEAMLV
FT                   VLMSLINPGDEVILTEPFYENYWPDCVIAGAEPRFVPMRPPHWRLDLDELAAAFTNRTK
FT                   AIILCNPNNPTGTVLNAQELQTVASLCQRWDVVAITDEIYEHIVYDGRIHRCLAALDGM
FT                   KERSVVIGGMSKTYSVTGWRIGTILAPAPLTKAFRQMHDFVSIGAAAPLQEAGAVAYRL
FT                   PRSYYDRLAADYQARRDRLCDALERIGFGLTRPEGAYYVMADFDAFAPGESDTHFARRL
FT                   VRDYGVATVPGSSFFLNHRELGRSMVRFCFCKRDETLDAAIERLERLRALV"
FT   gene            292551..294788
FT                   /locus_tag="Isop_0199"
FT   CDS_pept        292551..294788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_8053 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60796"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWA9"
FT                   /protein_id="ADV60796.1"
FT                   /translation="MNRHLFGSHWGRCSVIVLLTATTWSPRTLSADDPRPTSPPTANPA
FT                   TSAESNERALDARIDQARALLKRDRPEQAARLLEPHLLEWAQLDPTQRIALVNELRACY
FT                   RGAIQQHRLAGRSHKVDEFEEGLEMLAKLRVAATRQVAPRSSSTRDSATKPNEGRNGLE
FT                   PPKSPLHDSNLNGLFTDLPTPPTPLEADEPPHPLNRQPRGGEAGNRSLDPPSSPSDPAS
FT                   SDTKRDHVDVFKDEDKAKGGIDTGAEELAEESDSLGGGGIDLRDLVAALPELDSIDRPP
FT                   ADSQIQPTAGEASPRKDAADASNAPMTPIENQGVAPARKQPAAEGVSSPANQSPLIRLR
FT                   EADAAFEAKDYDRAGRIYAELAALNALPKSHHPHWGYCRWRAISQRIQAGPTSSREWDA
FT                   IDAEIESVNRLCPEHWFGEYLRNLADEQRGRVGVPGATPRDERVRPAGAIPSPSPSVRN
FT                   GSARVPLQSQTTLDWDDNANSRVREPVDSGRPGRPVGGWKLWESTNFRIIHRLEEERVR
FT                   ALTIRAETIRAEAFAWWSNTTPTRWLPRCDIFLHPNADSLRQAAGQALDAQAPGISRVD
FT                   LNGGRVVARTIHLRTDVDRWSERVLPREIAQVVISDLFPTADPPPWGREGLAALFEPSA
FT                   SRERLATEAAIMARRGRLWPIDRILAVADPATLTPLEWVEFRIQAATLVRHLVETRGQD
FT                   ALIQFLRASRTGSVESHLRELLGFEDLAALERSWVTVLGEGTDASSPRSQD"
FT   sig_peptide     292551..292643
FT                   /locus_tag="Isop_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(295248..295613)
FT                   /locus_tag="Isop_0200"
FT   CDS_pept        complement(295248..295613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:445226 zgc:100957; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60797"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB0"
FT                   /protein_id="ADV60797.1"
FT                   /translation="MIALSHRPETLVVPEPDGSSPDLVDPCTTTLTADFDLLEPTLHDW
FT                   LDPRRALNTPLAADLDEDEDEEDDDLDDDLDDDLDDDLDDLDEIDELGIDDDLDEDFDD
FT                   DFDDDLDDDDDDDDDDM"
FT   gene            complement(296128..297177)
FT                   /locus_tag="Isop_0201"
FT   CDS_pept        complement(296128..297177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0201"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: ttr:Tter_1808
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60798"
FT                   /db_xref="GOA:E8QWB1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB1"
FT                   /protein_id="ADV60798.1"
FT                   /translation="MDRLRIAVAGCGVAARAHTNRLARRRDVRIVALADPDLQAAQRLA
FT                   EGLIGAGPGVEAEGPTVFGDHVSMLRAVHPDALAVFTPHLHHFRVALDGLLAGCHVFVE
FT                   KPLCTNVQEATDLVNVARARDRILAVGHQYRLRPTLKQAKQRLAEGRIGRPRLAVGLLA
FT                   QPWLAAHAGGEDSWRFDPRIAGSGILTDSGDHLLDTLLWVLGTPALEATAIQDRLDSGL
FT                   DVVTAAAVKLAPNLPATLAVSGVSAGSLFELTILGETGALRVSETLLQERLGDQPFQTI
FT                   AEEVSGSAGDGPDFQVSQVAGDSIDDDFVEAARGRRFPSCPGDQALGTVKLLEAIARSA
FT                   ATGRPVAIA"
FT   sig_peptide     complement(297121..297177)
FT                   /locus_tag="Isop_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(297348..299138)
FT                   /locus_tag="Isop_0202"
FT   CDS_pept        complement(297348..299138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_3249 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60799"
FT                   /db_xref="GOA:E8QWB2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB2"
FT                   /protein_id="ADV60799.1"
FT                   /translation="MFAGPILAREFLTIPRPLRFYLIRAAYAGMLFVTMWTAWQSLIGW
FT                   QNVNAVGTMARFGNVLYKIFALGELTLMLFFAPIAAAVAIAFEKDRRTFTLLMMTDLSD
FT                   LEIVVGKLVASLVMVATLLATSAPVFFVCLLLGGISFRQLGEVLTVTASAGLAGGSLGL
FT                   LIALWRDRTFPTLALTILVVALSLGLIELLGILLPGVTFLGSPLAVTLNPFRNLYAILE
FT                   PVDPARTGAGLAFMTVSILVSLALNTISVVMLRRWNPSRNEPREQREGVEETESSEGIE
FT                   QIDEETPAQITEELKLRIPRRRHRRIAPPPRPYRVPWDTPIIWRELKTRAYGSKPLIIK
FT                   GAFVAAFALAVGFGLVNPAMLAPSFAFVAVLSLLLVNAQAVTALTSERDTGALDLLLVT
FT                   ELSPREFILGKLYGAIYNTKEMVALPLLYLLMLAWMGRIDWEVAVSVFLGFVLMVHFAA
FT                   MLGLHSAITYTSSRTAIATSLGTLFFLMVGIIVCAFLIILSDRDFGRQLLSFLIFIGAG
FT                   SVGLFLALGSKNPSPAIGWVAALTPFWTFYCVIGVLNGDDPFGILAVGFSLYSFALAAM
FT                   MIPAISDFDIALGRTNAIQG"
FT   sig_peptide     complement(299055..299138)
FT                   /locus_tag="Isop_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            299473..301728
FT                   /locus_tag="Isop_0203"
FT   CDS_pept        299473..301728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0203"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="COGs: COG4099 peptidase; InterPro IPR001330:
FT                   IPR010496: IPR003140; KEGG: plm:Plim_2385 protein of
FT                   unknown function DUF1080; PFAM: protein of unknown function
FT                   DUF1080; Prenyltransferase/squalene oxidase;
FT                   phospholipase/Carboxylesterase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Prenyltransferase and
FT                   squalene oxidase repeat; Domain of Unknown Function
FT                   (DUF1080); Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60800"
FT                   /db_xref="GOA:E8QWB3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB3"
FT                   /protein_id="ADV60800.1"
FT                   /translation="MRLLRFVPFLVCGAWGDLPAFWVATAATPPSTPISHVVPARPDDP
FT                   WTLTHDFVASCRNADGGFGPAPNQPSTLGATSAATRVLKCLGGTLDDPLSVLKFVHACW
FT                   DQTSGGFAPTPGGTPDPNTTSVGLMVWADLRIDQPEEVPQRALAYLSDQARDFDTIRLA
FT                   VAGVEAIGGPSKLDPAVRDAWREQILARRRPDGLFGEGDRPNAFATGSAFVALMRLGQS
FT                   PEELDRDRVIALILDQQRSDGGWSDGSSPEAPSTLSATYRIVRALRMTNTPPRNLDALR
FT                   SFIAACRNPDGSFRNRPDAPVEDRSATYFAAILHQWSRELDHLPAVVETAGFQPLFDGR
FT                   TLTGWEGGAPGLWTVRDGVLVGDSPGIAKNDFLATEEEFEDFILKLSFRLTGGPDANSG
FT                   VQFRSARIPNSHEMIGYQADIGKGYWGSLYDESRRNRVLAAGRKEAVDSVAVNGWNTYE
FT                   IRAIGPDIRLTLNGVPSVAYREQDEAIPRRGQIAVQVHSGGPLKVEFQELWIQRLPHLT
FT                   SDARPDGVAPTPNVPGFHRRYLQPAQAGEDPRAYTVWLPPAYDGVKTFPILIFLHGSGE
FT                   RGVDGLAPAQVGLGPALVNHPDRYPYVVLFPQARERWSGDGTDMDAVVALLDDVTASYK
FT                   VDPNRVALTGLSMGGAGCWNLALRMPERFRAVAPVCGFVDPARVTPLKNVPFWVVVGDA
FT                   DRLLPGSRGPVQALEALGARPVYKEHRGVGHNSWDRAYDDPAFARWLAERLEVHDGE"
FT   sig_peptide     299473..299550
FT                   /locus_tag="Isop_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            301851..302330
FT                   /locus_tag="Isop_0204"
FT   CDS_pept        301851..302330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA3428 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60801"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB4"
FT                   /protein_id="ADV60801.1"
FT                   /translation="MPRFAILEHDWPTLHWDILLESGPALRTWAASAPPGHDSPAVVTV
FT                   AVAEAVKEARGLEGIDSLSLVYALPDHRLAYLDYEGPVSNQRGRVVRFDSGAFAIRLWN
FT                   DFQVVAALRGDRLRGVLTLVRLDRPRHSRGHPWGLAWSPSDLLPSTAPTPRHPVG"
FT   gene            complement(302447..302575)
FT                   /locus_tag="Isop_0205"
FT   CDS_pept        complement(302447..302575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60802"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB5"
FT                   /protein_id="ADV60802.1"
FT                   /translation="MTFGTHAPFHLKDAKWAFKVTTFFQTMEIFRVDQKQVRRRGG"
FT   gene            302722..304203
FT                   /locus_tag="Isop_0206"
FT   CDS_pept        302722..304203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cag:Cagg_3809 protein of unknown function
FT                   DUF88; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60803"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB6"
FT                   /protein_id="ADV60803.1"
FT                   /translation="MNQFNTAIFYDLENLLKGYNFSQQLLTNLSLVEILESIRATNRLG
FT                   KVALQRAYANWSDPRLASLRGEVNDLGIDPIQVFGFARDSRKNAADIQMAIDAIDLAHT
FT                   RPGLEIFVIVSGDGGFSALARKLHEYGKTVIGCAYQSAANRTFRAVCDEFVWLADPIEE
FT                   ERGDRSMTGSVGYGMGGPAQAAYESATGPRPSLHPLVTDPRNHRLASHLRSIGLVVGGA
FT                   AFGDEPPSFEQVVEKTRAILKWYASDPESRRDLSRSGIHLNVVQEAVRSAIPGFQAMRY
FT                   GFAKFIEYLQCVCRDTEVGVVRPPSPQAQAILMLREAVRDPSTILPDLQPRDLHSPENY
FT                   AAILAYGNPILRMTSITEWRAVTSWMIAHPAQRIDLGSLIESASLDLEGVVNPAAIKQV
FT                   LLNYVAADVFLREPEGLPISEQRLTLRPDYRHAEHLREALRRVAFDKLVAGGLEPRAET
FT                   LERLLPSWSGEVGLVAARGGQARPDAEDHQHSWTT"
FT   gene            complement(304337..304540)
FT                   /locus_tag="Isop_0207"
FT   CDS_pept        complement(304337..304540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_332710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60804"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB7"
FT                   /protein_id="ADV60804.1"
FT                   /translation="MRHEVGSEGRASTKMIPTTPHTQIRMTNTPRNSQTKVIENETRSN
FT                   PSFQLPERSLMVNRVASAQPLS"
FT   gene            304620..305588
FT                   /locus_tag="Isop_0208"
FT   CDS_pept        304620..305588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0208"
FT                   /product="protein of unknown function DUF323"
FT                   /note="COGs: COG1262 conserved hypothetical protein;
FT                   InterPro IPR005532; KEGG: psl:Psta_1182 protein of unknown
FT                   function DUF323; PFAM: protein of unknown function DUF323;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Formylglycine-generating sulfatase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60805"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB8"
FT                   /protein_id="ADV60805.1"
FT                   /translation="MNPIDSPPIASAAALSDGGESNRNRSASLLTVPTRRVLILVASGL
FT                   FCLWAWEGLSRRTFSKPAVAHRESQSWEGREAGELKVVTYKDQELRFRWCPPGSFTMGS
FT                   PPTQPDRFDNEGPVEVRLTRGFWMLEVEVTQGLWRAANGPKLDWERKGAGPLLPVYNVS
FT                   HSEAAAFAASLTTQLRRGSELPPGWKVSLPTEAQWEYAARAGTTTRFPFGDDESQLGEY
FT                   AWYAGNSNRMPRNVGTRRANAWGLKDMLGNVWEWCLDGYAEALPGGKDPIGDLELPARV
FT                   NRGGSWTDEALYCRPTARVGDVPTYRNTGLGFRLTLVPDQN"
FT   gene            complement(305849..307006)
FT                   /locus_tag="Isop_0209"
FT   CDS_pept        complement(305849..307006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0209"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro IPR000111: IPR020578:
FT                   IPR000192; KEGG: ddf:DEFDS_2124 serine--glyoxylate
FT                   transaminase; PFAM: aminotransferase class V; SPTR:
FT                   Serine--glyoxylate transaminase; PFAM: Aminotransferase
FT                   class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60806"
FT                   /db_xref="GOA:E8QWB9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWB9"
FT                   /protein_id="ADV60806.1"
FT                   /translation="MKKPRLMTPGPANVPEDVLLDLARPVIHHRTAEVKQAIAEVTEGL
FT                   KQVFRTQHDVLILTASGTAAMEAAAVNTVPRGSKAIVLNAGWFAQRWLKVCQAYGINAV
FT                   SLDFEWGQPVDPARVEQALAEHPDAVAVMGTLSETSTGTGHPVAEIGQIVARTPALFAV
FT                   DGISGVGAMECHTDDWGIDLLCVGSQKALMLPPGLAFVSVSPKAWARIDAYPNPPCYYL
FT                   DLKAARKKMADFDTPYTPAHTLILALRTALKRILAEGIEHVWARHRRMSEACQAGVTAL
FT                   GLELFSARPAEGLTAFRVPEGLKDSDIRGRLEQKFGITTIGGQDKLKGKIVRIGHMGYT
FT                   DELDVIAGLAALEMVLDELGYDVEPGVAVAAAQRVLLNRNVTAAV"
FT   gene            complement(307334..307780)
FT                   /locus_tag="Isop_0210"
FT   CDS_pept        complement(307334..307780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0210"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="COGs: COG0139 Phosphoribosyl-AMP cyclohydrolase;
FT                   InterPro IPR002496; KEGG: dde:Dde_3567 phosphoribosyl-AMP
FT                   cyclohydrolase; PFAM: phosphoribosyl-AMP cyclohydrolase;
FT                   PRIAM: Phosphoribosyl-AMP cyclohydrolase; SPTR:
FT                   Phosphoribosyl-AMP cyclohydrolase; PFAM: Phosphoribosyl-AMP
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60807"
FT                   /db_xref="GOA:E8QWC0"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC0"
FT                   /protein_id="ADV60807.1"
FT                   /translation="MSPGNLPPFSDSKAPLRVFDLLKRSHDGLVPTIVQDADTHQILMF
FT                   AWMNDEALRATLTTGQAHFFSRSRNALWHKGATSGHTQTVVEVRLDCDADVLLVRVRQL
FT                   GGACHMGYRSCFFRTVAADGRVEIADLPVFQPETVYRPTKNFPP"
FT   gene            complement(307777..309150)
FT                   /locus_tag="Isop_0211"
FT   CDS_pept        complement(307777..309150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0211"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013026; KEGG: afw:Anae109_3372 TPR
FT                   repeat-containing protein; SPTR: Tetratricopeptide TPR_2
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60808"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC1"
FT                   /protein_id="ADV60808.1"
FT                   /translation="MDEPRRPDVVPSSTDSPMGTPRDVDSNVNTTNPSSDPPPVMTGWN
FT                   QLRLQRPLAAWACWSRVLRDNPNDSAAKQALEALLKAPHLPHAARAVYRFRMPSIPIRR
FT                   ARWNAVLLARDQEDLDAAADVFAQLMAADPEDADAAFNHALCLAWLGHNADALAALDRV
FT                   VRLDAATRPDQAAAAWVVAEVLRQGAGAERFADEWSHTLVMPRHSRDDLWIAQLEEAGR
FT                   LRRFATPLRPDTLEPVATDLQVYELLDRALTEVGEPTSGYGDPDSTPPPPPSRPARVMC
FT                   SVLVQPNELRFSSPDPESLRRVETFLPMLRPDASCRPVQRLSSPLPLNMLDAAAWLTRL
FT                   PVGLPEDQRRRLAQEALDDYYRNTWIHQPRQGLEGLTPALAAESSDPVIRVRLDAILTF
FT                   REQVDARSPVGWPLEIHHDFDDLRRRLQARRPDATPRLDQPHLKTQATPPELDRSEPQ"
FT   gene            complement(309401..311695)
FT                   /locus_tag="Isop_0212"
FT   CDS_pept        complement(309401..311695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0212"
FT                   /product="SEC-C motif domain protein"
FT                   /note="InterPro IPR013026: IPR004027: IPR019734; KEGG:
FT                   psl:Psta_1877 hypothetical protein; PFAM: SEC-C motif
FT                   domain protein; SMART: Tetratricopeptide repeat; SPTR:
FT                   Protein disulfide-isomerase-like protein; PFAM: SEC-C
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60809"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC2"
FT                   /protein_id="ADV60809.1"
FT                   /translation="MSLVDQYAPCPCGSGKKYKFCCQKAETFIKRVTLERENGQREAEA
FT                   RSLDEGLARFPDVPWLLLNKANAESQAGRPDKARDLVARVLKIQPDHPVALSAMARLLF
FT                   SNQSDNGKARGHAGAVVELLQNALNATTPERRHLLAELAEFTATVLIAEGHPLAAARHA
FT                   ELADMLDAQEPLDPKAGVNAKAENDDHSRGLELLMTPAIVPWAKQPPKLAAAPEDLSER
FT                   EACEFEEAVAWVHRGYWLKAVERFERFAKENKGGVATWLNLGLTLAHLGRDRDALASLR
FT                   RVRPTLGETEEAVDLECLCQSLTPLDAVPTLERVQLVWPLRDRRAALERILAEELAIRQ
FT                   PSPPPQDPDDPNEPTDLFLIVDRPPPPSSRFAELTAADLPRELARLYLFRDKIALETFE
FT                   NEGLAGLQQRITGLLGDAVPPAHPKTEVVGREPTHLVPLRNTLVAPPGLPLLTFRRFQR
FT                   EELHRLLHERWPDIPHPTLNGRTPRQAAEHAVHDSETRIVLRAMFLAMEVSVALKGILS
FT                   LDDLRQQLGLAPEPPVVVELVEGRIDFLQIPAARLHLIQISESFTPTILLGLYFQAKVY
FT                   AQLAALYRFAQALARHQPEVLAQLDLDLRRLYGDLLSIPLLRGDAEEALRTIEQGRQAD
FT                   PLRAKGSHAATWDLLEARVRSQAEPPESWVPLFQKLFQRYSASKETLPVLIHHLSQLGL
FT                   VRLIPHPEQPDTAMLDTAPLDFLIARYGSKIIPATRHPELGDREPVRPKIWIPGGDEGS
FT                   GSAKSLILPGR"
FT   gene            complement(311979..313622)
FT                   /locus_tag="Isop_0213"
FT   CDS_pept        complement(311979..313622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0213"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="COGs: COG1160 GTPase; InterPro IPR005225: IPR016484:
FT                   IPR002917; KEGG: psl:Psta_1973 small GTP-binding protein;
FT                   PFAM: GTP-binding protein HSR1-related; SPTR: GTP-binding
FT                   protein engA; TIGRFAM: ribosome-associated GTPase EngA;
FT                   small GTP-binding protein; PFAM: GTPase of unknown
FT                   function; TIGRFAM: ribosome-associated GTPase EngA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60810"
FT                   /db_xref="GOA:E8QWC3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC3"
FT                   /protein_id="ADV60810.1"
FT                   /translation="MPVPKVAVVGRPNVGKSSLFNWLVGKRVAIVEPTPGVTRDRVSTL
FT                   LCLDFNERPTRHSSPRPRFKDVRDLLEEEDEELDEPSQPSDAARYVELIDTGGIGIVDR
FT                   DDLSDHVERQIRIALEEASLVLFVVDVRDGRLPLDEEVADRLRRINRPTILVVNKVDHP
FT                   GLEDRVAEFDRLGFDERILVSTKENRNRSGLLDLIARSVPLVDDDNKPRAAVMKIAVVG
FT                   RPNTGKSTFINTLAQEERMIVSEVAGTTRDSVDVHFELDGLPFTAIDTAGVRRKAKLRD
FT                   SLDYFSLHRAQRSIRRSDVTLLFLDPTQGITKLDKQLADYIQQQYKPCIFVINKWDLIV
FT                   EGPNRAQAPPQETMAVVAAAIEREFRGLAHVPLAFITAKTGKNVKALINHAQALFKKAN
FT                   LQVPTARLNKVLRQILTSNPPPIREGKRPKVYFITQVAVAPPTLVLFVNNPDLFDTSYR
FT                   RYLSNRFRDLLPFGTVPVKIYLRDRNDPEAAGSSGRAGMPSRDLLDDPTLRDQDNKNEE
FT                   ALEGLRLTDQDWEEEGTSAWLESPLGPNND"
FT   gene            314116..314757
FT                   /locus_tag="Isop_0214"
FT   CDS_pept        314116..314757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_5899 protein of unknown function
FT                   DUF395 YeeE/YedE; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60811"
FT                   /db_xref="GOA:E8QWC4"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC4"
FT                   /protein_id="ADV60811.1"
FT                   /translation="MTRDVATRNDAGAFGVLDGVSLVAGGAIASLHLRDVVPSDPSSAS
FT                   ALMALAMIVGIGVTASGPLIVGLHAWSAQGWVRPSRGEWVWALAGLPWIGAALARIVFG
FT                   VPPQGATTMLAGTLVVWASALGFGLWIAAGEDDWEERTDVELRSASSIPSTAATIRSLD
FT                   LRPTGSTAQRGEVTTTGSGHSVTWRHWIGLSVLFTAPLQFVFAFLIGDVP"
FT   gene            314754..315341
FT                   /locus_tag="Isop_0215"
FT   CDS_pept        314754..315341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_1392 PAS sensor protein; SPTR: PAS
FT                   sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60812"
FT                   /db_xref="GOA:E8QWC5"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC5"
FT                   /protein_id="ADV60812.1"
FT                   /translation="MNDPQLTACASQGQGGRPNLPEFGGVMVGYALAGTLAKSVMPGSM
FT                   TLQTGDPHLWPVILGVYVWLGLAMAGPFVMLTSVLGRQRVAQSEDHPAVPVEASWSRGE
FT                   TAWVLVGTYWLVMTLLVVPRGLSEMVQLGLTPGLALIMLGYLPRSASSLSRSGLGRDEP
FT                   AGRWTRKAALAVMAAWPLTWLGLILLGREWFG"
FT   gene            315338..316087
FT                   /locus_tag="Isop_0216"
FT   CDS_pept        315338..316087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3000 NLP/P60 protein; SPTR: NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60813"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC6"
FT                   /protein_id="ADV60813.1"
FT                   /translation="MNPSGMDTPSRGDSATQGDFNRDAEAMTWVGEEVGLNRLLGLYDV
FT                   PAFARRGQATESALEAFERGVLRERALRLKEVVRRLDEWRDAARSFETLGPDELARRAG
FT                   LKVPIEPLIAVVEQELQRPSGVSAVALALSRGEAATNRPTPTPKPPPEPAPSQARAGSW
FT                   SGRLRLRARTRALRAAVERFNRLWDMYLSSLDLSAINQIVNDYNSYYLLEKECVMGSRL
FT                   LAGRLFEPLAPLEVETLRRRFPPLPMI"
FT   gene            complement(316356..317495)
FT                   /locus_tag="Isop_0217"
FT   CDS_pept        complement(316356..317495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0217"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR004635: IPR002142; KEGG: nde:NIDE2543
FT                   putative signal peptide peptidase SppA; PFAM: peptidase
FT                   S49; SPTR: Signal peptide peptidase SppA, 36K type;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   Peptidase family S49; TIGRFAM: signal peptide peptidase
FT                   SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60814"
FT                   /db_xref="GOA:E8QWC7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC7"
FT                   /protein_id="ADV60814.1"
FT                   /translation="MSSPSPSAPDSNPSPESGQGGPLPPLPFRFSNLGGGSTIILERGR
FT                   RGWPWRWAVWGLLLVSLLLNVSLLTASLGPIPDAVREQYVAGPIGPGKAKLAIIEITGS
FT                   IDDSKADGISRQITQASLDSSVKGVLLRIDSPGGTVSASDRLWRDVQTRLVGRKPVVVS
FT                   MGSRAASGGYYIACAGDALFAEPATITGSIGVILEIPQISGLLDKIGVEFATLTTGKFK
FT                   DSGSIYRPITNEERQRFLKSIDQSYQRFLRVVAQGRKMELSQLKPLADGSIFSGEEALE
FT                   NGLVDFLGYQDDALRHLLKLTRLEEAQVVRYVPPNSLATLLELLELGSRLPSPHPDPDE
FT                   SLSLWAPASQRDQGRSMPIPLSRAQVDDWLAPRLLMLSR"
FT   gene            317692..318729
FT                   /locus_tag="Isop_0218"
FT   CDS_pept        317692..318729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0218"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593; KEGG:
FT                   nhl:Nhal_0558 ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60815"
FT                   /db_xref="GOA:E8QWC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC8"
FT                   /protein_id="ADV60815.1"
FT                   /translation="MIEVERLTKTFGLLRAVDGVSFAVESGQIVGLLGPNGAGKTTTMR
FT                   MLTTALIPSSGRGRVAGHDLLDEPLAVRRHLGSLPETPPLYPEMRVKEYLAFRAKLRDL
FT                   SWSQRRIAIARVLERCALNEVASRPIGQLSKGFRQRVGLAEALLHDPPALILDEPTAGL
FT                   DPLQTREFRALLRELGGSHAILLSTHILSEVEAVCDRALIISQGRLALDEPIAASGIVP
FT                   GGVRIDLETPEAVELETIARQLAAVAGVEAVEPIHAYASLDHNGAPPLRPGRRRTGWRL
FT                   RLRSKTDRDDDDSRTNPSDDPRAVLVRRVVERHWDLLRLEPIRSSLEERFVEVVARDVR
FT                   PSAVA"
FT   gene            complement(318807..320732)
FT                   /locus_tag="Isop_0219"
FT   CDS_pept        complement(318807..320732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0219"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="COGs: COG0326 Molecular chaperone HSP90 family;
FT                   InterPro IPR001404: IPR020575: IPR003594; KEGG:
FT                   lic:LIC12469 HSP90 family protein; PFAM: ATP-binding region
FT                   ATPase domain protein; SPTR: HtpG; PFAM: Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60816"
FT                   /db_xref="GOA:E8QWC9"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWC9"
FT                   /protein_id="ADV60816.1"
FT                   /translation="MNTFSPSQSPRNFQINLHGIIELLSGHLYSGPQVFVRELLQNAVD
FT                   ALTARTQLDPSWPTGEAGRITLEVWNPRAARPTLVVRDDGIGLTEQEVHTFLATIGLSS
FT                   KRDEANWDDPTDFIGRFGIGLLSCFVVSEEIVVITKSAKPSPPRPGEITPRANVGVEWR
FT                   GRSDGTYTVRTLDPESDAALEIGTKVFLTCKPGSEEFFCTNRLIELARDYGSLLPYRIE
FT                   VIAEGARERATRINPEPPPWRQIYARPEERDQALLAYGRSVFGIDFIDVIPLRAEAGEV
FT                   DGVAFVLPFSPSLASKRTHRVYLKRMLLSEQADNLLPEWAFFVKCVANANRLKPTASRE
FT                   RFHENADLANARDELGACLKKYLVRLANRDPQRLRRIVELHYLSIKALAIRDDEFYRLV
FT                   IDWLPFETSMGRMTLTEYRRREESDTLKYVANLDQFRQIAPVAAAQGICLINAAYTYDL
FT                   DLVERFPDIVPEGRVEAIDADDLARSFDELEPDELDRASTLLDVAEVILRPFRCLPQVK
FT                   RFLPVEMPALYSLSAEAEFLRSLERTKEVANSLWSSVLDGIAPGDEEIHARLRFNYDNP
FT                   LIRCLIELNHRPTLEKVVPILYVQSLLMSHRPLKADELALLNTGLSDLIVWGLEPRSPQ
FT                   CSRETA"
FT   gene            complement(320974..324255)
FT                   /locus_tag="Isop_0220"
FT   CDS_pept        complement(320974..324255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0220"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467: IPR001789: IPR000014: IPR000700: IPR
FT                   004358: IPR013655: IPR003661: IPR003594: IPR001610; KEGG:
FT                   dma:DMR_33580 two-component hybrid sensor and regulator;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein;
FT                   response regulator receiver; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAC repeat-containing protein; PAS domain containing
FT                   protein; response regulator receiver; SPTR: Two-component
FT                   hybrid sensor and regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Response regulator receiver domain; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60817"
FT                   /db_xref="GOA:E8QWD0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD0"
FT                   /protein_id="ADV60817.1"
FT                   /translation="MTDSSASARLNSPILSNGARDGVSTTTAPASEPLSDTEARTGSWR
FT                   QGWRWLEPFGLAVTAGWLALSPGLTQWISLSAQQINLVGMSLITLTAWGWWSRVRTDQR
FT                   TARRGWHPNYAPHPTPTPIVTGLQTIGVHAVSHASTTSTASTDDPVHLEGEMGRLRARF
FT                   IASIKRAGLNYWDFDFATNRFIFSSTYKSLLGYENRELPDNANTWRERIHPNDRDLALN
FT                   ALEAAREGRDPILCFSHRLKTKDGGYRWVLAHGVVLRDEAGVPRHITGLILDLTSQRHN
FT                   QVELRLMHAVVDHAADAVAITSSAHGRHRAIVYANPTFMDWLGMDASSYFELLGREIEE
FT                   FFCLEDQPSSDASSATISISGRNLARETLLKRRDGSTLEVDLQVFTIPGEREADLRLVW
FT                   VARDISVRKRFEAQLVEAKRIADQANEAKTRFLAGMSHEIRTPLNSVLGMTRLLMDTPL
FT                   TAEQRDLAAAIQSSGESLLELVNGVLDLSKIESGRMELEHASMSPRGVVESVLDMIAAT
FT                   AERKGLEVAARVAEDVPERVRGDAAKLRQVLVNLASNAVKFTASGSVTIDVITLGQCPL
FT                   RPGRDSVSDRPGLILSFTVRDTGVGIAPDKVSRLFDAYRQADASITRLYGGTGLGLAIS
FT                   KKLVELMGGEIEVESEPGRGSIFRFTIRVEPDSSHPVRSGLDNDRDQTQTHLPVSELMA
FT                   HLERHSNTPTSPVPVNPAERASALAPPAPSSSPPPPSLDDSFLGLGSGDPSVSDVSLHQ
FT                   ENWLTSSIWERDSESPTSTSSLLTLAIPPGRRLLIVGGHPLFQALLADQIRDWGVQVDR
FT                   IDDQLESLQAARQSESRYDVVLLDASAHAALESLRSDPQAPPLIVAASRSQADNLHRSW
FT                   SSPSAEVSAPPWVIVPKPVKPSKLARALASILADEGIDPPSKFGSAQSNSDSSSTLISL
FT                   SDSNESEERPVGFDRDFARRHPLDILLADDVATNRKLMELTLARLGYTPDSVADGAQVL
FT                   EALRQRDYDVILLDLEMPVLDGLATTQVIRREWPPESQPWLIALTARALASDRAECLAA
FT                   GMEDYLAKPLRIDELTAALARAFRARGRFRPPPRQEEDNAPASTT"
FT   gene            complement(324912..325874)
FT                   /locus_tag="Isop_0221"
FT   CDS_pept        complement(324912..325874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0221"
FT                   /product="Soluble ligand binding domain protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554; KEGG: rba:RB754
FT                   polysaccharide export protein; PFAM: Soluble ligand binding
FT                   domain; SPTR: Wza; PFAM: Polysaccharide biosynthesis/export
FT                   protein; SLBB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60818"
FT                   /db_xref="GOA:E8QWD1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD1"
FT                   /protein_id="ADV60818.1"
FT                   /translation="MDRVRSEQRGVSIASLPMCLAAATLAVGLGGCRSTGVNVSVEKIA
FT                   ASEIPREFSKVSMPAHVVEPPDILLVEVLEALPGRPISGERLVRPDGTITLGFYGDIYV
FT                   AGLTLDEVKEKIVLHLRNFLNDEVLGLYRSNPETGEPEPVKPADSDRVFVDVVAYNSKY
FT                   YYVQGDVAAPGRLPITGNETVLDAIQFAGGLLPTASPNDVRLVRPAPPGACCEQVLPVS
FT                   ITSIIYDGDPSTNYQLLPGDRVVVMRDPSVRVTAFLERVTTPINYVLNTALTGAFAIQQ
FT                   FRFLSLPIGQFAGGFGGGFNQRPQADARATLTNPTGPAN"
FT   sig_peptide     complement(325737..325874)
FT                   /locus_tag="Isop_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(326343..326600)
FT                   /locus_tag="Isop_0222"
FT   CDS_pept        complement(326343..326600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: uma:UM06005.1 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60819"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD2"
FT                   /protein_id="ADV60819.1"
FT                   /translation="MGAPAIDPLWVVAPFGGNLPTATYLWTQRQHEAQRQAYHNRYGTA
FT                   AAGGPSARPTAIPASRAFRNGAPGRFDQRGGYFDTIGGRR"
FT   gene            326732..327295
FT                   /locus_tag="Isop_0223"
FT   CDS_pept        326732..327295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0223"
FT                   /product="glyoxal or galactose oxidase"
FT                   /note="KEGG: cre:CHLREDRAFT_196816 glyoxal or galactose
FT                   oxidase; SPTR: Minus agglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60820"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD3"
FT                   /protein_id="ADV60820.1"
FT                   /translation="MQTRAGSRLRVVLPEPARLRSAQWPASTPALGSDHPALALQPPPN
FT                   AAGNGAEAARKGGPARRLLGDVVPPTPPGADAPRRQLPPLPSQPAGWTTAYGPPNSTHL
FT                   SFDPNRLDHPDPKPDPRPNPTPVTPPQPTPPPSPDDPNPCGSSIHVISADSSKHPPFLV
FT                   SPAFLHSPKQPDPMTEIDASGRPR"
FT   sig_peptide     326732..326797
FT                   /locus_tag="Isop_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            327413..327547
FT                   /locus_tag="Isop_0224"
FT   CDS_pept        327413..327547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pic:PICST_85888 transcription factor which
FT                   mediates glucose repression; SPTR: Transcription factor
FT                   which mediates glucose repression"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60821"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD4"
FT                   /protein_id="ADV60821.1"
FT                   /translation="MDRFPPFPPEISSFLDAVARVPSDPRAFEQGSDQRDDVGQPNQM"
FT   gene            327635..328618
FT                   /locus_tag="Isop_0225"
FT   CDS_pept        327635..328618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oaa:100080472 similar to Src homology 3
FT                   domain-containing guanine nucleotide exchange factor; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60822"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD5"
FT                   /protein_id="ADV60822.1"
FT                   /translation="MSVSSRTPRTRTVGVVAALIVAGLTTAQDAAAQTLLPIDRSYSRR
FT                   QRIPCELEDPVYAQYRQLYYGYHPTCWRRFPDGWGCPSPEAPNAAEAFRKLPLQEPPSI
FT                   DDLEPLEPFDFDDLGDPNAAPRSGRDRQRTPTNRGRDRSGDFNQSIDRDLNLERQPRRS
FT                   RDLEPPALPSDDMFENDRRRPQPEDPLQPGPGDQTGLPELPPLPGERPNRGTVDLVPPL
FT                   NLEGDTPKAEPPSTRPNRRPQVVSTPTQPHPLDFDLERYRRYQGGRMPVADLFPPTYRV
FT                   RDPRVIPTQASQAGSPRVETRNTVPTPEPAPVRRPGLFGGLFRRGG"
FT   sig_peptide     327635..327730
FT                   /locus_tag="Isop_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            328986..329453
FT                   /locus_tag="Isop_0226"
FT   CDS_pept        328986..329453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC1424 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60823"
FT                   /db_xref="GOA:E8QWD6"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD6"
FT                   /protein_id="ADV60823.1"
FT                   /translation="MADSSRQLKLKVILAIAGLIVLLAATWVWTAPARRTMRVFTLLLN
FT                   AANREAVEEVRQLCSERWLATHSLEVAPEGGLKNFPRNIHKNFQVWSEGDVVLVRPTNR
FT                   GRLEPVYRFVHERGDWKFDGLAGLMTADGQLVSPDSTDDHDLGHPSASGSN"
FT   sig_peptide     328986..329075
FT                   /locus_tag="Isop_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            329577..330614
FT                   /locus_tag="Isop_0227"
FT   CDS_pept        329577..330614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0227"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="COGs: COG0811 Biopolymer transport protein; InterPro
FT                   IPR002898; KEGG: plm:Plim_0746 MotA/TolQ/ExbB proton
FT                   channel; PFAM: MotA/TolQ/ExbB proton channel; SPTR:
FT                   MotA/TolQ/ExbB proton channel; PFAM: MotA/TolQ/ExbB proton
FT                   channel family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60824"
FT                   /db_xref="GOA:E8QWD7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD7"
FT                   /protein_id="ADV60824.1"
FT                   /translation="MTVAFTNAARRLNLDLFRFVRHPPPSSESASLVMVMMRCRSSSPF
FT                   RPPAPSRRGRLVGFLIPPILWLWLGVVPVALGQQPAPDPTAPPAAALGSQEGIGPEASG
FT                   TTEPSGSIPVIGPETILKLIVEANPMLWPLFFCSIFTIGVVLERAFTLARGRVLPRDFV
FT                   QRFLERLATGKLDRERALEFCRAQSSPAARIFAIAVRHWGKPGWELRQIVASDAAAEIA
FT                   ELRRRTRTLSGLATLGPLLGLLGTVWGLIESFGNLGGKVGTAKGDALAHGISLALVATA
FT                   IGLVIAVIAVTAHTYFQYRIDGLIRDLDARTRDVVDLIAGDSPRGGPGTGGLVGGSAHP
FT                   GDPRV"
FT   gene            330696..331172
FT                   /locus_tag="Isop_0228"
FT   CDS_pept        330696..331172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0228"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="COGs: COG0848 Biopolymer transport protein; InterPro
FT                   IPR003400; KEGG: psl:Psta_2466 biopolymer transport protein
FT                   ExbD/TolR; PFAM: Biopolymer transport protein ExbD/TolR;
FT                   SPTR: Biopolymer transport protein ExbD/TolR; PFAM:
FT                   Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60825"
FT                   /db_xref="GOA:E8QWD8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD8"
FT                   /protein_id="ADV60825.1"
FT                   /translation="MLYGSSPGRDSHDDTPYINMTPMVDVILCLLIFFLAATRLYDWDE
FT                   SELKVSVPEVAQAAPLSAPPSDLDLVVTGPGTVRLNDRPVNLAQLLTELRAAVARYPDQ
FT                   GVVLRGEAGLSYQEIADVLSVCEQARLVHIRLAVRPRVTLPHTSRPDSNPPPSP"
FT   sig_peptide     330696..330869
FT                   /locus_tag="Isop_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            331330..332040
FT                   /locus_tag="Isop_0229"
FT   CDS_pept        331330..332040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0229"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="COGs: COG0586 membrane-associated protein; InterPro
FT                   IPR015414; KEGG: gau:GAU_2047 hypothetical membrane
FT                   protein; PFAM: SNARE associated Golgi protein; SPTR:
FT                   Hypothetical membrane protein; PFAM: SNARE associated Golgi
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60826"
FT                   /db_xref="GOA:E8QWD9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWD9"
FT                   /protein_id="ADV60826.1"
FT                   /translation="MLEYLEPILNLLKAEYVVAAGYTLMTIVVFVETGLLIGFCLPGDS
FT                   LLVTAGLFAARGDLDITLINALLIPAAILGDTLGYWIGHHSGKRLFNRPSSLLFHPEHL
FT                   IRAQEFYLRHGGKTIIIARFIPIMRTFAPVVAGMGSMPYTRFLVYNVAGGVFWVASLTL
FT                   VGYFLGLQWPWLVKKLEYIIVFVVFLSILPMLIAGVKNWLTQRAASNRRAVAASEPSSS
FT                   ETVSVPRSAEAIES"
FT   gene            complement(332078..332839)
FT                   /locus_tag="Isop_0230"
FT   CDS_pept        complement(332078..332839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0230"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347: IPR002198; KEGG:
FT                   plm:Plim_1577 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60827"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE0"
FT                   /protein_id="ADV60827.1"
FT                   /translation="MILTDAVVLITGGRRVGAAIAHALADRGANVALTYRRSRDQAEAT
FT                   AVEVQRRGGRGLALPADLAQPDQAERAVAVTLERFGRLDILLNLVSDYERVAFDDLTAD
FT                   HLTRMVATNLNAPFYVAVAAARAIRANSPGPHGLKGKILFYGDWMTDRPEPGLLPYLTA
FT                   KGALTTLTLGLAVELAPEITVNLIQPGTVLPPPNLDEDEARRILQTTPLQRFGSPEDIV
FT                   AATLFLLEGTDFATGAILRVDGGRFLGSPAR"
FT   sig_peptide     complement(332786..332839)
FT                   /locus_tag="Isop_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(332959..333516)
FT                   /locus_tag="Isop_0231"
FT   CDS_pept        complement(332959..333516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0231"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="COGs: COG2096 conserved hypothetical protein;
FT                   InterPro IPR017858: IPR002779; KEGG: rmr:Rmar_1592
FT                   ATP/cobalamin adenosyltransferase; PFAM: cobalamin
FT                   adenosyltransferase; PRIAM: Cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; SPTR: ATP/cobalamin
FT                   adenosyltransferase; TIGRFAM: ATP/cobalamin
FT                   adenosyltransferase; PFAM: Cobalamin adenosyltransferase;
FT                   TIGRFAM: ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60828"
FT                   /db_xref="GOA:E8QWE1"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE1"
FT                   /protein_id="ADV60828.1"
FT                   /translation="MSPKIYTKTGDDGLTGLLGPGRVSKNDPRIDAYGVVDELNAQLGL
FT                   ARLHLQTSGADLDALILSLQHDLFQLGAALADPNPDGPFHHRITMDHVVRLEREIDRLD
FT                   GELTPLTQFILPGGSAGAAHLHVARTTCRRAERAVVGLLRQHGQAVAPASLIYLNRLSD
FT                   LLFTLARAVNHRLGLPDVPWEG"
FT   gene            333804..334901
FT                   /locus_tag="Isop_0232"
FT   CDS_pept        333804..334901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0232"
FT                   /product="WD40-like beta Propeller containing protein"
FT                   /note="COGs: COG0823 Periplasmic component of the Tol
FT                   biopolymer transport system; InterPro IPR011659; KEGG:
FT                   psl:Psta_4140 WD40 domain protein beta propeller; PFAM:
FT                   WD40-like beta Propeller containing protein; SPTR: WD40
FT                   domain protein beta Propeller; PFAM: WD40-like Beta
FT                   Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60829"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE2"
FT                   /protein_id="ADV60829.1"
FT                   /translation="MRSRSLWFVVAWLGLGTWGGIPTAADEVILPSPKFNPAEARHLTN
FT                   IRQVTYGFAKAGEGYFSPDGSRIIFQAAPQGKEDYQIYVAELKPDAQPKMVSTGRGKCT
FT                   CAFFHPDGQSIIFASSHLDPKLDQPAEPRAKSPAYSRDARYRWDFDEWMEIFRADLEGG
FT                   NLVRLTDAPGYDAEGSYSPDGKSIVFTSFRDGDAEIYIMDADGRNPRRITHAPGYDGGP
FT                   FFSPDGKRIIYRSDRKGNDLLQIFDNSVEGDDERQLTSNDAVNWGPYYHPDGEFFVYST
FT                   SIHGHQNYEVYMQSLKTGAMTRLTYVEGFDGLPVFSPDGRKLMWTSKGRTADNTSQLFI
FT                   ADFSLEPLPLTEKAEADEANHSTRD"
FT   sig_peptide     333804..333878
FT                   /locus_tag="Isop_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            335157..335657
FT                   /locus_tag="Isop_0233"
FT   CDS_pept        335157..335657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_3923 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF664)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60830"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE3"
FT                   /protein_id="ADV60830.1"
FT                   /translation="MTAMTAHDVLFHSMRMAERIVEAYLGDLGDEELRIPPAPGLNSIA
FT                   HQLTHLILTESRIVNAIRPGTSPDLPEGFESLAPAEGETEATRARHLSKDRLLGLLETQ
FT                   RRATRGLLESLTAADLAAPMPEPFRALCPTVGGAFNLAFTHYLLHAGQWVAVRRQAGKP
FT                   IVI"
FT   gene            complement(335700..337811)
FT                   /locus_tag="Isop_0234"
FT   CDS_pept        complement(335700..337811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0234"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000719: IPR017441: IPR008271: IPR017442: IPR
FT                   020635: IPR002290; KEGG: cya:CYA_2146 serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; SPTR:
FT                   Serine/threonine protein kinase; PFAM: Protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60831"
FT                   /db_xref="GOA:E8QWE4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE4"
FT                   /protein_id="ADV60831.1"
FT                   /translation="MSSPPSPNASGLADRTDPEASWTPPPPDPVELARMAARIGSELGA
FT                   RYQVEEFLGQGAFATVWKVLDLSTGEHLAAKRFATAVTRSSMFFRELSALFRLSHPHIV
FT                   RAVNLLELSERVRYLFLEYCAGGSLRDHLRRARQRGADPRQPCPLERVRELTLQMTLGL
FT                   AEAHGVGLIHRDLKPENVLLDPDSDTPFAGTVKLADFGLVKVWRSGGGDPPSDGVLRAL
FT                   SGSPAYMAPEQFLNQYSAASDYYALGVIVFELLHGQPPFLGSPEELARCHLNEPPPRRH
FT                   DLPDPWPDILDRLLLKHPHERGYDHTWLLERLRHAPGSHRLVPELRVTSPPSVTVVDSI
FT                   SSPTIPQPAIANTTPITTPPRASTNATRSLIRAAPPRMARCLGVAALDLVARRLDDQNV
FT                   EFLAITSCGLFRIRPDQDGPPRLTPEIGVEGATVDDNGVVWLFRGGDLLAWPPRSTHPR
FT                   LVARLDGQLRALLAPRPPQTHSFPAASSSLVPPLGVILDDGLFDLEPGPDPAIPPRLHA
FT                   WSQGPTHTDHASAWMRFDDGRLAVARDDAPDGIDVFTPNQLIPQRIPFASGLCQRLWRD
FT                   PPRNAASPPRRDSGVALIRSREDANALVRFQAAPDRDSWRLTVTVLETPAFELAAFDGI
FT                   APDPAIVTLDLDGVARRWRVDSDPSDAPTIKLDLEGRLPLALAAAAGKFAVLAREDGVD
FT                   WVYVSNPNP"
FT   gene            complement(338074..338958)
FT                   /locus_tag="Isop_0235"
FT   CDS_pept        complement(338074..338958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0235"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="InterPro IPR001478; KEGG: ote:Oter_4030 PDZ/DHR/GLGF
FT                   domain-containing protein; PFAM: PDZ/DHR/GLGF domain
FT                   protein; SMART: PDZ/DHR/GLGF domain protein; SPTR:
FT                   PDZ/DHR/GLGF domain protein; PFAM: PDZ domain (Also known
FT                   as DHR or GLGF)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60832"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE5"
FT                   /protein_id="ADV60832.1"
FT                   /translation="MPTSLCSRIAPLSLGLILSLSLGLPSHGHDEPTPNQNQAQEAKQT
FT                   FTVPFVLLGSNHMVIQTKINGKGPYWLLYDVGAPITLIGSKAGMEAGVIKNTNRPALFM
FT                   GMRGEAKVDRLEVGEAKVENLPVIVMDHPAVKALSTFFRPLQGIIGYTFFARYRSTIDY
FT                   QAKTLTLEPIANEPKNLASTIEARMTLGSSRKPLERVLNPVGAWGWTVAELEDDAPVQG
FT                   VKVASVVPGSAVAEAGVQVGDLVTSLDGRWTIDVADLYEAASRIAAPGTPVAVELLRDG
FT                   KTLRLTITPRPGL"
FT   sig_peptide     complement(338875..338958)
FT                   /locus_tag="Isop_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(338962..339942)
FT                   /locus_tag="Isop_0236"
FT   CDS_pept        complement(338962..339942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0236"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="InterPro IPR001478: IPR001969; KEGG: rlt:Rleg2_1589
FT                   membrane-associated zinc metalloprotease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein; SPTR: Membrane-associated zinc metalloprotease;
FT                   PFAM: PDZ domain (Also known as DHR or GLGF)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60833"
FT                   /db_xref="GOA:E8QWE6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE6"
FT                   /protein_id="ADV60833.1"
FT                   /translation="MTRCLPVSLVVLPRQVGWLTRTTLLATLTWLLAFQPGQAAPPAVA
FT                   PAQELLRAASNNDPKERGVGTTYQVPYRLSDTNHFLVRVRINGRGPSNFLVDTGAPIVV
FT                   VSTETAKKIGLEPSKTSFWTTINRIDFEGGPFLENLPCRIEDPYQLVGMNAMGLPGVSI
FT                   DGILGFTALARFRITMDPTTDRMIWTRLDFEPRDPFVSAGVERPREVPAELKVMEAFGP
FT                   MMKLMSVFTGKQPEEKRLERGSLGLELADPSSPLTITAVWPDSPAQAAGIQPGDRLLEI
FT                   NNQRVADFDAARRALDPIRPNSRVTLKLQRGDQTLDLELQATRGF"
FT   sig_peptide     complement(339802..339942)
FT                   /locus_tag="Isop_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(340304..341329)
FT                   /locus_tag="Isop_0237"
FT   CDS_pept        complement(340304..341329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY00560 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein PY00560; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60834"
FT                   /db_xref="GOA:E8QWE7"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE7"
FT                   /protein_id="ADV60834.1"
FT                   /translation="MRLIETMIPRFHHPLCAALLLLFWVADHPCFAVDDLSPEKFLQEY
FT                   REAVKQYQTANSIIHIEGTMSQYRTDQSGSSESRDETHIAYSLVNGRERIILEEKDLEN
FT                   QKISVGSVTVLGCDRNFSLVRNSPKEAYRIQELVIPDSKAKRSQLASPYLTFSVDTPYT
FT                   LAGLPVSLMIESSEFRFIKIERINKNGNTRVQVEFDYDRSRPGKTSRIRGWVNFDPKNK
FT                   YSVCEYNFTDTVDGANYNYQGNSIYEFDENQVSLPQEVVCVETFFQSSKEIWKKEYRFQ
FT                   AERLSTDPIPDSEFTLAAYGLGDVEQPPGAPTNTLPYWAFGFAAVALGISVVLKRMARQ
FT                   A"
FT   sig_peptide     complement(341228..341329)
FT                   /locus_tag="Isop_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(341458..341763)
FT                   /locus_tag="Isop_0238"
FT   CDS_pept        complement(341458..341763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sna:Snas_2029 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60835"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE8"
FT                   /protein_id="ADV60835.1"
FT                   /translation="MRSQFCQLTSALFASLGLVAMAVGLLAFASTALADDPIDPTPVPL
FT                   RCDGCPPNGTNGARNGVGSGKCKSIGNAYCVKNGAATPCFNCKCERDLTTGDCECK"
FT   sig_peptide     complement(341662..341763)
FT                   /locus_tag="Isop_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(342281..342613)
FT                   /locus_tag="Isop_0239"
FT   CDS_pept        complement(342281..342613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: der:Dere_GG18161 GG18161 gene product from
FT                   transcript GG18161-RA; SPTR: GG18161"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60836"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWE9"
FT                   /protein_id="ADV60836.1"
FT                   /translation="MRNDHKPNWRTPPKQPGGRHNANAHQPPGERHAITQDDAPTVVSS
FT                   GTTIVPRVSFSFCPNSDPLASRARPDPLVSANFWAQSRHESLNRSPFLERPLNADLNHS
FT                   RASDNF"
FT   gene            342644..344938
FT                   /locus_tag="Isop_0240"
FT   CDS_pept        342644..344938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0240"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG2304 Uncharacterized protein containing a
FT                   von Willebrand factor type A (vWA) domain; InterPro
FT                   IPR002035: IPR013694: IPR006587; KEGG: psl:Psta_0406 von
FT                   Willebrand factor type A; PFAM: von Willebrand factor type
FT                   A; Vault protein inter-alpha-trypsin domain-containing
FT                   protein; SMART: von Willebrand factor type A; Vault protein
FT                   inter-alpha-trypsin, metazoa; SPTR: Inter-alpha-trypsin
FT                   inhibitor family heavy chain-related protein-hypothetical
FT                   secreted or membrane-associated; PFAM: Vault protein
FT                   inter-alpha-trypsin; von Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60837"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF0"
FT                   /protein_id="ADV60837.1"
FT                   /translation="MSAMSLPSPQTPRLAWFAALGGLFLVAPSALGQILIDRRPGVPIR
FT                   QGFEVREIRIEAKIVDQAAEVRLTQTFHNPTSMTLEAQYLFPVPENAAIRNLVLMVDGK
FT                   ELVGKLMPRDEARRVYEGIVRSKKDPALLEYTGRGLIQTSVFPIPPGADRTITLKYSTL
FT                   LPRTFGAVDFTFPFGGRGFTSKPIGKLRIEVDLRTTNDLKTIHSPSHDVAIDRKGNRDA
FT                   MVTFQRESFLPDQDFRLLFNEGEGALGAMVLSHPPTANEDGTLLLLASPTIETTPNKTP
FT                   PAKTVVLILDRSGSMSGKKIEQARAAMKFVVENLNQDDLFNLILYDDTVEMFKPELLRC
FT                   NAENRAEALRFIEGVRPGGSTDIDQGLRAGLKLIADESRPNYVIFLTDGLPTSGETNEL
FT                   KIAEAARAANPLKAKLFVFGVGYDVNARLLDRLSGENGGVSFYVKPDDNLEVAVSRFYE
FT                   RISTPALTDITVTFEGVEINRAMPRQLPDLFRGGQLVYVARYRKGGQARLILTGKVEEQ
FT                   INRYEFPIELAQEGSNVANSFVETLWATRRIGAILDQIDLKGKNDELINELVELSKRHG
FT                   ILTPYTSYLAEEEVSIQDRVALRSRATRNLEALNVTQGTFGVAQRRAKGTYLQADRVPA
FT                   PVDLPPLAGIEVQSAATAGRIVGGERGAVAVPPAARGGRDRTPGEVVRRLGGKTFFFKQ
FT                   GRWIDAEVTEEDLKATAKQQIIQRFDDTYFALADQLRGDQTAWLTLDGPITLKFAGRIY
FT                   LIEASQENDAP"
FT   sig_peptide     342644..342739
FT                   /locus_tag="Isop_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            345200..346336
FT                   /locus_tag="Isop_0241"
FT   CDS_pept        345200..346336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_3727 b-glycosidase, CBM9 module,
FT                   glycoside hydrolase family 8 protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   (DUF1083)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60838"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF1"
FT                   /protein_id="ADV60838.1"
FT                   /translation="MTTNRLSLIAPTWARFLTCALLATASQRTVAAVINDPPVLWPSQA
FT                   RAVATRLAKPLRIDGDLRDWPCSTFRIPLNHAHSQRLDQRAAQVGWAWDDQALYLSLRA
FT                   LDTHRVSFKGAQPTWPLEACDGLELRLDTRSGAALGRPDWSEGTLRLALAPFLKGRTGP
FT                   VWIVHPIDRFEQVQLRGVECAVVTHDWGYELEFKLPWVNLAGFQPRVGSLIGLEVVLVS
FT                   CDSASRSQRAFALGSSANERGTPDTLGVVLLVEELDPDRFDQIGSVAFPLTVRTFDQDE
FT                   ERHHSEVEAVVGIPPSWGLLIAEVEVRQHAADGSIAGVTPARLESFGPEGLEFRRAVAR
FT                   WSETREAAVKNSTVTARLVSPTGKTIATIAPQRRDDAH"
FT   sig_peptide     345200..345295
FT                   /locus_tag="Isop_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            346541..348907
FT                   /locus_tag="Isop_0242"
FT   CDS_pept        346541..348907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_0217 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60839"
FT                   /db_xref="GOA:E8QWF2"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF2"
FT                   /protein_id="ADV60839.1"
FT                   /translation="MTTDLPPTPASRACTVFSKSDRELARRTHRGGTWRSRGRRAWRGL
FT                   TWALIMMATLGVVGALAALAALPSYLATQAGRDYLLEQANAVLEPGRLEVDRFDFAWFG
FT                   PTHFEGFRLVDHEGRVVLDTPKADWDRTLFHLVFSSDRDRLGTLDLGSAAWTLVRDDQG
FT                   RVSLTTLLEPVIINGGHRELTIQTTQGSLRVSDPRLPADWVVPSWDALIHLPPQPAPVE
FT                   FDVAFRAQASKAADTLASGPGCLTVRGQFDRETSHLIGESHLNRWPIALEESSNPLGVR
FT                   LEAAASADLSHTAQTIAGRLGLTVVEWGWPGQPLWEIGTGWETVALSAGVAYHFDDDRL
FT                   DLNELRIDSALGRILAQGRIDKPLADQLSLEIQGRARADWQRVVEHFGPEGIEVTLEGD
FT                   DLLFALEHAAVDRDGVDPPDDNEPETKANAARASQTTGTSQTTGTSVRFRLPNLKLTSN
FT                   SVALGPLDLAGLVRPDLRMLTLEPIAGLLNGGRLVIKPEIVADADGMGWAIQLREGSRI
FT                   EGAAIDDVIARRALAYVAPVLADATRVEGKIDLEIDEARLHVRLRPPGAMAVAVEAVAD
FT                   PPLVVGNPNVGQGPREGEAIAPLGPLELGPNLAAWVEAPRFEGRVRFREVVFSPGPFVE
FT                   RLTDLLGVTKVLRIQLDVPVHVAIDHHAVRHTGLVVSIGPQIQIEIAGSVGFNQELDLT
FT                   ARLPVTPRMMGSNPLVNEVLGGLTIDVPIGGTLRQPTIDHQAFGRALAELGKDVGGRAA
FT                   VRGTLELLRILRDRQRQPDRGSTPPRRRRWPSRRR"
FT   gene            349200..349406
FT                   /locus_tag="Isop_0243"
FT   CDS_pept        349200..349406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfi:NFIA_102750 hypothetical protein; SPTR:
FT                   Predicted protein; PFAM: Lipoprotein Rz1 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60840"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF3"
FT                   /protein_id="ADV60840.1"
FT                   /translation="MMKLQGFLVALMAALFVVGCGGSEPAKPTPPAPAETPKPADQPPA
FT                   ETPAPAETPAPAETPAPEANTQG"
FT   sig_peptide     349200..349301
FT                   /locus_tag="Isop_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            349729..351366
FT                   /locus_tag="Isop_0244"
FT   CDS_pept        349729..351366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0244"
FT                   /product="protein of unknown function DUF1571"
FT                   /note="InterPro IPR011465; KEGG: cre:CHLREDRAFT_10029
FT                   fibrocystin-L-like protein; PFAM: protein of unknown
FT                   function DUF1571; SPTR: Plus agglutinin; PFAM: Protein of
FT                   unknown function (DUF1571)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60841"
FT                   /db_xref="InterPro:IPR011465"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF4"
FT                   /protein_id="ADV60841.1"
FT                   /translation="MVRGWLQVEDDDRLGWVIAVDRGGSVCENAGVIWRPIVPREDVRS
FT                   WIVGGESATMIGRALVLGTTWSFLLFDAGCVASRTRWLNDLPTPIDSREIAGDSRVRAA
FT                   GESQTTPSSLLGADQRASVIGRDDALALTARRPDSGLSPPPPDELPPPPLPPGRLLAEG
FT                   PLPIDLPASEEPVLPAPVAPTDSSSSSSGSDLAVTPAGLEAQPPRSDPMQPATPRLAAP
FT                   SPRPSEMPPIPLKTPLQPAPPASPAPQPGQAVPSNTTQPGSLNNNATQATPEAIILRAR
FT                   QVLESIRNYQVTMVRQERVGGQLQEPERLVLSRRREDPVSVRLEWVEGPYKGREVIHSP
FT                   VLWQGKLHVRMPNNKLMPRMAISPDNPMVTRASRHPIQEAGIEGVLDSMLATLEARRRG
FT                   EAVGSLRLEGITELGGRRLINVRRDDPNGEVWVVGFDERTGLPLAIEGRDRDGNLLERY
FT                   QFFDPRFDLAELSKPEAFDPDARWGVPPRGTLASLLSGLGGREPTEEDLKAIITSPSDP
FT                   NAPPPDVPNPDDEPPPIPNPDDDPPGLS"
FT   gene            351585..352055
FT                   /locus_tag="Isop_0245"
FT   CDS_pept        351585..352055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0245"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: psl:Psta_0568 response regulator
FT                   receiver protein; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver; SPTR: Response regulator-like
FT                   protein; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60842"
FT                   /db_xref="GOA:E8QWF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF5"
FT                   /protein_id="ADV60842.1"
FT                   /translation="MIATCSHTLLITADDPDARELLREILEPIGFRTWLAESGEQAIDI
FT                   IRSTDIHLCLMEFHLPRLSGLEAARISRDIKADLPTILLTGEPDATLLRRALEARIYCV
FT                   LPTPPTRDLVVYHVHRALRKVPPPRWNPSALPPPTDPPVPGSVTIPNGWRQP"
FT   gene            352052..353638
FT                   /locus_tag="Isop_0246"
FT   CDS_pept        352052..353638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0246"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2215 ABC-type uncharacterized transport
FT                   system permease component; KEGG: cai:Caci_3988
FT                   high-affinity nickel-transporter; SPTR: High-affinity
FT                   nickel-transporter; PFAM: High-affinity nickel-transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60843"
FT                   /db_xref="GOA:E8QWF6"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF6"
FT                   /protein_id="ADV60843.1"
FT                   /translation="MKGTVAPLGALAWWLGLGWGGGWMDSSPARGHDIPAARVDRSTQA
FT                   ILEPGRLILLYEVSLAELTLTQDLRGLIGTLPGGGRNDWFQRYGEVIGPLNARGFLVKV
FT                   DRRIVPLRVVSFLLTVEDHPRYVFRFEADLPVSGRLLIHDTNYLASEGLSQMALQATPG
FT                   VIYREEGPPESVGAIPERSPALLNDEGDRASRRLEVHYQTIPPTRVASHATNDVPSVPP
FT                   TERAIAGTALSQAKPPCLERPEPASAKSAAAPKPLIAKESLSQLLEGPRRGWGLAGLLA
FT                   IALVLGAAHAFQPGHGKTLVAAVTLGRGGGLGHGLALAGSATVSHMLGVLAIALILGLT
FT                   RTQRYDAINSAIVWSSGLVLAVIGGWRLGRHLAGHDEHRQRFGVQDSRRERMAISRDGS
FT                   RSPRRLGWRSTIALGFVGGVTPCWDAVLLVVMAEALGRLTLGLALLAAFSLGMGGLLTG
FT                   VALVMGWLRDRFVAAQTHPSQAVLLASDRATPSRRFEFELTNAGWERRLGLTSAIILLV
FT                   LGIGLCRASGV"
FT   sig_peptide     352052..352144
FT                   /locus_tag="Isop_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            353866..354561
FT                   /locus_tag="Isop_0247"
FT   CDS_pept        353866..354561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0247"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="InterPro IPR010496; KEGG: rmr:Rmar_1742 protein of
FT                   unknown function DUF1080; PFAM: protein of unknown function
FT                   DUF1080; SPTR: Putative uncharacterized protein; PFAM:
FT                   Domain of Unknown Function (DUF1080)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60844"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF7"
FT                   /protein_id="ADV60844.1"
FT                   /translation="MCFSLSLRCSTRLALTAVCLIGLTGMNAVSSDDDGFVSLFDGKSL
FT                   EGWQRYDGSTPGTQWVVEDGALHLKGGGGGDLATVEQYGDFILELEWKVAPGSNSGIIY
FT                   RARPGDPAPYMSGPEYQILDDSRHNDGRNPKTSAASFYALVAPEGKRLKPVGEWNTARL
FT                   VVQGTKVEHWVNGQKVVELDISSDEFKSMVAKSKFKAWPQFAQSAKGHIVLQDHGDPVW
FT                   YRNIRIKSL"
FT   sig_peptide     353866..353958
FT                   /locus_tag="Isop_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            354736..355176
FT                   /locus_tag="Isop_0248"
FT   CDS_pept        354736..355176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: srm:SRM_01011 conserved hypothetical protein,
FT                   secreted; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60845"
FT                   /db_xref="InterPro:IPR032347"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF8"
FT                   /protein_id="ADV60845.1"
FT                   /translation="MAANHSSESPTLRVSGPDPSLSPRDVVAIQLDALRHNDQPYHDAG
FT                   IETVFRFASEGNQRSTGPLRRFAGLVRNPLYAPLLYHRRADLGETYTLGDEVAWMNVRV
FT                   IDDNEQSHIYEFMLSRDPNTSCWRTDSVLPTLPDGFEFKAES"
FT   gene            complement(355313..355816)
FT                   /locus_tag="Isop_0249"
FT   CDS_pept        complement(355313..355816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0249"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; InterPro IPR002569; KEGG: nmu:Nmul_A2452
FT                   methionine sulfoxide reductase A; PFAM: Methionine
FT                   sulfoxide reductase A; PRIAM: Peptide-methionine
FT                   (S)-S-oxide reductase; SPTR: Peptide methionine sulfoxide
FT                   reductase msrA; TIGRFAM: peptide methionine sulfoxide
FT                   reductase; PFAM: Peptide methionine sulfoxide reductase;
FT                   TIGRFAM: methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60846"
FT                   /db_xref="GOA:E8QWF9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWF9"
FT                   /protein_id="ADV60846.1"
FT                   /translation="MTTTTQPAATVTERVLFGAGCFWGVEAAFRRIPGVLDAVCGYAGG
FT                   HVDHPTYRQVCTDTTGHAEVVEVVFDPTVVSFDQLLDAFFQMHNPTTRNRQGPDVGSQY
FT                   RSAIYTTTEAQLAQAHASKAKWEASGRFRGPIVTEIAPAGPFWKAEEYHQRYFEKHGGG
FT                   SCHV"
FT   sig_peptide     complement(355736..355816)
FT                   /locus_tag="Isop_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(355987..357363)
FT                   /locus_tag="Isop_0250"
FT   CDS_pept        complement(355987..357363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cag:Cagg_0419 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2088)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60847"
FT                   /db_xref="GOA:E8QWG0"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG0"
FT                   /protein_id="ADV60847.1"
FT                   /translation="MPCCSLSDHVSLPRRHDSPAPDLTPAMMPLPPVARIRQATRHPAL
FT                   NDPTGELARVLRASRLSERLPRGASVALTVGSRGIHGLPQLVTAAVTTLKEMGFAPFVV
FT                   AAMGSHGGGTAEGQRALLAQLGVTESTIGCPIRAEMETLELGRNRFGLPIYFDRHAYNA
FT                   DGIIVFNRIKPHTSFTGTHESGLLKMLAVGLGKRQGAAQVHQLGLPGLKVLIPEVGAFL
FT                   IEHAPVALGVAVLENADDRVAQIVALEPEAIVAQEPALLERAREMMARLPFDQLDVLIV
FT                   GELGKNYSGTGMDPNVIGRQRIETMPDLPRPVITRIVTLGLSVETHGNALGVGLADLIT
FT                   RRLAEAIDPTPMRVNSLTTNFLTRARVPIDLPTDRDAIQAGLDTCWKLDPAEVRLALIP
FT                   NTLELSTLWISPALADDADRLPGLSRETDFTPLPWTSADPDRLDLARLFPESLIARRKT
FT                   "
FT   gene            complement(357484..358380)
FT                   /locus_tag="Isop_0251"
FT   CDS_pept        complement(357484..358380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0251"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013424; KEGG: bja:blr0478 hypothetical
FT                   protein; SPTR: Conserved repeat domain protein; TIGRFAM:
FT                   PEP-CTERM putative exosortase interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60848"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG1"
FT                   /protein_id="ADV60848.1"
FT                   /translation="MFNTRYSALGAAFALAVASPVALADEMPAAIDPAADTIPDPMIET
FT                   TAITPSELPAGVRSLDTTMLISGTTDWATFRSLFSPVSTTPGTPGAAISGVSRFARTGI
FT                   DTTIVSQVYKKNDEDLYAYTFQLQGESQNPRNMPTIRGIGNYFNAQPVANDDLFGGSHV
FT                   VKISGPIEDSDSPFYKTPTIDNLADASFSFERFGSSEDDASFAVLTSNFRLPEAGTLNT
FT                   PVVALFSTVAPEETATVDVNGPEFYRGVEGRDLPEIWNPQAHNIQPPIPEPATLLGWAG
FT                   VLGAAALVRMHRRRRAA"
FT   sig_peptide     complement(358309..358380)
FT                   /locus_tag="Isop_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            359207..359605
FT                   /locus_tag="Isop_0252"
FT   CDS_pept        359207..359605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0252"
FT                   /product="RbsD or FucU transport"
FT                   /note="COGs: COG1869 ABC-type ribose transport system
FT                   auxiliary component; InterPro IPR007721; KEGG:
FT                   gct:GC56T3_3248 RbsD or FucU transport; PFAM: RbsD or FucU
FT                   transport; SPTR: Putative uncharacterized protein; PFAM:
FT                   RbsD / FucU transport protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60849"
FT                   /db_xref="GOA:E8QWG2"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG2"
FT                   /protein_id="ADV60849.1"
FT                   /translation="MKKRGILNPAICSLLAELGHQDELLIVDASFSLPTDAHVIDLSLI
FT                   PNLPRFLDVFKAIAEELVIESVVVAHEIHDANPRLFHEIRRVIEPGVELEEVPHRELVE
FT                   QAEDAKGIIRTGEFTPYANIRIVCGSAF"
FT   gene            complement(359757..360452)
FT                   /locus_tag="Isop_0253"
FT   CDS_pept        complement(359757..360452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dia:Dtpsy_3135 primosomal protein N'; SPTR:
FT                   Putative DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60850"
FT                   /db_xref="GOA:E8QWG3"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG3"
FT                   /protein_id="ADV60850.1"
FT                   /translation="MLDPTSNHDSPSNMANLPHSNNGMPVNAISNPPCPPGTALARREF
FT                   PSTPIDPEPLEPAFNPQAIAELEQDLFPHTPEPRPWVSARWIDSLVLLLAIVALIPKWG
FT                   WNGLVLTNLGLGQEQMLILLGSPMGLGGILAIGPYWLWRSGAWGAALENAFWRKDLNHK
FT                   ALFLLPYFAMPVGVMAALLVGRLLWDRVPLEAAGRSHARLLRLGWAAAIFGSLALLTYR
FT                   PIPGPLFIF"
FT   sig_peptide     complement(360330..360452)
FT                   /locus_tag="Isop_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(360621..360878)
FT                   /locus_tag="Isop_0254"
FT   CDS_pept        complement(360621..360878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0254"
FT                   /product="dispersed gene family protein 1 (DGF-1)"
FT                   /note="KEGG: tcr:510625.10 dispersed gene family protein 1
FT                   (DGF-1); SPTR: Dispersed gene family protein 1 (DGF-1),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60851"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG4"
FT                   /protein_id="ADV60851.1"
FT                   /translation="MNPRDKKRFREEKRRLKQLGNQRARRSFKALLRDHPEEASHVTQP
FT                   DHGRYATSHLNGRDRDATRRPQAIPTQPTLASEEEADETA"
FT   gene            complement(361029..362072)
FT                   /locus_tag="Isop_0255"
FT   CDS_pept        complement(361029..362072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0255"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COGs: COG2267 Lysophospholipase; InterPro IPR000073;
FT                   KEGG: rba:RB10853 lysophospholipase; PFAM: alpha/beta
FT                   hydrolase fold; SPTR: Probable lysophospholipase; PFAM:
FT                   Putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60852"
FT                   /db_xref="GOA:E8QWG5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG5"
FT                   /protein_id="ADV60852.1"
FT                   /translation="MAREFPDQDGGKGAHWDAAGGFDPRAEAEAQAMAIAHAQAEADRI
FT                   AFERVEPRPMVQLASDTYSLRGLVWSPPDGFETYGRVVVLHGIQSHAEWYLDLGRTLAA
FT                   LGLEAHFPDRRGSGANVENRGDTPNAQRLIDDVVERLEALREREPEAPVGLVGISWGGK
FT                   LAAVVAGERPDLVDALALICPGLVPRVSPGLWTRLGIALALAIRPRTTFPIPLSDPELF
FT                   TANPPAIEYIANDHLALRRATARLMLASRTLDRRVRRLVKQIRTPTLLMLAGQDRIIDN
FT                   ARTLDFLRALPSGDRTVIDYPDAHHTLEFEPDPYRYSVDLAEWLLDRFARISGRRRRPP
FT                   PLELLGQ"
FT   gene            complement(362077..363513)
FT                   /locus_tag="Isop_0256"
FT   CDS_pept        complement(362077..363513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0256"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR013342; KEGG: rba:RB10855 muconate
FT                   cycloisomerase I; PFAM: Mandelate racemase/muconate
FT                   lactonizing protein; SPTR: Muconate cycloisomerase I; PFAM:
FT                   Mandelate racemase / muconate lactonizing enzyme,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60853"
FT                   /db_xref="GOA:E8QWG6"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG6"
FT                   /protein_id="ADV60853.1"
FT                   /translation="MKATSGVEDPQVRRARGPARVPQKGQDTQIGVARPVRTLELVEPT
FT                   VTIPAPDPLREITLGGCACVQIWVEGGVSSQGVVSSRRRGRGTMKVVGLEWRRVRVPLR
FT                   KVVKHASHARAESENLIVSARLDSGAVGHGEGIPRPYVTGETLETAFEMLRGWDLDRQL
FT                   GAPSSFEEAVDRLANLETPARAADPRGAFGNAARCALEMALLEAFARGFDRSIGEALVR
FT                   MAPPEAGLRLNPTTVRYSGAITAEGVWAERIAAWKMRLYGFHQVKVKVGVVGQNDPERL
FT                   RRFRRILGKTCDLRIDANEAWDVSQVEERAQALVPFGPTALEQPVPHAQVEVLAQLRPR
FT                   LGIPVMLDESLCGWGDAVKAVELGLTDLFNVRLSKCGGIGPSLALIGLAKRSGLGVQLG
FT                   CHPGETGLLSAAGRQVATRIADLRYLEGSYDRHVLAANPIRQDITFGYGGRAEPLEGPG
FT                   WGVDLDSETLERMTLDRESW"
FT   gene            363565..364128
FT                   /locus_tag="Isop_0257"
FT   CDS_pept        363565..364128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0257"
FT                   /product="translation elongation factor P"
FT                   /note="COGs: COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A);
FT                   InterProIPR020599: IPR011768: IPR013185: IPR001059: IPR
FT                   015365; KEGG: aca:ACP_2876 translation elongation factor P;
FT                   PFAM: Elongation factor P; Elongation factor P/YeiP
FT                   protein; Elongation factor KOW-like domain-containing
FT                   protein; SPTR: Elongation factor P; TIGRFAM: translation
FT                   elongation factor P; PFAM: Elongation factor P, C-terminal;
FT                   Elongation factor P (EF-P) KOW-like domain; Elongation
FT                   factor P (EF-P) OB domain; TIGRFAM: translation elongation
FT                   factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60854"
FT                   /db_xref="GOA:E8QWG7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG7"
FT                   /protein_id="ADV60854.1"
FT                   /translation="MKIKATDIRRGMVITMNGVNFVVVDFAHHTPGNLRAMVQTKLRNM
FT                   NTGAIIEERLRSVDQIEVPFVETVTYEYLYSSGDEHVFMNVETFDQISFGPDMVGSAMP
FT                   YLLPNTRVGVMFIDGKAVSIDVPASVEMTITECPPSIKGATATNQYKEGVTETGLKVMV
FT                   PPFIEPGERIKIDTRTGEYIERVK"
FT   gene            complement(364312..367308)
FT                   /locus_tag="Isop_0258"
FT   CDS_pept        complement(364312..367308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0258"
FT                   /product="Cna B domain protein"
FT                   /note="InterPro IPR008454; KEGG: rca:Rcas_2197 hypothetical
FT                   protein; PFAM: Cna B domain protein; SPTR: Conserved repeat
FT                   domain; PFAM: Cna protein B-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60855"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG8"
FT                   /protein_id="ADV60855.1"
FT                   /translation="MEFLAPGGITLPNNSGERLRDDHTKREQRRVERANRPRVEPLESR
FT                   RLLAVNFTGDVIADFPADDPNVRVLGPFAEGTPFFTRPLLSETLEPLVGISGFELEGLR
FT                   LAYDRVTDVLAIGFQQPLNPLLNDGTRVIAGDADNNGNGGTVNPIILTLVDDPDNFIDF
FT                   ARLGGTETMGVKFDLNLDGQFEIIAGIPQRNSGDPDFVNKTPRVALNPGGTRQGFVFGQ
FT                   ELPGFTGLASDFFIGETPQNPAFQFQIRNFTQLVTQVTGQAPVNELSFRIFGFAGSSND
FT                   GPISEAALPDQLVTFPLVDPARISGLVFVDNDGDLVLDPNSRLLPNVTLTLTGTNNLGQ
FT                   TITPIVTTTNAQGFYEFTNLLPGIYTVTQTQPPDLIDLGVVVGSLGGIGGVNVISNIVV
FT                   ASGDNGTRYDFVEIEPTGISGIVFVDVNENNVFDAGDQLLPNVTLTLTGTNVLDVPIQQ
FT                   VTTTNAQGFYEFTNLLPGTYTVTQTQPPGFLDGGVIVGNRGGTPGVNVISNIPLQANLP
FT                   GINYDFFELLVRPGSISGLVFVDNDGDRILDPNSRLLPNVTVTLTGVTNTGQPIAPIVT
FT                   TTNAQGFYEFTNLEPGTYTVTQTQPPGLLDLGVNVGSLGGVPGVNVISNIVVGRGDAGT
FT                   RYDFVEIEPTGISGIVFVDVNNNGLFDNGDQLLPNVTLTLTGADLFNRPVTQVTTTNAQ
FT                   GFYEFTNLLAGTYTVTQTQPPGFLDGGVIVGNRGGTPGVNVISNVPLQANLPGINYDFF
FT                   ELLPTPPQVPLRPPVFINHHDQHHINTFHRGLIRVNIFGGPDLDVRDIDPESVLLGGAS
FT                   PTWMLIHHVNRDGFLDLLLVYRSDEVDLPRGPQMVTVAGELYDGRTFATATRVYNQPIF
FT                   HTNDLRVVPPQPIFLVRDVVAGRVNPVIGRQQPASASVVTEAQRRLDRVMSTPLRGQAA
FT                   TQQRANRSTLVVRTPVAVTAQPRVTPMTVSPTWARAQEDPEARLRPATTPASSLVRPLS
FT                   RPIVPRLLG"
FT   gene            complement(368014..370824)
FT                   /locus_tag="Isop_0259"
FT   CDS_pept        complement(368014..370824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_4998 Na-Ca exchanger/integrin-beta4;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60856"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWG9"
FT                   /protein_id="ADV60856.1"
FT                   /translation="MVLSGLDAFGFRAELRLLDPDWTADGLEMEVTQDAARGTEGVVFR
FT                   AEGSDERDVAIRLEGRDDLGRVRFLSNPADRLIAFGSLQPLNPSELGPDQTLRLDDLPY
FT                   EFVIQVADRSQPGVSDAPEKQATVVFRGLLDAELSRGGMTVSARSETLASQIAVVNGTT
FT                   LLLEFDSLQSPLGVPNRIDGGVWSYTPGSFLARVRPAPDPLGIEPDKVSFAESLIKVGE
FT                   AAETIVVRLARQGDRLGTTTVAYSASPVGSSTIPPGDLAGLAGRLTFQAGQAEAWLSLP
FT                   VPRSQDDGLLLTNALDLTIDPAVEGGELGEISRLRIELDGAVTPTASANAMSSHPQPPT
FT                   SEPQPTTTPAVAAVEPTPTATSPAPPSRFSSPSREVAKALMNTDDPIRSGSRSDNPRNP
FT                   APNHGRTLSTTTLESSDSEPNHGGPPAETLSNSPQASPTSSASKSNGPHSVGQASSLVG
FT                   GGARFGRNGSTIPPAAVSASHRTLVGGSRAGRPTPTPPTRPTAPSNPVIPSDPPEAVRS
FT                   ASAGAARMIDWSRVASPIVVTTTADQGPGSLRDALEQANRHPGPDVIRFRIPTVTASVA
FT                   VIQPTRPLPEINDPVMLDGVSQARFVAARQSAEAAQTQTQSESERGARRVSPATGSRPA
FT                   NAGAWLQARRAQAERQAAPLYPTGPELSEIGVELRGDRLAERPDQEDVAGLVLNSGGNV
FT                   IRGIAVTGFPSHGIVIRGAGGNRVETSLVGVDPLTLTARGNGGDGVRIVDSPDNRIGGD
FT                   ESSQGNWIAGNQGAGLTLLGAATTGNQVLRNVVGLDPNRTPLGTQTARNLGNQRDGLVI
FT                   AGGAGGNRIESNALVGNAPGAEGPPRGADLRVTARDEEGWIMPHNRINPNSVILNWIGI
FT                   DIAGSHLESSRPVDALVDQPELVEGRNYLRTDSPQNDSPSDNSNPDLPHDAATMIPGAS
FT                   RVDVRV"
FT   gene            371319..371963
FT                   /locus_tag="Isop_0260"
FT   CDS_pept        371319..371963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0260"
FT                   /product="Helix-hairpin-helix DNA-binding class 1"
FT                   /note="COGs: COG1555 DNA uptake protein and related
FT                   DNA-binding protein; InterPro IPR003583; KEGG:
FT                   plm:Plim_2967 helix-hairpin-helix DNA-binding class 1;
FT                   SMART: Helix-hairpin-helix DNA-binding class 1; SPTR:
FT                   Helix-hairpin-helix DNA-binding class 1; TIGRFAM:
FT                   competence protein ComEA helix-hairpin-helix repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60857"
FT                   /db_xref="GOA:E8QWH0"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWH0"
FT                   /protein_id="ADV60857.1"
FT                   /translation="MIDESIDRATDGVTAAAPWRGKASPTWFEESGGLARRERLTVTIL
FT                   AGLCLGGLAISWARGLWQEALVGGTESAVTVGRDQASSKSSFAWERDERTVFREEGEPL
FT                   QPRLGLATLDSGGRDAAKAEHKEESPPETAINRLDLNQANAIELQGLPGIGPVLAQRIL
FT                   AERVRGPFQSLEDLAERVRGIGPRTVERLRPWIVCSPSRPATAQVNGEARP"
FT   gene            372838..375609
FT                   /locus_tag="Isop_0261"
FT   CDS_pept        372838..375609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0261"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR019734: IPR000719: IPR013026: IPR017442: IPR
FT                   001440: IPR020635: IPR002290; KEGG: mno:Mnod_2431 peptidase
FT                   C14 caspase catalytic subunit P20; PFAM:
FT                   Serine/threonine-protein kinase-like domain;
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; Tetratricopeptide repeat; SPTR: TPR
FT                   domain protein; PFAM: Protein kinase domain;
FT                   Tetratricopeptide repeat; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60858"
FT                   /db_xref="GOA:E8QWH1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8QWH1"
FT                   /protein_id="ADV60858.1"
FT                   /translation="MSMSMTSSTTTVSPSLDALALARTETLPEGVLLCGKYRVIRKLAQ
FT                   GAVAGIWLVRHELLKVERALKRIPAPLALEDRVRGRLERQARIMSRLDHPAAVAVQDCG
FT                   VSDGAPYLEMEAVRGRALEDEFATTTFTAADFAPLLEQLCDLLDQAHGRGIVHRDLKAS
FT                   KILRLRDRRVGRDLKVLGFGMASLVEDPSLGANDPLFIGTPAYASPEQILRGVTAAQGE
FT                   SIDSLPTLDARCDIYSLGVILYKALSGVSPYRGNLNSILFQKLNKPVPRFDEATRAQLP
FT                   TGIEELVLACLSKDPRQRPASAHEVWETFQAALNRSSIAPVTVPLPGEADAPTSALPAA
FT                   SPKSTTALEAASASVVPEDSNHPPNSSPTPAGSPAGSSHTLGGSETETPDSTTAAIAPS
FT                   GIPEDSPGYSLPDAARLLGVPVDHLRAQVEKGLLTAVKRGDQWRVPNQELERRLLIGAE
FT                   LDPALMNDPEFLDIEERLQREPDRPRHVLRRGDLFLKHRAYEQAIADYSRAIRLDPREP
FT                   EGFRKRALAYRLMGDFEQAIRDGSTLIELSPRDPTAYLQRGYSYHQIGDYDRAIADYSK
FT                   AIRLDPGETSGYFNRGLALRARGMELEAIQDYTSVLEIDPKDVSALVNRGFTYRLRGEF
FT                   EKAIRDYDEAIRLAPDHALAHLNRGYAFSAQGDHERAIADFTRSIELEPRNPAAYYNRG
FT                   FAWTCLGQFARSIPDFTQAIALDPEDGSAYANRAFALHSLGAVAQAIEDYTQALQRLGR
FT                   DASTYYNRGVAHRDRGDHRAAIDDFAEALRIQPSDVAAAVNLAVCRQAVGDLERALADL
FT                   NEAIRLDPDEAEIYLIRGRLHLQRGDPTQAAADFAAALKLNPDLPSALRLRGLALFKLG
FT                   KRLTALLDLSRSLLARRSVPPLRRRLRRARLRLPEGGGPHPLDQDTRRNRME"
FT   sig_peptide     372838..372897
FT                   /locus_tag="Isop_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(375720..378623)
FT                   /locus_tag="Isop_0262"
FT   CDS_pept        complement(375720..378623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phe:Phep_2409 heparinase II/III family
FT                   protein; SPTR: Heparinase II/III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60859"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX26"
FT                   /protein_id="ADV60859.1"
FT                   /translation="MISPRGPLGLARFLLFFVAVWCGWVGSNGLHAQPAEWIEPFDSFA
FT                   LSEAEVERFWNSPEGRVFDRLTPQALADLVPTQGGFRGCACPACRAGERQEPLTWNPEI
FT                   PDRLTCRSCGRVFPNDTVPAKVDGRVPEEVVQLPSVPGTFHRYPYHRWFDEATGQTIRL
FT                   YFQALIDDSTSRYLTTAALHGAFRGVRRPEHPQASAGARKAAVLLARFAEVVPQYVPRL
FT                   DLPDQPKLFGPTAGIGGFGRWRGRAWEEIPEELIFAYALLRHHPVWTDRSLFRVDPRPS
FT                   ILSWFQSCAEVAGAAIDAQPDHAETLRVVRGELALARLLGSASREASAQARLVRFFEQG
FT                   FSRDGLWREGTLLGQQRVLEACRGWLSQPDRGGWDWRALEIPNQARALSVAEWLSAAAC
FT                   WSWSPANANPDAIRPAGLEDRQFSSSFERMVHADRRSLTLRDGRGLDRSINVRGPRVLG
FT                   GSGWARLEAGDGSERLTLDLRGVAGGPTASTRLALRVFVGGEAVLGDLDDLPARGDGFE
FT                   RSVWSHTTVVIDRTPHGEIAARSAGPPQPSDLAFFAADPDFQVVGMTDRWAYRDREGVL
FT                   TQVLLITRPVGGGPPYGLILAAALGGTTHHQLIQAAPGRRAAWRATPAPHEPINPRDPA
FT                   RALLKPNILFLEDQAAQTGRWFIQGAGHWSQPRRVAIASGTFQLVCPPDDMRGGLRWFG
FT                   LNDGPIDLIAAHVPDGLDLARRRPAWAVARSRENSPSTPPNGSTKAADHSTPPFLSRFA
FT                   AVVEPIPADSNSHRPGLRRAGRVEQPGWKTEDPRTPLVVVVETGAGEEHLILNATPFEP
FT                   IEVVLADGSTVRTDGLAARVCPAELRLAGGTFLIWNRGWTRQVVELPHWEGRLTAIQRT
FT                   TDSPRPLAGTGEGRFVIAETWPRPQQLSGRTLIVRDAVGHTQGWTIESARPLAEGGTEI
FT                   LTREPPDPRLADALLRGNAPTPHARVAALERVALPHP"
FT   sig_peptide     complement(378528..378623)
FT                   /locus_tag="Isop_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(378746..379168)
FT                   /locus_tag="Isop_0263"
FT   CDS_pept        complement(378746..379168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbr:Tb11.01.4480 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60860"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX27"
FT                   /protein_id="ADV60860.1"
FT                   /translation="MNTTTVPPHSMSAIPTVRVVDETFRFEYPPLCSVPDCGRLALYKA
FT                   GATWSDGSQRELKHYGLACRLHRDDLMARAAASRRALRVSEGEYVGPVVLRRLVAGLRD
FT                   AELPIAEEDDPLDLNPAPPKTTRDLDQAEREGDSKT"
FT   gene            379456..380343
FT                   /locus_tag="Isop_0264"
FT   CDS_pept        379456..380343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0264"
FT                   /product="alanine racemase domain protein"
FT                   /note="COGs: COG0325 enzyme with a TIM-barrel fold;
FT                   InterPro IPR011078: IPR001608; KEGG: psl:Psta_1019 alanine
FT                   racemase domain protein; PFAM: alanine racemase domain
FT                   protein; SPTR: Alanine racemase domain protein; PFAM:
FT                   Alanine racemase, N-terminal domain; TIGRFAM: pyridoxal
FT                   phosphate enzyme, YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60861"
FT                   /db_xref="GOA:E8QX28"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX28"
FT                   /protein_id="ADV60861.1"
FT                   /translation="MTQATAATTPPPRDALDPAGSAASTSVVVWDRDRLQSVFGTLPLD
FT                   LERLRANVAMVRGKIAEAESRAGRPAGSARLVAVTKYWPAEWLAPLAALGADTFGENHP
FT                   QAVWSKVPALASWRGPDGEILTIHWHLIGHLQSNKARRTLPMVEMIHGVDSLKLLKTLD
FT                   QLAANVGTATTTSHPLARVCLQVNLSGEASKHGWSAEGLMADAQEIAALRSISIVGLMT
FT                   MAALGTDTRTARPTFEALRELRDRFAQASGLTLPELSMGMSNDYEAAVEAGSTLVRIGS
FT                   ALIEGVALQAPPSV"
FT   gene            380411..380806
FT                   /locus_tag="Isop_0265"
FT   CDS_pept        380411..380806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0265"
FT                   /product="protein of unknown function DUF167"
FT                   /note="COGs: COG1872 conserved hypothetical protein;
FT                   InterPro IPR003746; KEGG: scl:sce8156 hypothetical protein;
FT                   PFAM: protein of unknown function DUF167; SPTR: UPF0235
FT                   protein DehlyDRAFT_1349; PFAM: Uncharacterised ACR, YggU
FT                   family COG1872; TIGRFAM: conserved hypothetical protein
FT                   TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60862"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX29"
FT                   /protein_id="ADV60862.1"
FT                   /translation="MSHSSHRAPGTDNSPPEGEDVIEATSDRAGGTLLAVMARPRSRRP
FT                   GVVGTWCGAVVVAIAAAPEKGKANAAILEILADLLGIAKSRLDLVSGATARSKVVRIAG
FT                   LEPDQVRQAISDHLKRFTLNDQGRLWE"
FT   gene            complement(380851..382386)
FT                   /locus_tag="Isop_0266"
FT   CDS_pept        complement(380851..382386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0266"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="COGs: COG0606 ATPase with chaperone activity;
FT                   InterPro IPR004482: IPR001208: IPR000523: IPR003593; KEGG:
FT                   plm:Plim_0159 Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; SMART: AAA ATPase; SPTR: Mg
FT                   chelatase, subunit ChlI; TIGRFAM: Mg chelatase, subunit
FT                   ChlI; PFAM: Magnesium chelatase, subunit ChlI; TIGRFAM: Mg
FT                   chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60863"
FT                   /db_xref="GOA:E8QX30"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX30"
FT                   /protein_id="ADV60863.1"
FT                   /translation="MLSKITSYTLVGIDAAAVEVEVDVSPSAQSKVILVGLAETAVKES
FT                   TYRVERALTNSGYYLPGDRVVINLAPADLRKDAGGFDLPIALGVLAGSGQVALERPGRY
FT                   AVVGELGLDGSTRPIKGALAMALEAARAGMDGLLVPLANANEAAVVDGIEVYPIGSLPQ
FT                   AVGFLSGHLDMEPTHVDLTETYLAHAKTEEDFSDVKGQEYAKRALLIAASGGHNVLMIG
FT                   PPGTGKTLLAKRLGTIMPPLTPAESLETTRIYSAMGLLKPGQALMATRPFRSPHHSISD
FT                   AGLVGGGGVPQPGEISLAHKGVLFLDELPEFNRKTLEVMRQPLEDGQVTISRALRATTF
FT                   PADFILVAAMNPCPCGYRTDPRRRCSCSPPQVEKYLSKISGPLLDRIDLHVEVPAVPFT
FT                   QLSEAPPGPTSAQIAQKVMAARQRQAERFRNGGLVVNGRMTPRQVRKFCQLKPESASLL
FT                   KGAMEELGLSARAHDKVLRVARTIADLEASDDIQPHHVAEAVGYRTLDRGVWA"
FT   gene            382899..385247
FT                   /locus_tag="Isop_0267"
FT   CDS_pept        382899..385247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0267"
FT                   /product="flagellar P-ring protein"
FT                   /note="COGs: COG1706 Flagellar basal-body P-ring protein;
FT                   InterPro IPR001782; KEGG: plm:Plim_1168 flagellar P-ring
FT                   protein; PFAM: flagellar P-ring protein; SPTR: Flagellar
FT                   P-ring protein; PFAM: Flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60864"
FT                   /db_xref="GOA:E8QX31"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX31"
FT                   /protein_id="ADV60864.1"
FT                   /translation="MRRRGPAWWRGKRLPAPALVAGLTIAWELGGVPRLDAVAVAVAVA
FT                   DDNGSTTSKVTLRTEQTVGDLAYIANLSDLRVEGVGLVIGLDGTGSDVPPSLYRTALLN
FT                   EMRKARVENPEAILASSATAAVVVRMKLPTGATRDESYDVEVEAVPGSATTSLAGGRLL
FT                   RAELKQVMMTEQGQAEGKVQAYASGAILADEKTPRKGVIPGGGRSKTTLPYTILIKEAF
FT                   RSGKTAALLQGAINTRFQQRNGRDDRGVALAKSDRHLELILPRIYRNNPERFFQVVKLV
FT                   PLVTSEAIVRKRIDTWGADLIAPETSGLAALRLEALGAAGRETLKKGLASPSPTARFFA
FT                   AEALAYLGDDSGVDVLAEAAVVRPEFRSQALRALASMDQAPALLRLRKLMGHSDPALRY
FT                   GAFDALRRADPFDPSLGRVAVFDAPAEQPWEEDEVSQEDSPRWAMDLQRPRRPTRPQDP
FT                   FALHVVDCEGPPLIHVSRTHRAEIVLFGRGQMLETPMVLNCGPNILINAADGDTQAQIS
FT                   RIVPGAAERRTLSSLDVATVIRTLAQFGATYPEITSTLDQARHRQNLAATLVFDAQPTK
FT                   TADYDRALMSAALPPERQFRETAGTAVGSGPASRLDEGVTQAGAEAPTSRRPWYARLNP
FT                   LAWLRRARTSDPIAQASARSKDTNPPNETPPPAKLDDQVSRAGLERVEGVTSSQTTVLR
FT                   NEEREPADNERDASAKPARRWRLWPFNRRRAVEKELDDAAAAAASAEATVRRGWLSRWL
FT                   GWGRGRSDSAASESPSESLPPDKSEPQAN"
FT   sig_peptide     382899..383033
FT                   /locus_tag="Isop_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(385509..385895)
FT                   /locus_tag="Isop_0268"
FT   CDS_pept        complement(385509..385895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0051 hypothetical protein; SPTR:
FT                   Lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60865"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX32"
FT                   /protein_id="ADV60865.1"
FT                   /translation="MNRIDSAVSYSSRDVKNREVRATVPGQNDLEVNRFSGPDDRNRSK
FT                   GGVRRAGLTIGVGLLLTPIVATLRTRPSGLIFDPLRPGTLNFKTVEPGPPPGSIRSVNP
FT                   ASADKADGVVGIILSEDGKWEGSP"
FT   gene            386243..386818
FT                   /locus_tag="Isop_0269"
FT   CDS_pept        386243..386818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0269"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR001789: IPR010093; KEGG: psl:Psta_3012
FT                   response regulator receiver protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver protein; TIGRFAM: DNA
FT                   binding domain protein, excisionase family; PFAM: Response
FT                   regulator receiver domain; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60866"
FT                   /db_xref="GOA:E8QX33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX33"
FT                   /protein_id="ADV60866.1"
FT                   /translation="MKKVFTTGQVAKICKVAPRTVSKWFDSGRLRGYRIPGSQDRRIPR
FT                   EHLLRFLKEHGMPLGELEAEVYHKVLLVGAEPDLVKDLQNHLRESDNFKVESASSGFEA
FT                   GIRAESFHPDCIVIDLAVGRIEAAQIAHNLRKSEDHLSTILVALTSDEPTPELTEWGFN
FT                   DAFKKPFDGALLAERLRRLITTKKAEEL"
FT   sig_peptide     386243..386311
FT                   /locus_tag="Isop_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            387190..387714
FT                   /locus_tag="Isop_0270"
FT   CDS_pept        387190..387714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0270"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="COGs: COG0315 Molybdenum cofactor biosynthesis
FT                   enzyme; InterPro IPR002820; KEGG: mbt:JTY_3390 molybdenum
FT                   cofactor biosynthesis protein MoaC; PFAM: molybdopterin
FT                   cofactor biosynthesis protein MoaC; SPTR: Molybdenum
FT                   cofactor biosynthesis protein C 3 moaC3; TIGRFAM:
FT                   molybdenum cofactor biosynthesis protein C; manually
FT                   curated; PFAM: MoaC family; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60867"
FT                   /db_xref="GOA:E8QX34"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX34"
FT                   /protein_id="ADV60867.1"
FT                   /translation="MASPLTHFDERGASRMVDVTAKPITLRMARAAGCLRMAPETLRVI
FT                   LDRRAAKGDVLEVARLAGILAAKRTDELIPLCHSLGLEAVELSFHPCDDQRLRIEARVT
FT                   TQGRTGVEMEALTAVSIAALTVYDMVKAIDRSLVIESIRLEEKTGGRSGRFLHPEAQSH
FT                   PSDGIDTNPDS"
FT   sig_peptide     387190..387282
FT                   /locus_tag="Isop_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            387770..388810
FT                   /locus_tag="Isop_0271"
FT   CDS_pept        387770..388810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0271"
FT                   /product="Polyprenyl synthetase"
FT                   /note="COGs: COG0142 Geranylgeranyl pyrophosphate synthase;
FT                   InterPro IPR000092; KEGG: plm:Plim_0149
FT                   trans-hexaprenyltranstransferase; PFAM: Polyprenyl
FT                   synthetase; SPTR: Trans-hexaprenyltranstransferase; PFAM:
FT                   Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60868"
FT                   /db_xref="GOA:E8QX35"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX35"
FT                   /protein_id="ADV60868.1"
FT                   /translation="MLNGGVADVTGTGTMSASTMLGQGPRIADFLAPIASELAEAERIF
FT                   AQELGSRHPFVQQLVDHCSAFRGKRLRPALVLLCGQAVGRLTPDHPVLAAVVEMIHTAT
FT                   LVHDDILDESLVRRHAATINAEWGNETAVLLGDYLFTHAFHLAASLESTLACRWIGRAT
FT                   NLVCEGEMNQVHHRGDLDLDESTYLDIIQGKTAELIAVSCKLGAHYAGADVETTERLER
FT                   FGRDLGSAFQIADDVLDLWGEERVAGKSLGTDLFKQKLTLPVIRLLNVAPLEVRREVHG
FT                   LLNQPGPETRRRLRDHLNAYKTLDYSWTIAGRFVESSLEALAILPPSQARTLLEAMARS
FT                   VLRRDR"
FT   gene            complement(388961..390406)
FT                   /locus_tag="Isop_0272"
FT   CDS_pept        complement(388961..390406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0272"
FT                   /product="C-terminal processing peptidase-3"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR001478: IPR004447: IPR005151; KEGG: plm:Plim_2514
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Carboxyl-terminal
FT                   protease; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   Peptidase family S41; PDZ domain (Also known as DHR or
FT                   GLGF); TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60869"
FT                   /db_xref="GOA:E8QX36"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX36"
FT                   /protein_id="ADV60869.1"
FT                   /translation="MTSKRRGVAARIGASLAILALVGGLWATPAVWSGFAHAQADDEDE
FT                   IRELYGLFVEALEQAQANYVRPVSRKELIEEALRGMCRKLDQNSTYFNAGESNQFRRSI
FT                   EGSFGGIGIQVGTDTASGRLKVIAPMAGTPAQKAGILAGDLILGVDDRSTDGLSTDQVI
FT                   ELLQGRPGTEVKLKVLHVNAREPVEVICTRSIIDVPSVLGDRRRPDGSWEYWLDPEHKI
FT                   GYIRLTAFVPRTAADLKEALDTLKSQEVKGLILDLRDNPGGLLSAAVEVSDLFLDQGVI
FT                   VSTRGRNVEERTFKATASESDFLDIPMVVLINQYSASASEILSACLQDHGRAQVVGQRS
FT                   FGKGSVQNVIELSDGVSVLKLTVATYWRPSGKNIHRFEDAKETDEWGVFPDPDCEIKYN
FT                   EVEHRRWALARRLRDLDILQPEVGREDQAEANLNTDGQPKPKPVEEAANDRPPTDNADD
FT                   PAAFEDRQLNKALELLRAKLSKP"
FT   sig_peptide     complement(390293..390406)
FT                   /locus_tag="Isop_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            390781..392937
FT                   /locus_tag="Isop_0273"
FT   CDS_pept        390781..392937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0273"
FT                   /product="Nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="COGs: COG0243 Anaerobic dehydrogenase typically
FT                   selenocysteine-containing; InterPro IPR006655: IPR006963:
FT                   IPR006656: IPR006657; KEGG: hau:Haur_4673 molybdopterin
FT                   oxidoreductase; PFAM: molydopterin dinucleotide-binding
FT                   region; molybdopterin oxidoreductase Fe4S4 region;
FT                   molybdopterin oxidoreductase; PRIAM: Nitrate reductase;
FT                   SPTR: Molybdopterin oxidoreductase; PFAM: Molybdopterin
FT                   oxidoreductase; Molydopterin dinucleotide binding domain;
FT                   Molybdopterin oxidoreductase Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60870"
FT                   /db_xref="GOA:E8QX37"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX37"
FT                   /protein_id="ADV60870.1"
FT                   /translation="MSPSDQPAIPRNGLATASAHHVRKVVKAVCPLDCPDTCGMVVTIE
FT                   RGKAIDLRGDKDHPFTRGFLCRKMARYLDRVYSPQRLTQPLKRVGSKGESRFEPIGWDE
FT                   ALDTIAQAMREAISSPEGPQSILPYSYCGTMGKIQSSGLDRRFFHRIGASLLDRTICAT
FT                   AGTVGYQYTMGSPRHGADPLAVTGCRLILNWGSNTASTNSHLWSLMIQARKTQGALIVT
FT                   IDPHRSETAARSDLHLPIRPGTDAALALGLAHVIFREGLEDRAFLEKAAHGVADFRTRA
FT                   LEEFPPERVAAITGLEVAAIEDLARRYAATHPSLIRLNYGLQRHRGGGMAVRTVACLPV
FT                   LVGAWKYPGGGALLSTSNSFGWNDAALERPDLIPPGTRTVNMNQLAEALLGELPGPPVK
FT                   VLYVYNSNPAAVAPDQSRVHRGLARDDLFTVVHDLFLTDTADFADLVLPATSQLEHHDI
FT                   HGAYGHHFVMYNAPAIAPVGESKSNSEVFRLLAQRLGLESELFPDDETLIREVLNGGPA
FT                   LQGITLERLKETYSIRLNLPSPFVPFADGAFPTPSGKCELRSETMARDGYDSLPTYIPP
FT                   REDPQTRPDLAARFPLQLITPPHPQFLNSTFANEEHHLKLAGPQVVELAAADAQTRGIA
FT                   DGDRVAVFNDRGQFEAFARVGDTVRPGVAVAFGIHWNKQVQGGRNVNFITSTALTDMGG
FT                   GATFFDNLVEIRKLADNPGSEAGT"
FT   sig_peptide     390781..390864
FT                   /locus_tag="Isop_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            392934..393707
FT                   /locus_tag="Isop_0274"
FT   CDS_pept        392934..393707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0274"
FT                   /product="Protein of unknown function DUF2064"
FT                   /note="COGs: COG3222 conserved hypothetical protein;
FT                   InterPro IPR018641; KEGG: gsu:GSU0485 hypothetical protein;
FT                   PFAM: Protein of unknown function DUF2064; SPTR: Putative
FT                   uncharacterized protein; PFAM: Uncharacterized protein
FT                   conserved in bacteria (DUF2064)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60871"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX38"
FT                   /protein_id="ADV60871.1"
FT                   /translation="MSDSPSSPRPSSAPSPWPPTAEDGVLAVFAKRPDPGAVKTRLADV
FT                   VGANEAAALAEAMLLDLTELWSDPRLWPLEARKVVVFDPPDAGPWFDQRLGPDWALQPQ
FT                   EPGDLGRRMRGFLEAEFAEGRRRILLIGSDAPHLEPSWVVTAFMTLAHRDLVIGPAADG
FT                   GYVLLGARDRVPPIFDQIDWGSQQVLNQTLDHLETAEGRTFSLGLLPVGFDVDRVEEAV
FT                   ALRGLLRGLRRAGADHRLLRVEAWLERMQIAANMG"
FT   gene            393807..394655
FT                   /locus_tag="Isop_0275"
FT   CDS_pept        393807..394655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0275"
FT                   /product="purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /EC_number="2.4.2.1"
FT                   /note="COGs: COG0005 Purine nucleoside phosphorylase;
FT                   InterPro IPR011268: IPR011270: IPR000845; KEGG:
FT                   psl:Psta_3240 purine nucleoside phosphorylase I, inosine
FT                   and guanosine-specific; PFAM: purine or other phosphorylase
FT                   family 1; SPTR: Purine nucleoside phosphorylase I, inosine
FT                   and guanosine-specific; TIGRFAM: purine nucleoside
FT                   phosphorylase I, inosine and guanosine-specific; inosine
FT                   guanosine and xanthosine phosphorylase family; PFAM:
FT                   Phosphorylase superfamily; TIGRFAM: purine nucleoside
FT                   phosphorylase I, inosine and guanosine-specific; inosine
FT                   guanosine and xanthosine phosphorylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60872"
FT                   /db_xref="GOA:E8QX39"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX39"
FT                   /protein_id="ADV60872.1"
FT                   /translation="MQRHEWEHVQEALARVRSEAPEARPRVGIVLGTGLGGLVEEIRIE
FT                   TTIPYTEIPYFPRPTVEGHAGRFLLGTLGGVPVAAMEGRYHLYEGYNAAQVAFPIRVIA
FT                   ALGAELLIVSNASGGMNPTYDKGDLVVIDDHINLMGANPLIGPNDDRLGPRYPDMSRPY
FT                   DPALIKLAMEEALKLGIAVKRGVYVGVVGPNLETRAEYRFLRLIGADVVGMSTIPEVLT
FT                   AIHAGLRVLGFSIVTDLCLPDALEPVEIADILATANRAEGKLRRLVLAILARLDQPAPR
FT                   N"
FT   gene            complement(394693..397476)
FT                   /locus_tag="Isop_0276"
FT   CDS_pept        complement(394693..397476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0276"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="COGs: COG0474 Cation transport ATPase;
FT                   InterProIPR001757: IPR000695: IPR018303: IPR004014: IPR
FT                   008250: IPR005834: IPR006068; KEGG: sat:SYN_00872
FT                   calcium-transporting ATPase; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   Calcium-transporting ATPase; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; Cation transporting ATPase, C-terminus; Cation
FT                   transporter/ATPase, N-terminus; haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: plasma-membrane calcium-translocating
FT                   P-type ATPase; ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; potassium and/or sodium efflux
FT                   P-type ATPase, fungal-type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60873"
FT                   /db_xref="GOA:E8QX40"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX40"
FT                   /protein_id="ADV60873.1"
FT                   /translation="MTTETTTRPDRVGIQLESQDPASTPIAWHTLELDEVCRRLETDPE
FT                   RGLSEEEALRRRERYGPNALTPRAGTPWWMALLLQFHQPLVYILLVATVVSALLGEWID
FT                   AAVILGVVLVNAVVGFVQESKAAEAIDALARTMVAEATVIRGGRPRKVSATELVPGDLV
FT                   RLASGDQVPADLRLVRIRDLRIAEAALTGESVPIEKRQGILEANTPLGDRVNLAFASSL
FT                   VTFGSGSGLVVATGDHTEVGRISQLMSSAEDLATPLTREIARFSRWLMVVILGLAGIAF
FT                   VIGLIRGDSAADTFHASVALAVAAIPEGLPAAVTIVLAIGVWRMAKRHAIIRKLPAVEA
FT                   LGSTSVICSDKTGTLTENRMAVVQLKAGDRFYKVEGEGGSAQGAIRPVQDPDEGESSSH
FT                   DVDPLPPRVIDCLTIGLLCNDSHLVRHADGRLDAQGDPTETALLVAAAKAGLFAEDLQE
FT                   RLPRVDSLPFESEFQYMATLHDQGPGRPRLVLVKGSVEQVTDRCDGIDRDAIQDQAAHM
FT                   ALQGQRVLAFARKELPPDRHHLTHEDLRDGLEFVGLQGMIDPPRPEAIQAVADCLRAGI
FT                   QVKMITGDHAATASAIAGQLGLQGTSGEDGRLRALTGAQLAQLEGEALADAADRVAVFA
FT                   RVTPEQKLRLVQALQSLGRIVAMTGDGVNDAPALKQADIGVAMGLAGTDVAKDAADMIL
FT                   TDDNFASIAAAVEEGRGVFENLTKFIAWTLPTNVGEGLVILAALLIGAVLPILPVQILW
FT                   INMTTAVLLGMTLTFEPKEPDLMSRPPRDPKSSFLDASLLRRIVIVGVVMLIGAFGLFK
FT                   WEILRTGDEVRARTVAVNVFVFVEIFYLFASRTLRRPLWKVPFFSNHWLLVGVVVMVAL
FT                   QLLLTYTAPFQTAFHTGPIDLTDWIAILLVSAIALMLVELEKTFTRYWEAAARPHP"
FT   gene            397819..399393
FT                   /locus_tag="Isop_0277"
FT   CDS_pept        397819..399393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0277"
FT                   /product="N-acyl-D-glutamate deacylase"
FT                   /EC_number="3.5.1.82"
FT                   /note="COGs: COG3653 N-acyl-D-aspartate/D-glutamate
FT                   deacylase; InterPro IPR013108: IPR012855; KEGG:
FT                   sro:Sros_1552 N-acyl-D-glutamate deacylase; PFAM:
FT                   D-aminoacylase domain protein; Amidohydrolase 3; PRIAM:
FT                   N-acyl-D-glutamate deacylase; SPTR: N-acyl-D-glutamate
FT                   deacylase; PFAM: D-aminoacylase, C-terminal region;
FT                   Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60874"
FT                   /db_xref="GOA:E8QX41"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX41"
FT                   /protein_id="ADV60874.1"
FT                   /translation="MFDVILKGGWVIDGAGGPPFRADVGLLDFMIAAVGRLDEATAPLM
FT                   LDVSERYVAPGFIDAHVHGDLSLLADPHGVGLAALKQGITTFVIGQDGTSVAPGRPETI
FT                   AFLRRYAAGFNGDPASVPTTWESVADYLARFDRSTPLNVAYLIPNGNLRLDAIGHDPRP
FT                   AGDEDLAAMVRAVREGMEAGAVGVSSGLDYLPSKYADARELAALAREAARFDGIYVTHM
FT                   RGYGHLAARGVAEVVEIARRSGAACHISHYNGPAELLLPLIDSARASGLDLTFDTYPYE
FT                   AGSTILSMVALPEESQAGGIEATLERLADPTHRDDLRRTWFSPENATRRTFPLEGIRLA
FT                   MVDHPDWCWAEGLTLADAAAQAGLDLADLVCELLVVTQLAVGTVVFAGDRAEADIRAIL
FT                   RHPAHMAGSDGIYLGGRPHPRGFGAFARYLGRHTRTLGDYSWGEAVVHLASHAARRHRL
FT                   TDRGLLRPGYAADIVVFDPHAVNDRADYADGKRLAEGVDHVFVNGILALHDGRPTGATP
FT                   GRALRRG"
FT   gene            399521..402043
FT                   /locus_tag="Isop_0278"
FT   CDS_pept        399521..402043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0278"
FT                   /product="Acetyl xylan esterase"
FT                   /note="InterPro IPR000834: IPR008391; KEGG: psl:Psta_2878
FT                   hypothetical protein; PFAM: Acetyl xylan esterase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Acetyl xylan
FT                   esterase (AXE1)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60875"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX42"
FT                   /protein_id="ADV60875.1"
FT                   /translation="MTLPPSIRVVLALLLWMTVALAGSGTLAPASVTIAGHRWVDDAGR
FT                   PRAVVLNPDEMRRLARPASIRVLVPQGRVWNRIPPQDDRPGRIILRPSGSFDARAPLVW
FT                   ITAGRLEAGSDAVEIVLDVDGTPQSSWDVPLDVLLATEGNGSNALTDEGLRRFIERTRG
FT                   RRDATATDDARRAQVRTNQQGIDFDPPDQAHAWKTRADEVRERLWVTLGLTPGFDKGPL
FT                   RPKVFGRFERDGYTIEKVWIETLPGHFLGGNLYRPLTPLPEGRKRPGLLSPHGHYAEGR
FT                   MHPDAQARCVQWARMGATVFLYDMVGYHDSKPFGHSFADERLIPYGLGLAGLQTWNSIR
FT                   ALEFLQSLPDVDPARIGCTGESGGGTQTFLLTAVEPRVAAAAPVVMVSEGFQGGCVCEN
FT                   TPGLRIGTDNVEIAALAAPRPLKLVAATGDWTSNTMTRVLPPLQRVYSLWGVPDHVSAS
FT                   LFDFGHNYNRTSREAVYPFLGEFLGLPGWDRSRPQAEPPFTPEEAATLRVTRDADAHQP
FT                   EHPDDLPSISDNVAPSELATTMIAQVQRRLEAIGPLSDPAVWTQGGRATWGAIHRVRVN
FT                   AAPPEAARIAVQSLGSTQGGEAVVVEHLDLRLKPFRGDQGRVVPTVLWSRADAAAPGSS
FT                   RRVAVVVSSYGKAALVEPNGQASALTEALLAAGFDVAGFDPLLIGESFDPGKPTARRPD
FT                   TVHFATYNPSLVGDRLGDLALVVGWLRSRDQTRSISLVGLGDGGGAWTLLALPNLGPIA
FT                   RAWVDLGEQGDDAIDLPGLLQFGGLAGASALCAETPLTIARPAAQFRRDWPRAARLAQF
FT                   GAVGELEFVEEAPQIDALVQRLDDGSSL"
FT   sig_peptide     399521..399610
FT                   /locus_tag="Isop_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            402087..402560
FT                   /locus_tag="Isop_0279"
FT   CDS_pept        402087..402560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5618 ATP-dependent transcription
FT                   regulator LuxR; SPTR: ATP-dependent transcriptional
FT                   regulator, MalT-like, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60876"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX43"
FT                   /protein_id="ADV60876.1"
FT                   /translation="MRDTPIVPRHLGKNRMNEHQFRALLDWFARVSALGDALGSESTDS
FT                   GVVLITAAESVGEAVRTLLPRDWSTHPLAWRRFEAEFLGPLLAGPQTPPHLAQAARTFL
FT                   TSCDPLEPEGLLVGPPEFDPGAPDRGGFHVGLFLHARPQTGWNLLILFPRVET"
FT   gene            complement(402666..403319)
FT                   /locus_tag="Isop_0280"
FT   CDS_pept        complement(402666..403319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0280"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: pvi:Cvib_1640 beta-lactamase
FT                   domain-containing protein; SPTR: Beta-lactamase domain
FT                   protein; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60877"
FT                   /db_xref="GOA:E8QX44"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX44"
FT                   /protein_id="ADV60877.1"
FT                   /translation="MPARFEILRMGPDKNLAYLFGDETTGEYAAVDPGFEPDKHLHAVQ
FT                   ALGGRIVLILATHSHRDHIAGLDDLKRATGAPLAAHPDFPGVDRPLADGETFQVGSIPC
FT                   HAWHHPGHCADSILIEIENRKLIVGDELFIGGVGRTHNEAQARVHYDSLHRRLLTLPDH
FT                   LELHPGHDYGATPTSTLGEQRQSNPYLLQPDFDSFWWLRQNWKTYCQQHGIRWG"
FT   gene            complement(403303..404169)
FT                   /locus_tag="Isop_0281"
FT   CDS_pept        complement(403303..404169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0281"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="InterPro IPR011444: IPR010869; KEGG: psl:Psta_3333
FT                   protein of unknown function DUF1501; PFAM: protein of
FT                   unknown function DUF1501; protein of unknown function
FT                   DUF1549; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1501); Protein of unknown
FT                   function (DUF1549)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60878"
FT                   /db_xref="GOA:E8QX45"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX45"
FT                   /protein_id="ADV60878.1"
FT                   /translation="MNDPTPEADAYAALVDRLLASPRYAERQARHWLDLVRYSESDGYR
FT                   QDADRPHVWRYRNYAALHPDQTELEARIRSYELAFRMQAEAPEAVDLSNETEETKALYG
FT                   MDDPVTTPFGRTCLLARRLVERGVRFIQLYHGAGSRWDSHAQIEKNHAERCREMDKPVA
FT                   GLLEDLKRRGLLESTLVVWGGEFGRTPQSEKGDGRDHNPYGFTMWMAGGGVPGGQVVGS
FT                   TDEIGLHAVEDRLHVHDLHATILRLMGLDHTKLIYLHKGRPERPTVNEGEIAQAFLPPE
FT                   FRHARTL"
FT   gene            complement(404250..404516)
FT                   /locus_tag="Isop_0282"
FT   CDS_pept        complement(404250..404516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0282"
FT                   /product="Zn-dependent hydrolase, glyoxylase family"
FT                   /note="KEGG: min:Minf_1147 Zn-dependent hydrolase,
FT                   glyoxylase family; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60879"
FT                   /db_xref="GOA:E8QX46"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX46"
FT                   /protein_id="ADV60879.1"
FT                   /translation="MADLDQKVPENRPGRFYVDLTCIDCDFCRETAPRHFARHRPGRYS
FT                   FVQRQPMTPEEEARCREALEGCPVEAIGDDGVPAVETVGVEPS"
FT   gene            complement(404685..405689)
FT                   /locus_tag="Isop_0283"
FT   CDS_pept        complement(404685..405689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0283"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COGs: COG0059 Ketol-acid reductoisomerase; InterPro
FT                   IPR013023: IPR013116: IPR000506; KEGG: psl:Psta_4689
FT                   ketol-acid reductoisomerase; PFAM: Acetohydroxy acid
FT                   isomeroreductase catalytic domain-containing protein;
FT                   acetohydroxy acid isomeroreductase; PRIAM: Ketol-acid
FT                   reductoisomerase; SPTR: Ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase, catalytic domain; TIGRFAM:
FT                   ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60880"
FT                   /db_xref="GOA:E8QX47"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX47"
FT                   /protein_id="ADV60880.1"
FT                   /translation="MPAVMYYDQDADLGLLKDKTIAIIGYGSQGHAQALNLRDSGLKVV
FT                   VGQRPGSANYEAAVKDGFQPVSAAEAAQAGDLINLLLPDEVQGDIYERDVKPHLKPGNL
FT                   LLCSHGFNIHFGQVVPPPGVDCALVAPKGPGHLVRSEFVKGGGVPCLIATTETTTPAGK
FT                   AQALAYAKGIGGTRGGVLQTTFAEETETDLFGEQVVLCGGVSALVKMGFETLVEAGYQP
FT                   ESAYFECMHELKLIVDLLYQGGLNYMRYSISNTAEYGDYTRGPRIITEQTRVEMRKILH
FT                   EIQSGQFAKEWILENKANRPTFNAIKRRERQHPIEEVGKRLRSLMTWIDAKTV"
FT   gene            complement(405979..406554)
FT                   /locus_tag="Isop_0284"
FT   CDS_pept        complement(405979..406554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0284"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0440 Acetolactate synthase small
FT                   (regulatory) subunit; InterPro IPR004789: IPR002912:
FT                   IPR019455; KEGG: psl:Psta_4688 acetolactate synthase, small
FT                   subunit; PFAM: Acetolactate synthase, small subunit-like;
FT                   amino acid-binding ACT domain protein; SPTR: Acetolactate
FT                   synthase, small subunit; TIGRFAM: acetolactate synthase,
FT                   small subunit; PFAM: Small subunit of acetolactate
FT                   synthase; ACT domain; TIGRFAM: acetolactate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60881"
FT                   /db_xref="GOA:E8QX48"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX48"
FT                   /protein_id="ADV60881.1"
FT                   /translation="MSDGLQDTGWRRHVLSALVMNQPGVLSHVAGMLASRGFNIDSLAV
FT                   GETETPELSRMTFVVVGDDRHLEQVRKQLEKIVTVVKVLDISKEEFVERDLMLIKVRAT
FT                   PEQRSEIRGLADDFRARVVDVGPSLMMLEVSGTAKKVEAFIELMRPYGIAELARTGRIA
FT                   LVRDSVRPVDRATLPPEPGGVVVGHSSL"
FT   gene            406981..407466
FT                   /locus_tag="Isop_0285"
FT   CDS_pept        406981..407466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0285"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR017504; KEGG: rba:RB4470 signal peptide;
FT                   SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   Planctomycetes uncharacterized domain TIGR03067"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60882"
FT                   /db_xref="InterPro:IPR017504"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX49"
FT                   /protein_id="ADV60882.1"
FT                   /translation="MASRGVLSWGMVGLLSIHVGWASPVRIDDHGRDHETELARMVGVW
FT                   TVTSWEAEGNKLPAASIEDARMTIRKDGSFSVRLGGANLRGTIRFDPSSKPAKFDATTI
FT                   DESGEESSFEGIYKIELKEGFIVWTVCVGAPGGGRPVEFVSEADAGTSLMIFRKPLE"
FT   sig_peptide     406981..407046
FT                   /locus_tag="Isop_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(407761..409158)
FT                   /locus_tag="Isop_0286"
FT   CDS_pept        complement(407761..409158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0286"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829; KEGG: rrs:RoseRS_0128 peptidase
FT                   C14, caspase catalytic subunit P20; SPTR: Peptidase C14,
FT                   caspase catalytic subunit p20"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60883"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX50"
FT                   /protein_id="ADV60883.1"
FT                   /translation="MPTLLIDGNSPPRPRSLWDAALVWTVGLLLVGTSAEGTRGQELPA
FT                   PRIVPGPSRPANPATDAPTTPPNAPLAQGERTTLSGDDEPIDFDSSNLTTEQIEELEKE
FT                   VLPNARAIVDPRARARALEKVGALLTYVGRYDEAYDALIEAGQAALRVDTSRERDLRLE
FT                   RIIRNLMALTAELLREAVPDLAPIPIAEDEETSKVDRLQIIDLILKIGEEASTLIKAMT
FT                   SPIYRNEGRLLIAEELSNRAREMFSPLNLGPERRPDLADDLDALIERGDRIIQLAFDIA
FT                   LQTEWPLFRDNAKLEVVRNAARSERFTLAFELARAIAGPEARSEAYLALADVLARSRTQ
FT                   EAHADLATQAFSEAARAIASLPLGDVRNVLARALVDVLVAVGRFEDARAAVVLLDGDLY
FT                   NIAQALGAVAESMGRRNLVKAAQEWIAEVENDRLRSYLERRLIEGVLSAINSSRGLNVE
FT                   ALGGMTP"
FT   sig_peptide     complement(409054..409158)
FT                   /locus_tag="Isop_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(409411..410736)
FT                   /locus_tag="Isop_0287"
FT   CDS_pept        complement(409411..410736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0287"
FT                   /product="amidohydrolase 2"
FT                   /note="COGs: COG1904 Glucuronate isomerase; KEGG:
FT                   plm:Plim_2160 amidohydrolase 2; SPTR: Putative
FT                   uncharacterized protein; PFAM: Glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60884"
FT                   /db_xref="GOA:E8QX51"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX51"
FT                   /protein_id="ADV60884.1"
FT                   /translation="MSAALLHADTISDALTRRLFEVIASWPIYDPHSHINPHAPAARRF
FT                   DEILGYHYYTELAHSAGMPAELVDPALDPRQRSRNLAGWLDRIDNTVQFSWLTEIARVF
FT                   HGFDDVHAPIGPDTIDLLYDHALKESPAEANAWDDRVWTTTGLEAVFLTNDFDDPLEGW
FT                   DTSRYVPCLRTDDLVLKLDRPTTSERLRNTTNLPVEDIEGLKNALGVLFDRFVSKGARA
FT                   CAISLPPDFQAVAPDVTRAATPIRRALHGLELRPDEARLVQQTVFWTLAQFCRDYRLPF
FT                   DLMIGPRRDVYPAGVAGGRDLYDRRVSLHDYHELFNQFPDVTFPISTLAPDAAPELVSY
FT                   AWIFPNVVAMGHWWYSNLPAFIATDLRAKLQAVPQTKIVGYYSDAYKLEFILPKFRMFQ
FT                   RVLAEVLAEDWVRGRGWSEERALGLAERIMRTNPKRLFARGE"
FT   gene            410980..411161
FT                   /pseudo
FT                   /locus_tag="Isop_0288"
FT   gene            complement(411210..411725)
FT                   /locus_tag="Isop_0289"
FT   CDS_pept        complement(411210..411725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP0357 putative secreted bifunctional
FT                   (alpha-amylase and endo-alpha-glucosidase): starch
FT                   degradation and integral membrane protein; SPTR: Putative
FT                   secreted bifunctional (Alpha-amylase and
FT                   endo-alpha-glucosidase): starch degradation and integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60885"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX52"
FT                   /protein_id="ADV60885.1"
FT                   /translation="MTHLAFITLKSSRPLDLFDDPRLPSLAGLAASGQSGELTTADPAD
FT                   PIWSNLVQNRWTTVSRLDLDLDLELDAAPDRIDGAITELLSAFQSGSGPRGNVLALVIA
FT                   GSPQGGVFLVVTPPGYANSNPPTETLEPASLISWIATLQETLAQSPAADPDEDELVKER
FT                   LRGLGYIE"
FT   gene            complement(411722..413599)
FT                   /locus_tag="Isop_0290"
FT   CDS_pept        complement(411722..413599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0290"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="COGs: COG3379 conserved hypothetical protein;
FT                   InterPro IPR001917: IPR002591; KEGG: hoh:Hoch_2285 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; PFAM: type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; SPTR: Type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; PFAM: Type I
FT                   phosphodiesterase / nucleotide pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60886"
FT                   /db_xref="GOA:E8QX53"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX53"
FT                   /protein_id="ADV60886.1"
FT                   /translation="MSSTRFVRRVIVIGLDGLSPRLIEEFQGRGELPHLAELRRRGGFS
FT                   TVATTAPAQTPVAWSSFATSRNPGGHGIFDFLTRDPASHRVDMALNRYERPNPLLPPRV
FT                   VNLRGGDPVWSVLARAGIPSQVLRPPCAYPPDPGQGQIRLLSGLGVPDLRGGFGTATFF
FT                   TEEPEVRALESERVVRLERKPNGELVGSLIGPRDAKGDLVREIKLKPRSDGPGLLLEGV
FT                   EGGPVALEPGVWSGWTRVKFKAGLLRSTRGIVRWRLERNDPPVRLYASPVNFDPHSPLF
FT                   PISEPPEYAGDLADTLGLYATTGMVEDHAGLANGRLDEAAFLNQCDLCWREREAMLRHA
FT                   LNRSSEGLIFCLFDTPDRIQHLFWRYWDDAHPAHRGRPRTEQGAAAILDAYKRADTMAG
FT                   LALEAADDQTLVIALSDHGFDDFRRGVGLNAWLQDQGLLTPKPNIAPGDPAGDYLQGID
FT                   WSNTQAYSVGLGAIFLNLQGREAQGIVPPDEAAHLAERIAAGLTGLIDPQTGQTAITRA
FT                   LCRDAIFQGPYVNRACDVLVHFAPGYRVAWGSSAGRVDDATFQDNDHAWSGDHVIDPDR
FT                   VPGFLAMNRPYDSAAATGPAPRLIDLAPTITKALGVPAPDEWEGRSLIP"
FT   gene            complement(413596..413802)
FT                   /locus_tag="Isop_0291"
FT   CDS_pept        complement(413596..413802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_1958 non-ribosomal peptide
FT                   synthase:amino acid adenylation; SPTR: Non-ribosomal
FT                   peptide synthase:Amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60887"
FT                   /db_xref="GOA:E8QX54"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX54"
FT                   /protein_id="ADV60887.1"
FT                   /translation="MGTTVSTDSPKGCLMSSFIVFSYFGPETTMPLASALATVLGGALL
FT                   LGRSALVMAKTLLRRVFRLNRDQ"
FT   gene            complement(414268..416829)
FT                   /locus_tag="Isop_0292"
FT   CDS_pept        complement(414268..416829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0292"
FT                   /product="heme-binding protein"
FT                   /note="InterPro IPR009056: IPR013427; KEGG: plm:Plim_3308
FT                   heme-binding protein; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: heme-binding protein; PFAM: Cytochrome c;
FT                   TIGRFAM: putative heme-binding domain,
FT                   Pirellula/Verrucomicrobium type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60888"
FT                   /db_xref="GOA:E8QX55"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX55"
FT                   /protein_id="ADV60888.1"
FT                   /translation="MLECVHLAIRPTALLVAGVALAAWVGPSSPTRGDDEPSAVRSKLN
FT                   DAAANFKTLKDFEVKLIYAVPPEQGSWVSMTLDPQGRLITSDQYGKLYRITLSDQEDQP
FT                   PTVEPLAIDIGSAHGLLYAFDSLYVMVSEGRQGNVTGLYRARDTDGDDQFDEVELLRPL
FT                   KGSGEHGPHAIVLSPDGQSLTIVAGNHTDITEFDRTMLPSNWGEDQLLPRMWDASGHAV
FT                   GRLAPGGWIARVSPDGKEWTLISSGYRNPYDAAYNKDGELFTYDSDMEWDMNTPWYRPT
FT                   RVNHATGGSEFGWRSGTGKWPPDYPDSLPAILNIGPGSPTGVVFGYGAKFPSKYQEALF
FT                   ICDWSYGKLYAVHLTPNGSSYDAVAEEFVTGQPLALTDIVVRPQDGAIYFTLGGRRTTS
FT                   GLYRVRYVGSEDTTPVTTQPTPDAGSEARAQRRALEAFHGVVDPKAVETAWPFLDSPDR
FT                   FLRYAARLAVESQPVETWADRALNEPRIQGALTALLALARQGGQQYQEPLLHALDRLSL
FT                   DLTTEDQKIQALRILGLSFIRQGEPPSHIRETVADRLNDLYPAGSRRLDSELSKLLVYL
FT                   QSDDVVAKTIDLMEKAPTQEEQIDYALALRVAQVGWTDELRERYFRWFVKASTYKGGHS
FT                   LVGFIRNIKAEAVANLSEEQKAKLQPILEAKPEVVAEVLPSRPFVKEWTLEELEPLVSG
FT                   EALAKGRNYDQGRLMFAAANCYSCHRFGDDGGSTGPDLTTIANRFSPRDLLESIIHPSK
FT                   TISDQYEAVQILVDDGRVVTGRIVNLNNENLMINTDMLNPDAMVSIKRSAIEEILPSPI
FT                   SMMPEGLLNTLTQEEILDLMAFMLSRGDRQHPMFRQNGAND"
FT   sig_peptide     complement(416731..416829)
FT                   /locus_tag="Isop_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(417368..417815)
FT                   /pseudo
FT                   /locus_tag="Isop_0293"
FT   gene            418094..419104
FT                   /locus_tag="Isop_0294"
FT   CDS_pept        418094..419104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0294"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: jan:Jann_0217 glycosyl
FT                   transferase family protein; PFAM: glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase family 2; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60889"
FT                   /db_xref="GOA:E8QX56"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX56"
FT                   /protein_id="ADV60889.1"
FT                   /translation="MSAADLASSCHAATVAPQPRGQIRPATRSESRPPRLSVVIASING
FT                   REVLEPTLDALDAQTIRDEMEILVVEAVGGATRAHLAERLPVVRVIPVQERMSIPRLRA
FT                   LGGRAATGDVVAILEDHVAVVPGWAEAIVAAFERTDDPTLAAVGGPVLNGRRGWVDRAA
FT                   FLTEYTPFLPPLQPRDPAAVPNLAGNNIAYRRAWLERHLDLLEQGRWESWINAAILRQG
FT                   GRLEARDAAAVRHIKPFTLADFLTQRFWFCRSFAGMRRADQSPVVRLIHVAGSPLLPAL
FT                   LLARIARAVWIDKRPGHRADFLACLPLILLFLTVGAAGELVGYLWGTGGSLERVE"
FT   gene            419101..420096
FT                   /locus_tag="Isop_0295"
FT   CDS_pept        419101..420096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nda:Ndas_1372 transcriptional regulator,
FT                   winged helix family; SPTR: Transcriptional regulator,
FT                   winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60890"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX57"
FT                   /protein_id="ADV60890.1"
FT                   /translation="MSVFENHKVLRETNATRRAAEPRLAVVITSADDPARLVQAARSAW
FT                   SSCRAPERVTWWLVTTSQWVETLERDQATWFEGMGPAKVRLLVVSSDAVELQRADAVWQ
FT                   IDADWVIFTEAGCRHPVGWVEDWIEAIQRAETLGIEAVGGTVEPAEEVLRDRLTLAVWL
FT                   HEYSHALADSLTSRRPAGCDAAVAVTWARRLAAERGRLFDHEWTRPGRAEARRRGAPVR
FT                   YARPIPPDGWISERIRAGQSYGQTRPIAQWAGMFSWCAALALTPLIAAAQIRGLLGSIR
FT                   ISARGRGLARRAGIALIGVVLGWSWGEACGRLGRATPRDEDSRPVPATSP"
FT   gene            420207..420896
FT                   /locus_tag="Isop_0296"
FT   CDS_pept        420207..420896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0296"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="COGs: COG0259 Pyridoxamine-phosphate oxidase;
FT                   InterPro IPR000659: IPR019740: IPR011576: IPR019576; KEGG:
FT                   bmj:BMULJ_02532 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like; PRIAM:
FT                   Pyridoxal 5'-phosphate synthase; SPTR:
FT                   Pyridoxine/pyridoxamine 5'-phosphate oxidase; TIGRFAM:
FT                   pyridoxamine 5'-phosphate oxidase; PFAM: Pyridoxamine
FT                   5'-phosphate oxidase; Pyridoxine 5'-phosphate oxidase
FT                   C-terminal dimerisation region; TIGRFAM:
FT                   pyridoxamine-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60891"
FT                   /db_xref="GOA:E8QX58"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX58"
FT                   /protein_id="ADV60891.1"
FT                   /translation="MSLYSATERVPEPGSAPREMRVDYKRASLSESDVHPDPITQFGVW
FT                   FEEAVAHGLREPNAMTLATVGPDGRPSARIVLLKGYDPRGFVFFTNYESRKGRELSANP
FT                   HAALVFFWADLERQIRIEGMVERVDPDESDDYFKSRPLGSRLGALASRQSTVIPNRDVL
FT                   DRRLAELEAQVRAGDVPQRPDWWGGYRVTPSELEFWQGRSNRLHDRLRYRRDELSPSGW
FT                   RIERLSP"
FT   gene            complement(420839..425794)
FT                   /locus_tag="Isop_0297"
FT   CDS_pept        complement(420839..425794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090020000039 guanine nucleotide exchange
FT                   factor; SPTR: Alpha-2-macroglobulin domain protein;
FT                   manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60892"
FT                   /db_xref="GOA:E8QX59"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX59"
FT                   /protein_id="ADV60892.1"
FT                   /translation="MATWSSCAWELPSVRGRGEGDVVGNTSEFPGDSLDLTRRQPRRWP
FT                   TLVKPLAVGAVLIATLAAVVWWWNRPVAADFEIRLWPPDAPSIGSTEALRVWIVKAHAE
FT                   SNLESGSTSHSSSPRWQGVPGVEVTAELVDRGTRRKRLATWTTDATGTAAPSVTWPDWS
FT                   EGSYKLVLSARRQRARETLEVAVRLQRAERMAALIDRHRIEAGEPLNILAWMTSAPGHT
FT                   PLVNRRVEAQLLNTERTVVSLSEARTNAHGIAELQFITARSLPPGEYVVKLRSSGGVNE
FT                   WGLRIDPPLDPLTPRLALGLRPPDPSNPALRGWLLARDGRGAPRGGLSVVLEGRWINLG
FT                   SATASPSPAAPIRVVTNSLGLADWSFDPPLDSGALELVARVEFSEPFTAPSASLVVPLP
FT                   HPTPVTLTPSQTADAVSPASSTNDPDTLPTLRADRPCVAAGSSVTIQVHDQPGPIPGTL
FT                   DLLANGNMVTGLTLDLTNGTGIGRLTIPEMIRGVVDVRYLRPQADGTVVTRWLCLGVEG
FT                   PSQARLRPFWSDAEPPWPSSTDTLLKQHESVPALSARPKRADDGPLDGLVLGVIQPLTV
FT                   TPNRLDDSLDLLDARLEEWGVVFDQHAADTLAHRASLLNQTSRTLGTWMSSRAVTALQG
FT                   DGSSAASLRNVPQLTALAPEDRDSASRRPSSDGEGHSNVTSERVEVDQSAARPPELPNR
FT                   SRPAGINNRGEFFKSAPPRWLRWIRLNSPTDATHTAPSPDLSVWFDAPRAWGDAPERIV
FT                   PPQGWRIETFLAHSDGTIAWEQAQTTPRLLRAELYLPSHWTLGDQSDAVAWVWNDGSHD
FT                   HVAQITWRVQGGLVFSTPSSHQDKETDPPGFSETQTTQTIVVPAGGVVGLSLALQARVA
FT                   GEAVLKLWVESTSTSSSTPLHTVSTTQSPTAWRERSAIIDPPGRIRWLTVGGLIGPNAP
FT                   RTLELALPASARLDDPVTTHLRVDLVGHPSRWDALADAAETAWRQAAPTVDQLVFGAWP
FT                   ILMLAHPVSFTLPDFAAEHRVFWDHLLDATLQNLRQRADSSGNLSPWGNEPADPLATAL
FT                   VHALIARRQSRLAADLDLQRESRRRLEALIIELTPVRRFVPVPEPFSRSGGLAIEAGPR
FT                   FVPPELVGPESGFPRLPQRTSRVDQPGVPPSEEPSSSTPITKEILPEPGSRNNAPDPAF
FT                   RSGGPIMTPSWMYTRQTRDQYLLRAIGLWSGGHSGAMPGAAISLQTDFFRRDLNDAYAQ
FT                   AFILLSLMNNELSPRSREIQSDFHLLGRLRSLGSLPNDPAPPGPFWTTGQTVFGCRGRA
FT                   AAQATTALSSLTLTAVPFFPNLTKLLDAATEHLWQWRQHQGVWLSAEATAWAVWSLSRQ
FT                   LGSARIRVPTQLLLRAGEAGTPRLWELPLGPLGQPQRLDLTDTVAHARLAVTPPTDPSE
FT                   PGSATLRWRLEWYGPTSIPTMQQEEADLTQLAAPVLLRARWIEPEVATATPHPRLPVRW
FT                   LDPIDPSQSLTLNVGMVWSPRLQLDWRSVPQDQRPRVVAVTLPEPPGLSLERVDLELVN
FT                   DDDHDDATPSTPSTASASQDADASKTDQSQARPGDVALLERRRTNEGSGVTVLIRVPPQ
FT                   PEATRLTARLLPCWKARTPGRAILGAVEVVDWDDPDTIARLPLPTLVAPTASAAQGDKR
FT                   SILQPEGDNSSRR"
FT   gene            426129..426217
FT                   /locus_tag="Isop_R0006"
FT   tRNA            426129..426217
FT                   /locus_tag="Isop_R0006"
FT                   /product="tRNA-Leu"
FT   gene            complement(426869..427675)
FT                   /locus_tag="Isop_0298"
FT   CDS_pept        complement(426869..427675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0298"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018247; KEGG: rbi:RB2501_05365 probable
FT                   large multifunctional protein-putative glycosyl hydrolase;
FT                   SPTR: Probable large multifunctional protein-putative
FT                   glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60893"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX60"
FT                   /protein_id="ADV60893.1"
FT                   /translation="MRCLTQGVVVMLLVAATAGSVAAQPSDNDSNSKPTASPQQVVGYW
FT                   SFKITAEGRTFEPTLTLKTDAKGNLKGVYRDADVEETPTDTIHWDGSRLTFSLTVTLQG
FT                   DKVDLAFQGQVVNDRFVGDVQYKAQDASGIAEVIGTRKAPDASPERVVGVWDLELSAEG
FT                   QVFKPTVEIKVGDDNKLTGIYRSTGIKDTPIKTIEWDGITLTLKLAVVIQDLDVAIVYQ
FT                   GNVTDDRIEGEVEYDAGPAFGTVTFKGSRRGNVPATPETTSDSRVP"
FT   sig_peptide     complement(427607..427675)
FT                   /locus_tag="Isop_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(427925..428269)
FT                   /locus_tag="Isop_0299"
FT   CDS_pept        complement(427925..428269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0299"
FT                   /product="protein of unknown function DUF486"
FT                   /note="COGs: COG3169 conserved hypothetical protein;
FT                   InterPro IPR007437; KEGG: dia:Dtpsy_2708 protein of unknown
FT                   function DUF486; PFAM: protein of unknown function DUF486;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function, DUF486"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60894"
FT                   /db_xref="GOA:E8QX61"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX61"
FT                   /protein_id="ADV60894.1"
FT                   /translation="MPVLVQTILLLTIANIFITFAWYAHLKELNHQPWFIAALMSWAIA
FT                   LAEYLFQVPANRIGHTQFNVGQLKILQEVITLSVFIPVSVFYLREPLKWDYFWAGLCLV
FT                   GAVYFIFRNA"
FT   sig_peptide     complement(428201..428269)
FT                   /locus_tag="Isop_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(428465..429628)
FT                   /locus_tag="Isop_0300"
FT   CDS_pept        complement(428465..429628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0300"
FT                   /product="esterase"
FT                   /note="COGs: COG2382 Enterochelin esterase; InterPro
FT                   IPR004193: IPR000801; KEGG: sli:Slin_1254 putative
FT                   esterase; PFAM: esterase; glycoside hydrolase family 13
FT                   domain protein; SPTR: Putative esterase; PFAM:
FT                   Carbohydrate-binding module 48 (Isoamylase N-terminal
FT                   domain); Putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60895"
FT                   /db_xref="GOA:E8QX62"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX62"
FT                   /protein_id="ADV60895.1"
FT                   /translation="MKIVRWIGIGWVAWTIGWIEVNAQPVAAPSPEVSSERQITFRVFA
FT                   PKADTARLTSSDLPGLGFAGVGMTKNERGVWEVKIGPVPAGAYRYAFNVDGTIVLDSNN
FT                   PNVSPTNDSVFSLVEVPGSELFDRREGTPQGAVARVDYYSQTLKRFRRMHVYTPPDYDT
FT                   SRERTYPVLYLLHGATDCDASWSTVGRAGVILDNLIASGRAEPMIVVMPHGHTGPFRFG
FT                   ASPEENAFERQMEEFSQEFTREIIPLIETRYRVIADRAHRALAGLSMGGYQTLLIGIDH
FT                   LGEFGYLGIFSSGIFGIAGGFGADAPSDQWEKARKAVLDDANLKKGLKLVWFAIGKEDF
FT                   LLKTSRATVTMLQRHGFEVISKETEGGHTWLNWRDNLAEFAPLLFKP"
FT   sig_peptide     complement(429560..429628)
FT                   /locus_tag="Isop_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            430038..430664
FT                   /locus_tag="Isop_0301"
FT   CDS_pept        430038..430664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_3458 methyltransferase type 11; SPTR:
FT                   Methyltransferase type 11; PFAM: DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60896"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX63"
FT                   /protein_id="ADV60896.1"
FT                   /translation="MRRFFKFRFHGTRSIAVGAMGAALVATLAGMIWNGGGMVTVRAWP
FT                   VVQETEVEFVFPIIKRYGGVVALPDAAEPVLAGTKAICDLMGRGKTPDQPLPGLVRLAV
FT                   LLNLAGTQGLKPDSFDLVVILHGDATESALNDAAYRRSQGHDHPSGELIDQLVAAGVKI
FT                   NVCGQSLLRKHLDPRDVRPGVTITASAISTILNYQSRGYPYIPSH"
FT   sig_peptide     430038..430166
FT                   /locus_tag="Isop_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            430694..432175
FT                   /locus_tag="Isop_0302"
FT   CDS_pept        430694..432175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0302"
FT                   /product="sulfatase"
FT                   /note="COGs: COG3119 Arylsulfatase A; InterPro IPR000917;
FT                   KEGG: plm:Plim_0571 sulfatase; PFAM: sulfatase; SPTR:
FT                   Sulfatase; PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60897"
FT                   /db_xref="GOA:E8QX64"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX64"
FT                   /protein_id="ADV60897.1"
FT                   /translation="MKHSMSAWWRIVALAAWIGVGAVGTVGPTAQGADDRPPNIVFILA
FT                   DDLGWTDLGCQGSTYYETPHLDRLAAQGIRFTQATTAGPNCQPTRAALITGQYGPRTGI
FT                   YTVGSIERFNWRLRPLQPVDNVETLDPSAVTFAEVLKSAGYATGFFGKWHLGDGPSHPC
FT                   RQGFDEALVTTTTHFHFRTNPPVELEDGVYQADFLTDRAVEFIKRHQAGPFLLCVQHFA
FT                   VHSPYQAKPEWIEQFRSKAGAPGHRDPTYAAMIASVDESVGRIVAQIDRLALDRQTLVI
FT                   FTSDNGGVGGYAREGLRRSQDVTDNAPLRGGKGMLYEGGIRVPFLARWPGRVPSGVVCD
FT                   EPIQSIDLFPTLLELAGVAPPADLVLDGTSFVGLLETGRLQTDVERPPLFWHFPGYLGA
FT                   GEDQWRATPVGVVRAGDWKLMEFFEDGHFELYNLKDDPGETCNRAADQVEKVAELHQRL
FT                   IAWRRAINAPMPTPNPRRPPADKPVKPVPVPSQPG"
FT   sig_peptide     430694..430789
FT                   /locus_tag="Isop_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            432189..432686
FT                   /locus_tag="Isop_0303"
FT   CDS_pept        432189..432686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0303"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="COGs: COG2110 phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1; InterPro IPR002589;
FT                   KEGG: rba:RB4366 hypothetical protein; PFAM: Appr-1-p
FT                   processing domain protein; SMART: Appr-1-p processing
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60898"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX65"
FT                   /protein_id="ADV60898.1"
FT                   /translation="MPPSRIEVVEGDLLDQPVEAIVNPWNRNVIPWWLLLPQGVSGAVR
FT                   RRAGREPFRQLGRMGPIRLGEAVATTAGRLPFRAIIHVAGINLLWRSSEASIRTATRNA
FT                   VALAGRLGLSSIALPLIGAGTGGACPERVLEWMREELSRCDFQGTVRIVRFAPKSSRGD
FT                   HS"
FT   sig_peptide     432189..432248
FT                   /locus_tag="Isop_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(432751..434085)
FT                   /locus_tag="Isop_0304"
FT   CDS_pept        complement(432751..434085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0304"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR004839; KEGG: rba:RB7823
FT                   transaminase; PFAM: aminotransferase class I and II; SPTR:
FT                   Probable transaminase; PFAM: Aminotransferase class I and
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60899"
FT                   /db_xref="GOA:E8QX66"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX66"
FT                   /protein_id="ADV60899.1"
FT                   /translation="MNVPESPESDSPASTPSSLPTASDTSSIRPERDREFEEEHDNFEM
FT                   NVEFASRVLKLPPYLFGKINEIKYRKRRAGIDVLDLGMGNPTDPPAQTIIDKLCEAARD
FT                   ARNHRYSVATGIYNLRREVAIRYRNRHGVELDPESEVVATIGSKEGFSHMCLGLLGPGD
FT                   TALVPAPSFPIHVHAVALASANVIALDVRRPEAFLENVVRVCESLTPRPKALILNFPHN
FT                   PTGVVVESDFFREVVALARRFGFVVIHDFAYGDVGFDGYEPPSFLATPGAKEVGCELIT
FT                   MSKGYNMAGWRVGFAVGNSRMLQALKAIKGYYDYGLFQAVQIAAIVALRHGEPARQAQV
FT                   LEYQARRDALVDSLNRQGWNITPPKAGMFIWAPIPEPWRSRMNSVEFAMKLLEEAEVAV
FT                   SPGSGFGELGEGYLRLALIENVQRLRQAARQIGRCLRSEGGIHTH"
FT   gene            complement(434412..435761)
FT                   /locus_tag="Isop_0305"
FT   CDS_pept        complement(434412..435761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0305"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000297; KEGG: plm:Plim_2735 PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase; SPTR: PpiC-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60900"
FT                   /db_xref="GOA:E8QX67"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX67"
FT                   /protein_id="ADV60900.1"
FT                   /translation="MITTRIRMVLDSTVWRPSLVAVVSLSAAVPVLGQTREGRNANTPP
FT                   PAPTALPSPSGPTDTTTPKLKPVAIPVNPSDPVAVINGQVITRQMLSDECVARRGVEIL
FT                   ETLIARVLIDQAIQAQGLSVTAEEINAEIDSVAQRMAGLSREAWLKTLYKERGISPEQY
FT                   ARDIIYPTLALRKLAEPLVQITPKDLQIAFDATYGDKLRCRMIMVDKLRVAQEIWQELK
FT                   ANPGGFEKIAMERSMDLNTRSLGGLIAEPISRHAAPETVSAAAFAQLVDGNPNDKDPSH
FT                   KPKDGDITGPIQVSETSWIILKREAVIPAQAKDPNDPAIAAQLEELVRDTKIKEKMGEV
FT                   FNALMKRAQIENRLTGHIKMANEDPDPATGVDAAIRRASNNDQEQSAPPQTAPAPKTIT
FT                   PPPVADGPGAQSPKLKLPVPAGVTPEMIRERERLREQIRKEAQSVKPSNN"
FT   sig_peptide     complement(435663..435761)
FT                   /locus_tag="Isop_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            436142..437998
FT                   /locus_tag="Isop_0306"
FT   CDS_pept        436142..437998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0306"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="COGs: COG0405 Gamma-glutamyltransferase; InterPro
FT                   IPR000101; KEGG: gau:GAU_2335 gamma-glutamyltranspeptidase
FT                   precursor; PFAM: gamma-glutamyltranspeptidase; PRIAM:
FT                   Gamma-glutamyltransferase; SPTR:
FT                   Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltransferase; PFAM:
FT                   Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60901"
FT                   /db_xref="GOA:E8QX68"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX68"
FT                   /protein_id="ADV60901.1"
FT                   /translation="MTTTITKTTQRRIGPHGEGHSRGMGCRRVGVGLALVAWLVGSTPP
FT                   VRAQETAVVVSASAAVFQREAVVCNDEPSARVGATILAQGGNAIDAAVATALALAVTHP
FT                   AAGNLGGGGFLVAFLPERGQVVAYDFRETAPAASTPTMYLDEQGRLRPRHRVGPRAAGV
FT                   PGTPRGLELAHRHHGQLPWAQVVAPAIALARDGFPVTKVLADSLNAQLQLRSGTQPLEV
FT                   DDENPGDAQARMADFPSSTAAFAKPDGTPWRAGDLLKQPDLASTLQRLADRGADDFYRG
FT                   QTAHLIVEAMARDGGIITLKDLESYQAKSRPPIRFTYRGYEIYGMSPPSSGGLTMGMMF
FT                   RMLERFDLAADGPESPQTLHRVTEAMKRAYMIRARDLGDPDFNNRDWETLLESKEVERL
FT                   AASIGPRATPSRDLAGDAWIIAPEGTDTTHLSVIDAQGAAVALTYTLEESYGSKYVVPG
FT                   AGFLLNNEMGDFNLIPGLTDERGHIGTTPNLIAPGKRMLSSMSPTLVLREGRVRVVTGS
FT                   PGGRTIPNTTLWVLLRLIDFNASPAEAVAAPRTHHAWFPDLLSLEGREWPKATLDTLVS
FT                   QGHRLQVGGVQGDAHTIVVDPVTAARHGVPDPRRGIAHAAGR"
FT   sig_peptide     436142..436285
FT                   /locus_tag="Isop_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            438334..438726
FT                   /locus_tag="Isop_0307"
FT   CDS_pept        438334..438726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0307"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="InterPro IPR000119; KEGG: tgr:Tgr7_2924 histone
FT                   family protein DNA-binding protein; PFAM: histone family
FT                   protein DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein; SPTR: Histone family protein
FT                   DNA-binding protein; PFAM: Bacterial DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60902"
FT                   /db_xref="GOA:E8QX69"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX69"
FT                   /protein_id="ADV60902.1"
FT                   /translation="MAKKVPAKPAPKAAANGPKAKAAPKATPKAKPPTKNEVFGKLAES
FT                   TQLTKKQVAAVFEQLEKMIIEELGPKGSQVFQIPNLVKLSVTVRPATAEKMGRNPATGE
FT                   PMKIAAKPARKAVKVRVLKMLKEAVE"
FT   sig_peptide     438334..438399
FT                   /locus_tag="Isop_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            439321..439755
FT                   /locus_tag="Isop_0308"
FT   CDS_pept        439321..439755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0308"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="InterPro IPR013096; KEGG: mka:MK0873
FT                   mannose-6-phosphate isomerase; PFAM: Cupin 2 conserved
FT                   barrel domain protein; SPTR: Cupin 2 conserved barrel
FT                   domain protein; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60903"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX70"
FT                   /protein_id="ADV60903.1"
FT                   /translation="MSTVDPSQPRVQDPPPTSVGVRADRPRFLVRRLADAPVVECHCGP
FT                   SARLLTYPEADQINVHVTTIVDATEHYHKITTEYYYILEGNGTLYLDHQPIEVEPGTLV
FT                   VIEPGVRHRLVSVTGVKTLVMGVPALDPADEYFDEDASRT"
FT   gene            439812..439896
FT                   /locus_tag="Isop_R0007"
FT   tRNA            439812..439896
FT                   /locus_tag="Isop_R0007"
FT                   /product="tRNA-Leu"
FT   gene            complement(439946..441421)
FT                   /locus_tag="Isop_0309"
FT   CDS_pept        complement(439946..441421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0309"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: psl:Psta_1220 efflux transporter, RND
FT                   family, MFP subunit; SPTR: Efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: HlyD family secretion protein; TIGRFAM: RND
FT                   family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60904"
FT                   /db_xref="GOA:E8QX71"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX71"
FT                   /protein_id="ADV60904.1"
FT                   /translation="MTWLRWVGGCLALGVWLTSIGCNDGLISDLPSEPTGTTEARTPDL
FT                   EPTPSSKGDAREDAEEASAFRSDVAVVDAKEEVSASPPPEPQPGESRLHVPVVGLRPGT
FT                   IRRVVTRRGEIQASQLTSLHARIAGLVRVASHEAGESVRAGTVLAELEAPELDADLQYR
FT                   RAEVDRARARTRQAEAALAVAEAAIHRAQAELAQVRASIRRADAEVERGRTQFQRIDQL
FT                   AKESVLTAGLRDESLNRYMLAQAARREIDARLSSAEAALAQARAERDKAQADLAAAQAD
FT                   ITVAEAEIARAQVLERHRRIVAPHDGILLERRVEPGQTTLPGDTGEPLFILARNDRVRA
FT                   VVVVPEDVAALMNVGQEAEIRPPTVEERYVAGKVSRLSGPLDPINPTWRVEIDLANPDH
FT                   LLQPGQVVSVTVILDERTDVPTLPRVAVAGRGESAFCFVAEDGLARLRRIRTGLADDER
FT                   VEVLAGLDVSDRIIVVDPATLSDGQPIHAVNLP"
FT   sig_peptide     complement(441359..441421)
FT                   /locus_tag="Isop_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(441749..443191)
FT                   /locus_tag="Isop_0310"
FT   CDS_pept        complement(441749..443191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0310"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3); InterPro
FT                   IPR013027: IPR004099: IPR000815; KEGG: hch:HCH_00152
FT                   dihydrolipoamide dehydrogenase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   SPTR: Putative pyridine nucleotide-disulfide
FT                   oxidoreductase, class I; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60905"
FT                   /db_xref="GOA:E8QX72"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX72"
FT                   /protein_id="ADV60905.1"
FT                   /translation="MNQESVTFAIIGAGTAGMRAYREIARHSDSIRLIEGGRYGTTCAR
FT                   VGCMPSKLLIAAAERAHQVRHADLFGVRVPEVQIDGRAVMKRVRSERDRFVGFVVETVH
FT                   GFKEEHRIQAFARFLDNHTLKLSDGRILKAERVVIATGSRPTVPPLLQGLEDRVITSDD
FT                   LFEWEDLPKSVAVLGSGVIGLELGQALHRLGVRVKIFGRNGRVGGLTDPAVVAEANRIF
FT                   ATETPIDTRARVERVERADNGLILHYFDGDNREHIETFELVLAATGRMPNVDRLGLENT
FT                   SLTCDDRGVPHHDPLTGQCGDSPIFIAGDATHELPLLHEASDEGQVAGLNAVHYPEVHR
FT                   YAKRAPITVIFTDPQLMIVGPGHRALSQRATPVVTGAVDFGDQGRSRILGENRGLLHVY
FT                   GEPVTGRFLGAEMVGPRAEHLAHLLAWSLQSNLTVADMLERPFYHPVIEEGLRTALRNL
FT                   HAKLGQEGSPGLRRLNGTVSRD"
FT   gene            complement(443238..444719)
FT                   /locus_tag="Isop_0311"
FT   CDS_pept        complement(443238..444719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0311"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="InterPro IPR010869: IPR006311: IPR017909; KEGG:
FT                   rba:RB12159 hypothetical protein; PFAM: protein of unknown
FT                   function DUF1501; SPTR: Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF1501)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60906"
FT                   /db_xref="GOA:E8QX73"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX73"
FT                   /protein_id="ADV60906.1"
FT                   /translation="MNGPHSSPVSSSDPIASPVDVSRRWFVRDCGVALGAIALRDLLLS
FT                   GDSARATAADSDAPKSARRDPLAPRAPHSPPKAKRVVFLFMAGAPSHLELFDYKPELAR
FT                   LDGSLPPAELLEGYRAAFINPNSRLLGPRFKFARHGQCGAEISELLPHLASIVDDLTIV
FT                   KGMTTDAFNHAPAQILMNTGSQQFGRPSFGAWTTYGLGSETRDLPAFVVLNSGTKGPSG
FT                   GNANWGSGFLPTVYQGVPFRTAGDPVLALSNPPGVDERSQRTTLDAINRLNDLRRDVTG
FT                   DPEIATRINAFEMAYRMQVSVPELMDVRNEPQHILDLYGAEPGKASFANNCLLARRLLE
FT                   RGVRFVQLFHEAWDQHGNLRKDLAKNCKDTDQACAALVKDLKQRGLLEDTLVIWGGEFG
FT                   RTPMVQGGGDDGRDHHPNAFTMWLAGGGLKPGLTLGRSDDLGFNVVEDRVHVHDLHATL
FT                   LHLLGFDHTRLTFRSQGRDFRLTDVHGTIVQKMLA"
FT   gene            complement(444828..448133)
FT                   /locus_tag="Isop_0312"
FT   CDS_pept        complement(444828..448133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0312"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="InterPro IPR011444; KEGG: rba:RB12155 signal
FT                   peptide; PFAM: protein of unknown function DUF1549; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1549); Planctomycete cytochrome C; Protein of
FT                   unknown function (DUF1553)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60907"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX74"
FT                   /protein_id="ADV60907.1"
FT                   /translation="MMTKMIMTRSVSCRRHVVGWIERWGSIALIGMIGWLGGPVERALA
FT                   GGVRVGETSVATLHGIDSVDFERQVLPILTTRCFECHDARKQTAGLRLDARSRAFAGGE
FT                   SGLASIVPGQPDESELILRVESQEEFERMPPKGPPLTPEEIGVLRLWIEQGATWPDALA
FT                   NDHDPARDHWAFRPPNRPALPDLKGHHRLAGWVRNPIDHFVAARLAAEGLEPSPAADRL
FT                   TLARRIALDLTGLPPSIEQADALAHDPDPDDQALARYIESHLRSPHYGEHWARWWLDAA
FT                   RYADSDGFEKDKPRSVWNYRDYVINAFNANLPYDRFVIEQLAGDWLPNATPAQKIATGF
FT                   LRNSMINEEGGVDPEQFRMEAMFDRMDAVGKSLLGLTIQCAQCHDHKYDPLKQSEYYQM
FT                   FAFLNNDHEASIEVFTPEQESRREEILSRVRAIEAELKASAPDWRERLAAWEAALLDPS
FT                   QAFSWSVIRPEAEANSTGGQKYLLQEDGSFLCQGYAPTKHTVMLTAQVDRPVLTAFRLE
FT                   ALPHPDLPLNGPGRSIKGTFALTEFKAEVTPLGVPNAKPTPVEFVRATATVNPPERELD
FT                   PIFFDKTDRRRVTGPVEFAIDGRDQTAWSDNLGPGRRNRPVEAVFLAKRPLVDPGGRGF
FT                   LVTIRLVQNHGGWNSDDNQNHNLGRFRLSVTDETTAQADPVPLDVRASLKIAPEQRTPD
FT                   DLERIFAHWRTTVPQWHEANQRIDALLAELPEGTPQLVLQARAQPRTTQILKRGDFLKP
FT                   GDPVQPGTPAFLHPLETTEGTPLNRLTFARWVVDRRSPTTARAIVNRVWQRLFGVGLVE
FT                   TPEDLGVQSPPPSHPELLDWLAVELMESGWDLNHLQRLILTSATYRQSSRLTPQLAERD
FT                   PNNRLLARMPRLRLEAEVIRDAALAASGLLNRRVGGPSVFPPLPEFLLQPPVSYGPKSW
FT                   PVSPPEEQRRRSLYIFRYRSLPYPALEVFDAPPGEVACVRRSRSNTPLQALTSLNEPVF
FT                   VEAARSLALATLKQAAPNETDRLTHAFRRVLTRYPVPEELAILGALRRAEHERLAAQKD
FT                   PQATAWTLLAGPEAANHPERRPDLPNQVDPIEAASWVAVARALLNLDEAIVRE"
FT   gene            448677..451265
FT                   /locus_tag="Isop_0313"
FT   CDS_pept        448677..451265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aag:AaeL_AAEL001032 hypothetical protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60908"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX75"
FT                   /protein_id="ADV60908.1"
FT                   /translation="MRMRREEPGGTTEAGILPLPGHHVRIQARLTTRLTELRRCLTACS
FT                   PGSSDLVGPLGPDWPERTLLIQACARLESDLAASARLCEGLARSWAATWSGDGKDAAGV
FT                   SGQLAQLRAAHAEIEARLVDLERRLGRPDVADRPDNLLVAPTRQGETVHPARTPKSERR
FT                   RSTFRLKPTMFEGLEPRVVPALAATPLPVDPVLAIVSTPTNRDNLPNNDIVARFQFTGP
FT                   VNAAQLLAEVGFGDGTSTTFGTVTVTPGATTPVDLTGATAFTLPAIPPGSQDPGFLTPP
FT                   AGASISFFQELSAQTAVASGIFNFSSTTSQFDPGSPGQPFDSTLLLGRLAGSTGANQPF
FT                   VTIGGQLDPNTGAIPRGFLTLTFGAGRSIVNNPGDDLFLFELASVESFGVRATWIDPVT
FT                   GVQNTTGFFSTPTDPFQYDSAPNSNLPDFFLRRTNLARIDFSDLGIPNGALVQSVEVVN
FT                   LFPQFDFVTTGGQQDTRQAILRTDFNQTAPPGFETLPLPPGFNQNPAVSGPDLQFAVAS
FT                   NLVQTAGAIVTVRAPHDFPRDGVFNGVVELRDASGHSAFSTFTSQVSTLDLQPPFVLAP
FT                   QTTGVPVVFPGGVLTTALPVPANGVNPEAQSYRAFIDWGDGTPITQGVVTDANNDGVLE
FT                   ISPTSFTYRAPGTYQVRVDLFSVNNVKIDSQVYTITVTGDPISGPVDPVAPQVVEVVRY
FT                   GYHRQPTVVEVRFNTAMNPATVTNPANYQIVGAGADGRFGTRDDERFPVGRVNYNAATN
FT                   TAILFPNRQLRLLGRVYRVTVSNLQSAAGLPLPTTTVGFQGLGPAGLGSPGPLPTSTTP
FT                   QGAIAPIPANVNANTIRPASTLVNRVALPSGSRLLDPANNGSGSNLWWRR"
FT   gene            451653..453788
FT                   /locus_tag="Isop_0314"
FT   CDS_pept        451653..453788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0314"
FT                   /product="Redoxin domain protein"
FT                   /note="InterPro IPR013740: IPR009056: IPR017936; KEGG:
FT                   psl:Psta_2862 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen; PFAM: Redoxin domain protein;
FT                   SPTR: Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; PFAM: Copper type II
FT                   ascorbate-dependent monooxygenase, C-terminal domain;
FT                   Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60909"
FT                   /db_xref="GOA:E8QX76"
FT                   /db_xref="InterPro:IPR008977"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX76"
FT                   /protein_id="ADV60909.1"
FT                   /translation="MIGRICRCRVTPRWSRSLPVSAGRIGLALALATSAFLQAAEPPAQ
FT                   DAHANLLTALDRGVGQPLSMNFKLIGLDDKPISFRQFIGKKAVVIVFIGTDCPIGNLYM
FT                   PTLVELAKEYEPRGIQFVLVNSNQSETLDDMRKHAEEYGLNGVPGLLVAKDPGNELADL
FT                   ALAERTNEAILIDATLDFLNKLARIRYRGMIDDQYHYNARRDQPKRTPLKDALEDFLAG
FT                   REVRVAGTEVQGCLIERGAPKVLVDRQGAMVRTMPEEIRAEFAKARAMEPIAVGPVTYH
FT                   KDVAPIVQAKCQTCHRPNQVAPFSLLTYEQAKRWKGMIREVVDDGRMPPWHANPNYGAF
FT                   ANDRSLTPLERAILLAWVDQDAPEGNPADSPAPRTFAEGWTIGKPDLIIEMPRTHIVPA
FT                   GGVVDYVRYPVDFEVKEDLWIQAIEARPGDPAVVHHIILYYVLPGDPAPRYLVGYAPGD
FT                   LSETFPEGTAKRLPKGSRFFFEMHYTPIGKVRQDKSSVGIVLAKTPPTRETITRPIASR
FT                   ELEQRLISIPPGHPNYPITSAIEFKTDVELIGMMPHMHLRGKDFRYILTDPQGKETILL
FT                   DVPAYDFAWQNFYWTKQPIPIPAGSRIDCVAHFDNSEDNPYNPDPSASVTWGDQTYEEM
FT                   MIGFIEYTVPLDIQGSWTQHAKRVTPKLVPGQDPLPEARPSTGAAGLLNRLLGGLNPAT
FT                   TPKTAPTTTPTRSDPGQ"
FT   sig_peptide     451653..451799
FT                   /locus_tag="Isop_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            454105..455901
FT                   /locus_tag="Isop_0315"
FT   CDS_pept        454105..455901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0315"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR007197: IPR006638; KEGG: rba:RB5334 Fe-S oxidoreductase;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Fe-S oxidoreductase; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60910"
FT                   /db_xref="GOA:E8QX77"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX77"
FT                   /protein_id="ADV60910.1"
FT                   /translation="MLNAGLKEFLVARILPRVRTPGQYLGGERQAIRKDHRAVKGTVCL
FT                   AFPDTYALGMSHHGLQVLYSLINARDDWACERAFTPLPDFENELRDHGLPLYSLETFTP
FT                   LNQFDILGFSLQYEICYTNVLTMIDLGGLPLHAEDRGPDDTLVIAGGPGAQNPELLAPF
FT                   VDLFIIGDGETSLPVVCDLWIEMNGSGMTRAEKLARIVRETGWSYAPCLYEPIYKEDGT
FT                   LLEMRPLADDLPREIHASVIREFDAIPLPVAPIIPLVETAHDRIALEIMRGCPWQCRFC
FT                   QSTVIKRPLRARSVETVVQAALDSYRKTGYDEISLLSLSSSDYPHFEELVTRMSEIFTP
FT                   LGVKISLPSLRITEMLKRIPALLQEGRRSGLTLAPEVARDDMREQIRKPINNQDLYDGA
FT                   AEAFRRGWRRVKLYFLIGLPGERPADLDGIVELAERLSRLGKETTGRFAEVTASVSNFV
FT                   PKPHTPYQWNGQRDRNYFEWAHRYLKSKVKLPHVKIKCHDIETSLLEGILTRGDRRVAP
FT                   ALEEAWRRGARLDAWREYHRPEIWEATFRDLGIDVAFFSQRERPLDEVLPWDHIQVKKG
FT                   RTYLAKEQTRSLAQLEAMAAAV"
FT   gene            456005..456637
FT                   /locus_tag="Isop_0316"
FT   CDS_pept        456005..456637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_1412 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60911"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX78"
FT                   /protein_id="ADV60911.1"
FT                   /translation="MMSRQACWDQGGSSSDSHPNPRDGMSEHVIPTWTAADLYRLDLGG
FT                   RLHELVQGVLVAVPSPTPAQARARQATRRLLERHGRRTGGGLVLPEGSGLLTQRQPDTV
FT                   RTADLAFHPNPRWWFDPGDAPQLIPEPPDLVVLVPPEGRSQDEMIRRRVHEYLDAGVLI
FT                   VWTVHLDQQLLTIDRDDEPTLHLERHRQIADLDELPGFAEPVLALFG"
FT   gene            456640..457431
FT                   /locus_tag="Isop_0317"
FT   CDS_pept        456640..457431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0317"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR004033;
FT                   KEGG: psl:Psta_1787 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase; SPTR:
FT                   Menaquinone biosynthesis methyltransferase ubiE; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: ubiE/COQ5 methyltransferase family; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60912"
FT                   /db_xref="GOA:E8QX79"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX79"
FT                   /protein_id="ADV60912.1"
FT                   /translation="MTSAVNSTDTRDLEPSPLSSSATVDKSAAQVRSMFAAIARRYDLL
FT                   NHLLSLNIDRFWRVRAAQRLRDRLADGPAGPILDCCTGTCDLALAFDRVARGSRPIVGI
FT                   DFTPELLSLGAVKLKRRGCAERISLGQGDALRLPFASNTFAASMVAFGLRNVADTTQGI
FT                   DELMRVVQPGGAVAILEFSRPRGPVLGRAYLSFFRAVLPRIGQTIAPNTQNAYGYLPQS
FT                   VLEFPDGPDMVALLEQRGLTDVTAEPLTAGIATLYLGVKPC"
FT   gene            complement(457439..458425)
FT                   /locus_tag="Isop_0318"
FT   CDS_pept        complement(457439..458425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0318"
FT                   /product="protein of unknown function DUF1009"
FT                   /note="COGs: COG3494 conserved hypothetical protein;
FT                   InterPro IPR010415; KEGG: plm:Plim_2359 protein of unknown
FT                   function DUF1009; PFAM: protein of unknown function
FT                   DUF1009; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1009)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60913"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX80"
FT                   /protein_id="ADV60913.1"
FT                   /translation="MFSTVSSSASTSTTAPSPRPLGRPHEGHPRLLPIAPRRKIGLLAG
FT                   SGRFPILFAEAARRQGLEVYCVGIRYEAADELVPLCARFEWVSVTRMNSMIQAFQRMGI
FT                   DEVVMAGKVIKNVMYTPWRILRLWPDRRTVRWWRNLPDRKDDTVLLSLIDEFARDGIRF
FT                   TSALDYCPELLVDHGLLSCRPLSPLERGDVAFGWRLAKAMGGLDVGQSVAVKERAALAV
FT                   EAIEGTDRCIERAGQLCKAGGWTLVKVAKPQQDMRFDVPTIGLSTIENLARARARVLAV
FT                   EAQKTILIDRDLVIARANHYGITLIALTNAEAEAMEAEATAAAKPNG"
FT   gene            complement(458443..459663)
FT                   /locus_tag="Isop_0319"
FT   CDS_pept        complement(458443..459663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0319"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="COGs: COG1044 UDP-3-O-(3-hydroxymyristoyl); InterPro
FT                   IPR020573: IPR001451: IPR018357: IPR007691; KEGG:
FT                   plm:Plim_2360 UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase; PFAM: UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase, non-repeat region;
FT                   transferase hexapeptide repeat containing protein; SPTR:
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase;
FT                   TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; PFAM: UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase, LpxD; Bacterial transferase
FT                   hexapeptide (three repeats); TIGRFAM:
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60914"
FT                   /db_xref="GOA:E8QX81"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX81"
FT                   /protein_id="ADV60914.1"
FT                   /translation="MIPDSSTLAAGTSHPVAEQTTALPTAALPAMTLGELADRLGGRLV
FT                   DTQTASVPLVGAKPIHEAGPGELTFLDGDKNLPLWKSCRAAAVLVNPRFIPPEGCRAIP
FT                   RLEVDDPLMAFAEAVLLFRRPPPASFQGIHPQAIVAQSARLGENVTIHPGAVIGERVEL
FT                   GENVVIHPGAVVQDDCKLGRDCVIHPRAVLYPGVILGDRVVVHAGAVLGGDGFGYRFHQ
FT                   GRHLKVPQLGGLVVGDDVEIGCNTTIDRGTFGDTKIGAGTKIDNLVQIGHNTSIGRHNL
FT                   ICGLVGIAGSCATGDHVVLAGQVGLRDHITIGSRAVIGAQAGVSRDIKPDASVVGSPAI
FT                   PDKEFKAIYAASLRLPRLPNQLREIFERLDRLEASSLSSKIHADVNRNGDADAGSQDDP
FT                   PAESQPA"
FT   gene            complement(459757..462822)
FT                   /locus_tag="Isop_0320"
FT   CDS_pept        complement(459757..462822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0320"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR013655: IPR013656: IPR003661: IPR003594: IPR
FT                   001789: IPR000014: IPR004358: IPR005467: IPR000700; KEGG:
FT                   nde:NIDE1908 putative sensor histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-4 domain protein; PAS fold-3
FT                   domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein; response
FT                   regulator receiver; SPTR: Sensory transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: Response
FT                   regulator receiver domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60915"
FT                   /db_xref="GOA:E8QX82"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX82"
FT                   /protein_id="ADV60915.1"
FT                   /translation="MSRILLSLSMLGMLAGAALVSWLLIPIVGWTNASLVWLPAIVATT
FT                   WRHGATGGIIATALSTLIVACLPILHMDANESPSESPLQELNLPLFASVGLATAIFARP
FT                   GGAIGKLARSWRRRSSTSVTTRPATRIRDWNPLYTTDHGEIDRNARIDLVFSVTTDPIA
FT                   YVDDSGALVTANAEFLVLTTPGERSAPPIGRPWRSWFRGDDLAAIDQAIRQARQWGRAI
FT                   AAVRLARSDGSEREIDLVVIADHDPNDRFGAGLFLVLKDHTELRDTQSKLERRDHLLRT
FT                   VGDHLPETALFQVESSPQGQFRLTHLTQGVETILGLNPDQCLNDYQCLLEKIHPEDRAG
FT                   FLQALRSSALTLNDVRCELRVYDSQSALHWVWVHITARRSADGTTLWDGFLFDLTSRKI
FT                   AEQELRAANQRLESFLDHAPYLAWITDEHERLLYLNHPYRQILGLRDDSPAGRTLAEVF
FT                   GEEKAKACRAANRHLLETNQPFESINTITTADGEERVYLSHKFPLPPEASGNGPRLVAG
FT                   TSLDITQRQRLEQELQRARAEAIEASRVKSQFLANLSHEIRTPIASVIGLIDLLSTSEL
FT                   SEAEREETTSLLRLAAEHLSSMVNDVLDLSKIEAGRMTLEWSPTDPCQVIRAALNLLAI
FT                   QARARGIELVMEPLDQSEPSPPSICTDPTRLRQILVNLISNAIKFSERGGRVTVRYGPR
FT                   IEEDSRWLVIDVVDQGIGIAPDQIERLFTPYTQADETSQRRHGGTGLGLAISRRLAEQL
FT                   GGELHVRSQVGVGSTFTLTLPCPKEASAFEPSISPSENSKNSDFDSAWNPDDSMVPSLS
FT                   RPPASLVNGNGSFPIRPAADIAHSTNRITASTTQHSDPSPSDPPSARVLIVEDNPSIRR
FT                   ILIHYLKRARPPLEITAVEDGIKAIEAAQQTLYDLILMDLHMPHLDGVSAMRNLRSQGY
FT                   SGAIVALTADSLTAQRETCIGLGFDDYLTKPISPDRLNQAIRQRLAACRTRSAGNASGQ
FT                   AEPAATKLVETGSRATNFDRSVNQPRAGFNSG"
FT   sig_peptide     complement(462736..462822)
FT                   /locus_tag="Isop_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(463277..464068)
FT                   /locus_tag="Isop_0321"
FT   CDS_pept        complement(463277..464068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0321"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="COGs: COG1011 hydrolase (HAD superfamily); InterPro
FT                   IPR005834: IPR006439; KEGG: plm:Plim_4115 HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60916"
FT                   /db_xref="GOA:E8QX83"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX83"
FT                   /protein_id="ADV60916.1"
FT                   /translation="MPQSRFFLRLASTNQPIDLILFDVVGTVLVPNPPVWQVYREAAAR
FT                   QGVDLDPQTIKTRFQTAFAQDEARDRQLGSHPGWTTNETCERERWRRIVKETLGPLPDP
FT                   DRAFEELWDEFARSDRWRCPEDARDALARLNQLGLAWGIASNFDGRLRRVLRGHPEFDA
FT                   LGLNKESPNPPGPPRLTISSEVGARKPDRRFFDRIRETAALLPERILFVGDDPLNDGEA
FT                   ARALGFRTVQIDRHAERDHLDDPIAPRVRDLRHLVDQLVPA"
FT   gene            complement(464011..465180)
FT                   /locus_tag="Isop_0322"
FT   CDS_pept        complement(464011..465180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0322"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR000905: IPR017861; KEGG:
FT                   plm:Plim_2513 metalloendopeptidase, glycoprotease family;
FT                   PFAM: peptidase M22 glycoprotease; PRIAM:
FT                   O-sialoglycoprotein endopeptidase; SPTR:
FT                   Metalloendopeptidase, glycoprotease family; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM:
FT                   Glycoprotease family; TIGRFAM: putative glycoprotease GCP;
FT                   metallohydrolase, glycoprotease/Kae1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60917"
FT                   /db_xref="GOA:E8QX84"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX84"
FT                   /protein_id="ADV60917.1"
FT                   /translation="MRLLAIETTCDETGVAVLEGPSPEEPWRVPRIRSSVVASQLDLHQ
FT                   RYGGVVPEIAARAHVRQILPVLRQALRESGVGLEEIGAVAVATRPGLVGALVVGLTVAK
FT                   TLAWSLEVPLVEVDHLEGHLFACQLAFPERVAYPCVGLVVSGGHTSLYRCDGPIDATPL
FT                   GGTIDDAAGEAFDKVASLLGLGYPGGPRIEALARSGNPRRFALPRSFLKEEERLEFSFS
FT                   GLKTAVLYTLQGQPGPPSHPPEPSSPPPPEPGFLADLAASFQEAVVEVLVTKAAQATRR
FT                   TGLRRLAVGGGVAANQRFREALEQMATREGIDLLIAPPALCTDNAAMAGVAFAKLQRGL
FT                   VAPLDIDVTPGLVRPSRPSPPHSSTPPTSASCPNPGFSLDSPPRTNRST"
FT   gene            complement(465214..466266)
FT                   /locus_tag="Isop_0323"
FT   CDS_pept        complement(465214..466266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0323"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="COGs: COG2730 Endoglucanase; InterPro IPR001547:
FT                   IPR018087; KEGG: trq:TRQ2_1074 glycoside hydrolase family
FT                   protein; PFAM: glycoside hydrolase family 5; SPTR:
FT                   Glycoside hydrolase family 5; PFAM: Cellulase (glycosyl
FT                   hydrolase family 5)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60918"
FT                   /db_xref="GOA:E8QX85"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX85"
FT                   /protein_id="ADV60918.1"
FT                   /translation="MSAIWILTCCLVGVDPASATVTPTPTNPSDIFKANARLGRGINLA
FT                   NALEAPVEGEWGVVLEADDFKNVKRAGFDSVRLPIKWSANAKTTPPYTIDPAFARRVDW
FT                   AIGQATTNGLNIIINVHHYNEMDENPADHAERLKAIWKQIAERYKKRPDSVYFELYNEP
FT                   HGNLDAARWNALIPELLRIIRATNPHRPVIVGPAEWNGIHALNSLKLPDDPNLIVTVHF
FT                   YEPFHFTHQGAEWVEGSKDWLGITWTGTEEERKLITEKFDQALEFSRRTNRPIFVGEFG
FT                   AYSKADEASRVRWTRFVVEQCQRCGFSWCYWELRAGFGAYDYDRKAWREPLRQALLEST
FT                   SLDLTNPSRP"
FT   sig_peptide     complement(466159..466266)
FT                   /locus_tag="Isop_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(466324..467526)
FT                   /locus_tag="Isop_0324"
FT   CDS_pept        complement(466324..467526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0324"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000994; KEGG: psl:Psta_2870 peptidase M24; PFAM:
FT                   peptidase M24; SPTR: Peptidase M24; PFAM: Metallopeptidase
FT                   family M24"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60919"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX86"
FT                   /protein_id="ADV60919.1"
FT                   /translation="MTHLDAIRRALREFGLDGWLLYDFRGNNVLARRVLGLEDKPVGSR
FT                   RFFYFIPADDAVGPTKLVHPIEPAALDHLEGTKRIYERWSSLETHLKETLAGTSKVAME
FT                   YAPGLSNPYVSRVDAGTVEAVRALGVEVVSSGDLIQLFEATWDDDQWAMHRQAEAHTTA
FT                   AFDLAFGMIAEALKEGRTITEGQVQKLILDHFDACDMTTYSPPIVAVNAHSADPHFENT
FT                   PATDQPIRPGDFVLIDLWAKLKKPRAVYSDLTRVAFAGSSVPPKIASVFDVVARARDQA
FT                   VTKVRDTLAEGRPLTGAEVDDAARSIIEQAGYGRFFIHRTGHNIGQETHGNGANIDNLE
FT                   TQDQRRILPRTCFSIEPGIYLPGEFGVRSEINVYIDADGRTVHVTGGPVQTEVLPLIPP
FT                   V"
FT   gene            complement(467752..468783)
FT                   /locus_tag="Isop_0325"
FT   CDS_pept        complement(467752..468783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0325"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="COGs: COG3252 Methenyltetrahydromethanopterin
FT                   cyclohydrolase; InterPro IPR003209; KEGG: plm:Plim_2586
FT                   methenyltetrahydromethanopterin cyclohydrolase; PFAM:
FT                   Methenyltetrahydromethanopterin cyclohydrolase; PRIAM:
FT                   Methenyltetrahydromethanopterin cyclohydrolase; SPTR:
FT                   Methenyltetrahydromethanopterin cyclohydrolase; TIGRFAM:
FT                   methenyltetrahydromethanopterin cyclohydrolase; PFAM:
FT                   Cyclohydrolase (MCH); TIGRFAM:
FT                   methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60920"
FT                   /db_xref="GOA:E8QX87"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX87"
FT                   /protein_id="ADV60920.1"
FT                   /translation="MTTPTPSPRRSSEPDSQPESSRLNRRAAREFELLRSRAWEARVAV
FT                   HGVEGGGIVLDAGIAAPGGLAAGRDLARIGLAGLGEVNLVPAGAVGIGPWPGVQVWTDH
FT                   PVAACLASQYAGWALSGAAPKFFAMGSGPMRAVAGQEPLFDKIGHREQADAETGVVGVL
FT                   ETRTLPTPEIVGIIAQRCGVPPETVKLAVAPTASLAGTIQVVARSVETALHKLETLGFD
FT                   LTRLVAGFGVAPLPPVASDDLAAIGRTNDAILYGATVELHVVGDDDSLAQIGPQVPSCA
FT                   SPAHGAPFAEVFRQAGFNFYKIDPALFSPAVVRFRNLTTGRSHSFGRGELEILQRSFES
FT                   SCP"
FT   gene            complement(468806..469741)
FT                   /locus_tag="Isop_0326"
FT   CDS_pept        complement(468806..469741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0326"
FT                   /product="formylmethanofuran dehydrogenase subunit C"
FT                   /EC_number="1.2.99.5"
FT                   /note="COGs: COG2218 Formylmethanofuran dehydrogenase
FT                   subunit C; InterPro IPR002489: IPR017550; KEGG:
FT                   nhl:Nhal_0012 formylmethanofuran dehydrogenase subunit C;
FT                   PFAM: glutamate synthase alpha subunit domain protein;
FT                   PRIAM: Formylmethanofuran dehydrogenase; SPTR:
FT                   Formylmethanofuran dehydrogenase subunit C; TIGRFAM:
FT                   formylmethanofuran dehydrogenase subunit C; PFAM: GXGXG
FT                   motif; TIGRFAM: formylmethanofuran dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60921"
FT                   /db_xref="GOA:E8QX88"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX88"
FT                   /protein_id="ADV60921.1"
FT                   /translation="MVNPTATPWQWFLTIHEGFTELPLLAEAIRPESFTANEVPSGSAP
FT                   PSFKASPDSREPSPSLILGRRRLTLGEVVEVERQPIPASPSSAPPQPRLVLRGDWSRVR
FT                   GIGRGMRCGQLIVEGDAGAGVGADMSGGTLEVLGHAGSFAGAGMSGGTLRIHGNAGDDC
FT                   AGAWPGADQGMSGGWVFVGGRVGARAGRLMRRGHLVIQGDADQALGWEMIAGSIVVLGR
FT                   CGPLPGAGMKRGTLLLAQGTDQLPPTFTRVGPFWSPVLTILLRDLAQRGAFAGQPEGFA
FT                   DHLARRGWVRFNGDRLHHGLGELYLPHDPL"
FT   gene            complement(470272..471228)
FT                   /locus_tag="Isop_0327"
FT   CDS_pept        complement(470272..471228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0327"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="COGs: COG1560 Lauroyl/myristoyl acyltransferase;
FT                   InterPro IPR004960; KEGG: tgr:Tgr7_0480 lipid A
FT                   biosynthesis lauroyl (or palmitoleoyl) acyltransferase;
FT                   PFAM: lipid A biosynthesis acyltransferase; SPTR: Lipid A
FT                   biosynthesis lauroyl (Or palmitoleoyl) acyltransferase;
FT                   PFAM: Bacterial lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60922"
FT                   /db_xref="GOA:E8QX89"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX89"
FT                   /protein_id="ADV60922.1"
FT                   /translation="MRRHGLNFRKFLLRFTFPFLKRLEPRQASRSLSAIGRWEYRHLAS
FT                   VRLRFDRAVEAGKAHFQTDWDVVETARELAGYHIRFRTRDLLLDGLDDERARSVFEIEG
FT                   REHLDEALAQRRGVILLSNHYGGNLMQAHWMIREGYPLRMYMERPRRVSRLMSNYFDQD
FT                   GPLGQKKMFISRKMEPAEAAASVLKASKALRAGMVVMMASDVQWIDSHTAEVEFLGKRF
FT                   RFSTTWVTLAAMSGAPVVQVFSHLEPDGASRLEFLPALSVPPEALRANPTPWMRLALVE
FT                   IERRVAASPLNSNDYFFWLSDPDISVSAAALQHVERH"
FT   sig_peptide     complement(471145..471228)
FT                   /locus_tag="Isop_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(471314..471601)
FT                   /locus_tag="Isop_0328"
FT   CDS_pept        complement(471314..471601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0328"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="InterPro IPR006163: IPR009081; KEGG: drt:Dret_1416
FT                   acyl carrier protein; PFAM: phosphopantetheine-binding;
FT                   SPTR: Phosphopantetheine-binding; PFAM: Phosphopantetheine
FT                   attachment site; TIGRFAM: acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60923"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E8QX90"
FT                   /protein_id="ADV60923.1"
FT                   /translation="MTMRTTPPISGSAVADDLLSQVADEVRRAAKLPADRIMQPSSRLV
FT                   EDLGIDSLDLVGVMLQVQDRFGVEIDDDDVVKLTTLEALTTYVAQRLPQV"
FT   gene            complement(471598..472893)
FT                   /locus_tag="Isop_0329"
FT   CDS_pept        complement(471598..472893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0329"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase; InterPro IPR014030: IPR014031; KEGG: aae:aq_1717
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II; PFAM:
FT                   Beta-ketoacyl synthase; SPTR:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II; PFAM:
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60924"
FT                   /db_xref="GOA:E8QXU5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXU5"
FT                   /protein_id="ADV60924.1"
FT                   /translation="MGDQAGRGQGGRVFVVGLGAVTCLGSTLEETWAGLIAGRSGLKRH
FT                   ESMPRDRFLQDIAGVVETFQPGPAEMIGEAAKLEVRSIHFALEAAREAWRDAGLHERQT
FT                   PSRDSFDPDRVGVLVGSALGGMDLFENEVAKAAKRTTLAVSPYLIPGLIINQEAGQIAR
FT                   QLGVFGPGFAPANACASGGHAVALGGMMIRAGEIDLALCGASESALTPMIVNGFATMKA
FT                   LYAGKPGDRAESDPSQASRPFSGDRAGFVLAEGAGMIVLASETAVERMGLRPHAELLAW
FT                   AVNSDGHHMAMPHGARIEACLRTALDRSGLEPEAIGHYNAHGTSTKVNDRVETQAIKAV
FT                   FGSAVSNLAVASIKGALGHALGAASAIEAAVAVRSLSQGIVPPTLNYQPDPELDLDFVP
FT                   HQARRIDLSAVMSASFGFGGTNNALIFGRIAS"
FT   sig_peptide     complement(472819..472893)
FT                   /locus_tag="Isop_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            473151..473918
FT                   /locus_tag="Isop_0330"
FT   CDS_pept        473151..473918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0330"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro IPR001451: IPR018357; KEGG:
FT                   scl:sce6563 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial transferase
FT                   hexapeptide (three repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60925"
FT                   /db_xref="GOA:E8QXU6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXU6"
FT                   /protein_id="ADV60925.1"
FT                   /translation="MSSLTRLRRFLATADHPAARLVRSLRRGVRTFHLPAPRLVVVPLA
FT                   NLYLVCRETWAFLLRVLVCEPYFKAFCTRYGRNLRTGEFLHYVTGRGVIEIGDDVTLDG
FT                   KIDIAFASRFSDRPTLRIGDRTGLGHQCRLVIARAITIGSDCRIAGGVVLFDSSGHPSD
FT                   PQRRRAGEPPGPEDVKPIVVEDNVWIGMNATIFPGVTLGEGSVVATGSVVMADVPPYTM
FT                   VAGNPARKVAKLDPPPDSQQVDPTPLHVAQPVP"
FT   sig_peptide     473151..473318
FT                   /locus_tag="Isop_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            473973..474218
FT                   /locus_tag="Isop_0331"
FT   CDS_pept        473973..474218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0331"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="InterPro IPR006163: IPR006162: IPR009081; KEGG:
FT                   scl:sce6564 hypothetical protein; PFAM:
FT                   phosphopantetheine-binding; SPTR: Putative uncharacterized
FT                   protein; manually curated; PFAM: Phosphopantetheine
FT                   attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60926"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXU7"
FT                   /protein_id="ADV60926.1"
FT                   /translation="MNPTSTSGTPVAEIVDMIKRLGKLESLDPSVDFYEAGFSSINALQ
FT                   LLTELEDRFKVTLADDDFIAARTAVALRDLIDAQRR"
FT   gene            474277..475530
FT                   /locus_tag="Isop_0332"
FT   CDS_pept        474277..475530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0332"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="InterPro IPR002314: IPR000408: IPR006195; KEGG:
FT                   scl:sce6565 hypothetical protein; PFAM: tRNA synthetase
FT                   class II (G H P and S); SPTR: SerS1 protein; PFAM: tRNA
FT                   synthetase class II core domain (G, H, P, S and T)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60927"
FT                   /db_xref="GOA:E8QXU8"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXU8"
FT                   /protein_id="ADV60927.1"
FT                   /translation="MMSPQTLTITLAKPANDMVQEEILKQIPHLSPRLARPRFASDGLT
FT                   VEVDWVGEPADQGKASTSEDLSAHIEELRGRIAAVCAKVQRGLRSLERKIVYTAQAEAQ
FT                   LGQPDFFRGAAHLDQPPGVHFTGLGQAILEGAPLRLFEAIDRRIVTLGRAYRAEPMRIS
FT                   TLIPPDTLAKCDYFRSFPHTVTFASHLLEDADRIDAFRNRHAEINHLDDHAAADLDQPK
FT                   ACLSPAACYHVYKVYQGRSIPAEGVVRSVCGKCFRYESAGLGGLRRLWDFTMREVVFLG
FT                   TADHVLKLREQAIVQVGEILEEFGLAGLIRTASDPFFIAPDSVGKTYFQLSSATKYEVA
FT                   LPLPDGSRLAVGSLNYHTDFFGRAFDVTNAGGGFMHSVCIAFGLERFVHAFLARHGCDP
FT                   DGWPRAVRDHLGDGQGVC"
FT   gene            475534..476667
FT                   /locus_tag="Isop_0333"
FT   CDS_pept        475534..476667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0333"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000182; KEGG: scl:sce6566 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60928"
FT                   /db_xref="GOA:E8QXU9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXU9"
FT                   /protein_id="ADV60928.1"
FT                   /translation="MTSRGATSDGRIEFPAWTDGIKPMAACLRAAWPPPRLDQSPTYLR
FT                   WCGRDDPHAALALASDASGRVFGSVGLVPRRFRIGCDHEAQEGWLLSFVAVDPSRRGEG
FT                   WAGRLYDALLNRVASEARVSRRPLRPILGFAPVATSGEHLLRSRVVRAGYSAHDLGCLQ
FT                   TYVRLTRPEDAPPRLDSAVWTLVSGDSQEQTHSSTDWVSEYRTLIYQGGSLGSESLLTE
FT                   ADDPVAWLAWANDPRGRVVVIHRRHDGRLDWAAGLVWAVVAEADQVRRVLQVERVVITP
FT                   DRPPIWAELAELGDYLAANGCGSRGEPRFDPKAPPPILSIAFDPTRPATASGPWTDPRS
FT                   ARFRAVGAAFRAIWFTPTCESSTPNRMNPTWTHLEII"
FT   gene            476861..478060
FT                   /locus_tag="Isop_0334"
FT   CDS_pept        476861..478060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0334"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: psl:Psta_4753
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60929"
FT                   /db_xref="GOA:E8QXV0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV0"
FT                   /protein_id="ADV60929.1"
FT                   /translation="MSQSQSIVLPRVSVEPPPPPVPIRATREPVRVALIGVGLVSRDHH
FT                   EPGLRLDPRARLAAIADADAALLERRRVEWSDGEPIKTFTVERLPELFADPEIDAVVIA
FT                   TPNHTHKDLAIAAAQAGKHVMCEKPLGLDAHQARAMTAAAEAAGVVNMTAFTYRFAPSM
FT                   RYLRHLLRNGDLGEPRHFRSQRFLDLPETSWGWRQYKATAGAGDLFDMTIHRLDFAMDL
FT                   LGPLARICGAVARFAPRDRDASGNPCAPSEVDDWSALIGEFRRGAVGVWEGTTLAKGYH
FT                   VGGYGHEWAEVNGSEASAVYRMHEPNTLLLGRHGGDLEPIAVPNAFLKPSGSPRDPAQG
FT                   KPATVFRYDLMWEFVTAIVEGRPAVPSFRAGLNAQIVADAVLVSHQRGSWVEVEPVSLA
FT                   "
FT   gene            complement(478090..480870)
FT                   /locus_tag="Isop_0335"
FT   CDS_pept        complement(478090..480870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0335"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: sth:STH913 peptidase; PFAM:
FT                   peptidase M16 domain protein; SPTR: Peptidase M16 inactive
FT                   domain family; PFAM: Peptidase M16 inactive domain;
FT                   Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60930"
FT                   /db_xref="GOA:E8QXV1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV1"
FT                   /protein_id="ADV60930.1"
FT                   /translation="MSSSPLYSPRTERLANGLTVITQHDPWAAVAAVQLWFHVGSKNDP
FT                   PGREGFAHMLEHIMFNGSDRIGYADHLKEVFKAGGLDCNAYTTYDQTVYHALIPPEQLD
FT                   LVLWLEAERLAFLKVDQKALDHERRRIEVERTITGSDPLTRQCLKYHSLQFETHPYRNA
FT                   PIGQFAHLRSTAVAELREFWEDYYVPNNATLVVVGPLTHEEVMTTARKNLEWIPARGVP
FT                   PQSSVVEPLPTKPRKHTFTDNEVPLPLVLLSWPTVPSGHTDEPALRLLARVIDKAIRET
FT                   LNKPRQFLGIKLNDIPQAIFTKCDAFFLEEAGCFQILAMRPHFQFSADQLINCIQKIVD
FT                   RVRQAPADADHFTKAHDLLRWDLAIDSCNPHGRALMLGWCGVIQGNPESSNHLWHAIQT
FT                   LTAADVHQCAQTYLIPQRRLVASYRQSFWGKWFRKSDDKDQPVIAPMEDVPAAPERPGA
FT                   VRPENHPEKPPLAPIFAAPRVTTQVERHVLSNGLTVQLLPEPGYPTIRARLTQMVDPRN
FT                   GFPRGTIGFPRGTIDRVQEILLDQSGWAFNSKRQQRNDPLPPIESQIIKKHDCDYGMIA
FT                   IDTLADHLDAAIDCLANLINRAEREGFQKTAVQDARARAGVQRATNPGDVEGNATVRLL
FT                   ERTLLGPRHPYTPDPRAKDDAQAHDRLNPQELQTWWQRHGRPGSASLTISGGFNPTATL
FT                   ERVQTQFRFWRGCDSKNVNLFANPSLVEPTSTRILLRQGPKNGAAWVAVGRPGLPVDHP
FT                   DVPKSLAINEYLIHIPNDRLTHTLRYQRDISMGGGGGFRFWRGAGLFMLFTICPAAAAA
FT                   DAVLALFDEIRRLRVEPPNEEEWTWTRARLVSNLLSNIAGPHERGDGIALAQARGLRSD
FT                   FLEQHMSCLSSMTPEDCVQVARTHLNPNALVVVVTAPPDKTIRKALGRLAPVENA"
FT   gene            complement(480948..481052)
FT                   /locus_tag="Isop_0336"
FT   CDS_pept        complement(480948..481052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60931"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV2"
FT                   /protein_id="ADV60931.1"
FT                   /translation="MIGFLSYPPLQEGTIPFQMTKSVPIDRVPPSSNG"
FT   gene            complement(481049..481738)
FT                   /locus_tag="Isop_0337"
FT   CDS_pept        complement(481049..481738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0337"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; InterPro
FT                   IPR002376: IPR001555: IPR004607; KEGG: sti:Sthe_1363
FT                   phosphoribosylglycinamide formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: Phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60932"
FT                   /db_xref="GOA:E8QXV3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV3"
FT                   /protein_id="ADV60932.1"
FT                   /translation="MSHAPRTPPIGPDDPPLRLAACISGAGSTLANLLDRIETGALRAQ
FT                   VVAVVASRPGIGGLEVARRAGIKAVVVRQTANDSVAAYSQQVFAPLRAAGADLVVLAGF
FT                   LKLLAIPPDYHNKVINVHPSLIPAFCGRGYHGLAVHRAALERGVKLTGCTVHYANDDYD
FT                   AGPIILQRAVAVLDDDTPETLAARVIQAERIALPQAITLHAQGRLLVEGRRVRVLGNPQ
FT                   SEDHPPP"
FT   gene            complement(481740..484658)
FT                   /locus_tag="Isop_0338"
FT   CDS_pept        complement(481740..484658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0338"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="COGs: COG0060 Isoleucyl-tRNA synthetase;
FT                   InterProIPR002300: IPR013155: IPR010663: IPR001412: IPR
FT                   002301: IPR015905; KEGG: mta:Moth_0863 isoleucyl-tRNA
FT                   synthetase; PFAM: aminoacyl-tRNA synthetase class Ia; tRNA
FT                   synthetase valyl/leucyl anticodon-binding; SPTR: Strongly
FT                   similar to isoleucine tRNA synthetase; TIGRFAM:
FT                   isoleucyl-tRNA synthetase; PFAM: tRNA synthetases class I
FT                   (I, L, M and V); Anticodon-binding domain; Zinc finger
FT                   found in FPG and IleRS; TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60933"
FT                   /db_xref="GOA:E8QXV4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV4"
FT                   /protein_id="ADV60933.1"
FT                   /translation="MSTDATGYKATLNLPKTTFDMKANLTQREPQRQAQWLQRDLYGQI
FT                   RQARRGAPVKVLHDGPPYANGEIHMGHLLNKVLKDFVVRWWTLQGYDSPYVPGWDCHGL
FT                   PIEHKVVRDLGPKARQLDASQIRQLCHEEAMKWVNIQSAQFQRLGVLGDWQRPYLTLDH
FT                   RYEAGIVDVLADLVEKGYVFRQKKAIHWDIHDRTALAEAELEYQDITSPSIYVLFPMTS
FT                   GVPSCWGGQPEDWSAMIWTTTPWTLPANLAIAVHPRLDYAGVRYRDPETGAERRVLLCQ
FT                   SLVAKVMAERSVSQYDIVGVCKGADLEIATYRHVFLDRTGRFVLADYVAAEDGTGLVHT
FT                   APGHGAEDYRTGLAYGLPAYCPVDESGRYTDDAPDWLRGKGVFEANPLVVQRLKEDGTL
FT                   FHSAPVRHSYPHGWRSKKPIIFRATEQWFIKVDHNGLRQRVLEQIGQVTWLPSWGQRRI
FT                   EAMVSGRPDWCISRQRAWGVPIPAFRCQKCGHWHMSAATLRHLRDLFRQHGADAWFSRP
FT                   ASELVPPGLTCEACGHDQFDKGSDILDVWFESGASHRAVLSQPPPDGFGLGYPATMYLE
FT                   GSDQHRGWFQSSILTAVAAQGVAPFQTVLTHGFIVDEQGEKVSKSEMEKKYGKGKVPVI
FT                   FSAVPATETYGADVLRLYVASMDYADDVRVGETGIKEASEAYRKIRNTFRFLLANLEDY
FT                   QRFDPERHAPQPSDLVELDRWILGRLNALIRDCEASYNAFEFYRVVQKITQFVNVDLSS
FT                   FYLDAIKDRLYAELPEGPERRSAQFALFRLHDVLTRLLSPILVHTCEELWERLPGSAAT
FT                   AKPESVHLALAPQPDPRFDDQTLADKWTTLRAVRSDCLRELERLRQSKIIGSSQQGRLA
FT                   IATADPQLRGLLESSRDALATVCVVSEVEVVADHPEAVPGVDEPRIRVFAAKSPHRRCE
FT                   RCWNHYASVGSDPRHPDLCARCVRVVERLALAASLDPMKGSS"
FT   gene            complement(485090..488266)
FT                   /locus_tag="Isop_0339"
FT   CDS_pept        complement(485090..488266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0339"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="COGs: COG3696 Putative silver efflux pump; InterPro
FT                   IPR001036: IPR004763; KEGG: mca:MCA2324 CzcA family heavy
FT                   metal efflux protein; PFAM: acriflavin resistance protein;
FT                   SPTR: Heavy metal efflux pump, CzcA family; TIGRFAM: heavy
FT                   metal efflux pump, CzcA family; PFAM: AcrB/AcrD/AcrF
FT                   family; TIGRFAM: heavy metal efflux pump
FT                   (cobalt-zinc-cadmium)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60934"
FT                   /db_xref="GOA:E8QXV5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV5"
FT                   /protein_id="ADV60934.1"
FT                   /translation="MIGRLIEASMRTGWLILTLTGVIVAAGVFAFRNQPIDAYPDISGQ
FT                   MVQVITVYPGRAPEEVERQVTIPIEIALRGVPGVETIRSRTIFGLSVVQLMFHEGVENY
FT                   WARQRVQENLGTVELPEEAAAELGPLATAYGEVYRYELVSDGTFDLMELRTLNDWVVIP
FT                   RLMRTPGVAEVSNFGGLEKQFAVTFRPSDLERFGLTLNDVVEAIQANNASAGGSVLQRG
FT                   SMSFVIRGGGTIQSLDQLERIYVKSVGGIPVYLSDVAQVGLDNLTPSGIFSKDRRDESV
FT                   QGIVLMRRGENPSRVLEAVQEVVAELNADDLPEGVRVVPFYDRQHLVEATLHTVSHSVL
FT                   MGITLVVLVLLLFLGRPAMAFLVALTIPFSLLFALILMYLTGIPIGLLSIGAIDFGIIV
FT                   DGAIIMGEHLARRLGEATRADRLDPQSHPFNPFATVLKAAQEVERTVFFSILMIIVAYL
FT                   PLLSLTRIEGLLFRPMALTMVFAMIGALLFSLFVVPVMSVAVFQRGYREWENPLLRWLR
FT                   PLYGATIQRLLQLRWWVVAGSICLFATIALKIAPQLGLEFLPRMDEGVIWVRANFPEGT
FT                   SLNQTSAYGKRLREIVLECPDIQFVTVQAGRNDSGTDPFPPSRMEVMIGPKPRELWTQF
FT                   QTKDQLVEHLGSRLRAEFPTTRFNFTQPIIDSVTEDTNGTSADLAVEFSGPDSDILMDL
FT                   ARATVELLSAVPGARDVAIEQEGPQPQLVITPVRQWCARHNVKIEDVAKLINIALGGEA
FT                   IGVLYENERRFDITARLDRSFVTSPQAVGRLIVHNAEGLPVPLAQVAQIELVDGQTVIA
FT                   RENSRRRITVRCDIVGRDQGGFVAEAQRRFQESVAPKLPNGYRVAWLGMFENLERARDH
FT                   FIVVIPITVGLIFALMIVTFGSLRAALLLLVSVPFAFIGGVAALWARGMNLNVSTGVGF
FT                   AALFGVSIMNGVLMVRAITARRREGRSLRAAIQQGALDCLRPILVASLVAILGLLPASL
FT                   ATGLGSDVQRPLATVIVWGLFSSTLLTLFVVPVLYDLFRPHVAAAPTNPPPPRPASLVE
FT                   PAGAGSALNV"
FT   sig_peptide     complement(488153..488266)
FT                   /locus_tag="Isop_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(488263..489660)
FT                   /locus_tag="Isop_0340"
FT   CDS_pept        complement(488263..489660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0340"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="InterPro IPR006143; KEGG: mca:MCA2325 RND family
FT                   efflux transporter MFP subunit; SPTR: Efflux transporter,
FT                   RND family, MFP subunit; TIGRFAM: efflux transporter, RND
FT                   family, MFP subunit; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60935"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV6"
FT                   /protein_id="ADV60935.1"
FT                   /translation="MTSPSTTNDTDSQPLGPSLLPSLSPSSASTRQPGRLAPRRAEPDH
FT                   ERMGWGETLQFLAALSVTLGVLGFLLVSSSTTPPSETVEEPRPVSELVQVIGPGQIRVE
FT                   PDGPFASKIEVVSVTRETRADPILTVTGRVAASLRPLNGTGTPQWQFDSPADLTAFTEW
FT                   ERAKADVEFAQIQLVQVRQLAAARIDAQRKLVERLEKLVVAGSETPRDLATERAALIEV
FT                   QITGRREIHEAETALRIARRLEAAQIRQLQQSGLDPTLLESVSPNYDLVIADVPEAMVS
FT                   RVRVGQGCSAVFFGLPDRVFQGRVQSIAPVLSPERRSLRVQFLIDDFDDELRPGMFAEI
FT                   GLGTDLHDALLIPAEAVLHLGRFDYVLAANLQTEHVWNVTRVVVGEPREGRIEVLAGLS
FT                   QQDRVVGSGAILFKPMMREALQLTARNGSSNDEVAVEVPLENEADSVTGPEPGSAGLPD
FT                   QAAEVRP"
FT   sig_peptide     complement(489571..489660)
FT                   /locus_tag="Isop_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(489673..491346)
FT                   /locus_tag="Isop_0341"
FT   CDS_pept        complement(489673..491346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0341"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: mca:MCA2329 outer membrane efflux family
FT                   protein, putative; PFAM: outer membrane efflux protein;
FT                   SPTR: Putative outer membrane efflux family protein; PFAM:
FT                   Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60936"
FT                   /db_xref="GOA:E8QXV7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV7"
FT                   /protein_id="ADV60936.1"
FT                   /translation="MGDRIWNPKAIAIALTMVWAFLGCGSRKEAPVAPHGLVALLDRWE
FT                   QANSTLAVETGQPTAESKPTEPAQTTQDAQAARAEWRDEGQEDGPARGGTEAYPSSSET
FT                   SLPAPLLQDDIRLDEEGQGGTTDLEPRAPAPASILDLNDDVPFERNAKGLTLDQTINIV
FT                   LLADPELRVGFEAINQANAEALTAFLAPNPTINVNQSLLPLVRPFTEDRQGGPPQLDVG
FT                   VEYPIDWFVFGKRAAALQAATLNTQISEAEYADLVRRRVLDATILYYDVLEAEALRDLA
FT                   RQDVRHFQTVETITRRAVQAGGRPRVELDRVRLERLRSEQTLREAQRQLVASLAALGER
FT                   LGATQDTPPLQLAGTLETIEPILTPPSVREGFELAFRMRPDLEAARLKITQADAELLAE
FT                   TRNALPELVTRFGYTRQFQRRAIGFPDADSWGVGLDFTVPLFNRNQGQRARAASVVVQS
FT                   QAELRAALVGLYAELVEADQALRTAAENVRAVAQDQLELATRVRDTLTQAYQEGGRPLL
FT                   DVVDAQRDFRETTRLFIESRADYARALARYNATLGTRLSP"
FT   sig_peptide     complement(491257..491346)
FT                   /locus_tag="Isop_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(491707..493134)
FT                   /locus_tag="Isop_0342"
FT   CDS_pept        complement(491707..493134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0342"
FT                   /product="protein of unknown function DUF1552"
FT                   /note="InterPro IPR011447: IPR017909; KEGG: psl:Psta_3460
FT                   protein of unknown function DUF1552; PFAM: protein of
FT                   unknown function DUF1552; SPTR: Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF1552)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV8"
FT                   /protein_id="ADV60937.1"
FT                   /translation="MSSSFRRISRRTVLRGAGVALALPWLEAMGPLTRLGRAAEHSLGE
FT                   GTKLEGPPVRVAFLYMANGVNPHSWTPQGEGTDWQPSPILKPLVERGLKDDVLVLSNLW
FT                   NAATRSGDGHYVKEAAWLCGTTITRTTGVDLCSGGTSVDQVIARRLGHLTPLPSLELGC
FT                   EPTSTGVDQVVGYTRVYGAHLSWATPTTPLAKEINPKLAFDRLFRRHNAERSTTPEEDR
FT                   SLLDLALEDARALKRRLGRADQVKVEEYLESVRAVEARIAHEASERAARYRDDPAARAD
FT                   IESLGGRVDLYAMDPGRLRERTADHTEHVRLMMDIIALAFQTDTTRVATFMFGNAVSNK
FT                   NFSFLEGVSGGHHENSHHENQADKLAHYERIAAWHVEQYAYLLDKLRSISEGEGTLLDH
FT                   AMIQFGSALRDGNTHNPHNLPIVVGGRAGGRLTTGRHLIYPKDTPLANLYVAMLDRAGA
FT                   PVEHFADSQGPLANLEV"
FT   sig_peptide     complement(493021..493134)
FT                   /locus_tag="Isop_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(493277..495295)
FT                   /locus_tag="Isop_0343"
FT   CDS_pept        complement(493277..495295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0343"
FT                   /product="protein of unknown function DUF1592"
FT                   /note="InterPro IPR013036: IPR013043: IPR013042: IPR013039;
FT                   KEGG: plm:Plim_0129 protein of unknown function DUF1592;
FT                   PFAM: protein of unknown function DUF1592; protein of
FT                   unknown function DUF1595; protein of unknown function
FT                   DUF1587; protein of unknown function DUF1588; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1592); Protein of unknown function (DUF1587);
FT                   Protein of unknown function (DUF1588); Protein of unknown
FT                   function (DUF1595); Protein of unknown function (DUF1585)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60938"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXV9"
FT                   /protein_id="ADV60938.1"
FT                   /translation="MRFARLTPAATDERPNIGPTALAAWCLVGLHLGSFAEATPVAQES
FT                   EPSAGSPSRFEASVRPLLVKHCLDCHNAVRKKGGIDLDQPVDDHAVGRDADFWLRVADV
FT                   LEDRSMPPADRSQPSEEARQAAFHTLEALINEAQRPNDPGPGPIQRLTHRQYDYALFDL
FT                   LGITEPLSKRFPADGAGGEGFQNNGSTLFVPPILLEQYLAAASQAVETADPSRYLVARP
FT                   GGDSGLEPRQAARAVLARFARKAFRRPIDDAELERLLTLYQKAADAGKPFEEAVKLPLK
FT                   AILIAPSFLFIQEQRRFAEFPQSNDGQDHDHTPAGSNPYPISDHELAARLSFFLWVSIP
FT                   DDELNALADAGRLSDPEVFEAQVKRMIADPKARRFAEDFADQWLNIASLRQSVEPDRQR
FT                   FPEYDNDLREAMIREPIVTFTEVILSDRSLFELIDSEHVYVNARLARHYGVEGVEGEEF
FT                   RAVPRPDPSRGGLLTTAGVLTLTSYPRRTSPVLRGKWVLEELLGTPPPPPPSSVGVLPE
FT                   DDRPREGLTFRQRLEQHRSKPDCAACHAKLDPLGFGLEIFDPIGRIRTDIGGEPVDAQG
FT                   VLTSGETFNGPAELKAILLKTKREAFLRNLAKRALSYALRRGLEPYDTPAIQTIVEALE
FT                   ANDHHASTLLLEVTRSYPFRHRRDQPPTLEAVGVSSD"
FT   sig_peptide     complement(495188..495295)
FT                   /locus_tag="Isop_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            495708..497228
FT                   /locus_tag="Isop_0344"
FT   CDS_pept        495708..497228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0344"
FT                   /product="tyrosine phosphatase"
FT                   /note="InterPro IPR004861; KEGG: hypothetical protein;
FT                   PFAM: tyrosine phosphatase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Tyrosine phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60939"
FT                   /db_xref="GOA:E8QXW0"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW0"
FT                   /protein_id="ADV60939.1"
FT                   /translation="MSFQGNESKANEQTLGEAVRSGAACCVAGGWRSLWPFGFLAVWLA
FT                   YAIFTVLYFPNEADPEFPQVVRPTLSPWPPAAYRLAEPGDTIDRAAMYAASVALIYATV
FT                   GLIWALAERTRRRTEGAAWGTAWVVSFLLYFDSCAPYPTWDGWHGWNWRAAFDSKTPTA
FT                   LRIALGGGLVGLLGLAALLAAREGRGWVARARRAEGRVKALLGLALILVGLRLVEWPNP
FT                   EPIGYWPRWCGFGGIASWAAVLLLSFPRLTLGRWTWPARGAALGGLGLLVAFGGFGFWH
FT                   HRPLGRFKEVEAGRLYMSAMPTAEGLELAHARHGFKTIINLFPEATLGRHPDSEAEQRF
FT                   ARTHGIRYLESPGRVELNGAFLRETLDLTRDPAAWPILVHCHACMDRTPAWVGFFRYRE
FT                   KGWELKEVWKAIEQHRGLRPKATVFLLYHHVIPRLGVTWPDPAPFTAWLAGLTRGVPDP
FT                   YDGMLPDPVPAIDPIGSPPARLAADGQQPPDALTRSEPNAATAPPVRR"
FT   gene            497393..498733
FT                   /locus_tag="Isop_0345"
FT   CDS_pept        497393..498733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0345"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="COGs: COG1167 Transcriptional regulators containing
FT                   a DNA-binding HTH domain and an aminotransferase domain
FT                   (MocR family) and their eukaryotic orthologs; InterPro
FT                   IPR004839; KEGG: caa:Caka_0677 putative transcriptional
FT                   regulator, GntR family; PFAM: aminotransferase class I and
FT                   II; SPTR: Aminotransferase; PFAM: Aminotransferase class I
FT                   and II"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60940"
FT                   /db_xref="GOA:E8QXW1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW1"
FT                   /protein_id="ADV60940.1"
FT                   /translation="MTTSTRLAELGLSDSGRRTTPPPISTLMQSALANPNLISLAAGFV
FT                   DPETLPTALVGDIVAEFAHDPALGRQALQYGSTGGSPDLRWRMLAEMEREDRVAEGTYA
FT                   AAFERTLLTTGSQQLLSLAADALLDPGDIVLVDSPTYFVFLGMMASRGVRTIGIETDEG
FT                   GLNPEALAEKLAELEATGELARVKMVSVVSEHSNPTGVSLLADRRLPLVETVRRFSERA
FT                   GRRIVLIEDAAYRGLGFDPEAPEPPSLFALDPQGEVVLHARTFSKTFSPGMKVGFGVVP
FT                   VGLIGPLLALKGNQDFGSAHLNQVILSRAMANDRYHEHRRRVVAAYRRKRDVVLEALEE
FT                   EFGPSGSVGISWTVPQGGMYVWLTLPETIDTGPQGDLFERACREGVLYVPGEFCFAAEP
FT                   TPPRHHIRLCYGLPPVSALSEGIARLATAIRGRLDQIAVSGDALAAR"
FT   gene            498990..500513
FT                   /locus_tag="Isop_0346"
FT   CDS_pept        498990..500513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0346"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="COGs: COG0795 permease; InterPro IPR005495; KEGG:
FT                   plm:Plim_2512 permease YjgP/YjgQ family protein; PFAM:
FT                   permease YjgP/YjgQ family protein; SPTR: Permease YjgP/YjgQ
FT                   family protein; PFAM: Predicted permease YjgP/YjgQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60941"
FT                   /db_xref="GOA:E8QXW2"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW2"
FT                   /protein_id="ADV60941.1"
FT                   /translation="MLGIGILQRYVIRQLLGSFALALLAISSIIVLFLVMAEAAKAGLG
FT                   LDQIVQIAPYLIPGTLPYTVPVALLFSVTVVYGRLAGDNEITAVKAAGLSVWTVLWPCI
FT                   LLSIVLSGALYLAASHVIPEANHAVKRVIFSNYEQTFTTFLRRDRILNNPNWPFVIIVK
FT                   DMEGDDLIAPVFKRRAKINGRDGFDLNIVAKRARLSFDMERAMVRVFLVDATIQPLEVP
FT                   PEELLKNDALRAPLPRDAGDARTIAAIIAREGVFDRPDSLYRIEARGVSDRTLIEPVVR
FT                   RKGRDGDSDLVVTGETAVLADLADRPGLLITFEDPSVRARSRASDVGFINEQILEFPLP
FT                   ANVRVSLPPKIVQEMNADELLDKQAELRELRRNERIRQAVAASMWIASGRLQRVNWPEV
FT                   NRAFREYDDWDYYDRKLETEKQMRIALSCGPFFFALLGAPVGILFAKRDYLSAFITCFL
FT                   PIILIYYPLTLLGINLGKEGVLDPMIALWMGNLTLSVLAGLVLPNVMRH"
FT   sig_peptide     498990..499106
FT                   /locus_tag="Isop_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            500719..501897
FT                   /locus_tag="Isop_0347"
FT   CDS_pept        500719..501897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0347"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="COGs: COG0795 permease; InterPro IPR005495; KEGG:
FT                   psl:Psta_2358 permease YjgP/YjgQ family protein; PFAM:
FT                   permease YjgP/YjgQ family protein; SPTR: Permease YjgP/YjgQ
FT                   family protein; PFAM: Predicted permease YjgP/YjgQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60942"
FT                   /db_xref="GOA:E8QXW3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW3"
FT                   /protein_id="ADV60942.1"
FT                   /translation="MVPRIRILDRQRYWSFVKAYVICFSSLVGLYIVIHAFANVDEFGK
FT                   AAPGLMGVVRAMGFYYLIRISQYYDQLCGVIAMMAAIFTVTFMQKDNQLVAMLAAGIST
FT                   HRAIRPVLVCSVLVSLLAVINQELILPRFQTELSLKPDDDGKRPLPVSNLYDLNEIPIH
FT                   GRKADRARRAMILNATLPIGLTGTLRELEARDALHIPHDHPTAPLKGGWLLRGATISPP
FT                   LEEDEVGPLKKLSRHELNGFPPSTLSQAELGGSDEQSYFFFTNITFEMLTRDPKEWMQY
FT                   ASSGQLIAALGDPSNAADHLAISIQLHQRLLRPFLSLALLCAVLPSVLGGPNRNMFISL
FT                   GYALGTTALFYGGLFLFQYLATRGAISPIDAAFAPLAVFSLLAAMRWSAIRT"
FT   sig_peptide     500719..500832
FT                   /locus_tag="Isop_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(502045..503064)
FT                   /locus_tag="Isop_0348"
FT   CDS_pept        complement(502045..503064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_3310 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60943"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW4"
FT                   /protein_id="ADV60943.1"
FT                   /translation="MFCEWIRRLTPIVVGIGSLSVSGCGGDPAFNPTTAVVIRDTKPTL
FT                   GTPSAPAVTQAQPVAAASPSPAADSEPSNTETTTTAAATQTAEPAAETAAPAAEVKLDA
FT                   GGDAFGTIKGRLVWKGGPPTPPVLVRQGDGSVKDAAVCSYKELIDRRFESGSSSNGVPH
FT                   VFAYLTRPQGSNPVLMQQLLAQKPVVTIDQKYCEYIPFSAVYVVGQELELKSSDPVNHN
FT                   VRYAPLANRAFNQILPPNGSTKVKLTSPERRPTELKCDIHPWMSGWFMALDHPFADVSD
FT                   ENGEFEIVGVPPGTQSLIISFPNGVFINEGRATGQKVVVKAGEVTDLGTIEVDPGLLK"
FT   gene            complement(503412..504227)
FT                   /locus_tag="Isop_0349"
FT   CDS_pept        complement(503412..504227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_3310 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60944"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW5"
FT                   /protein_id="ADV60944.1"
FT                   /translation="MFFAWTRWMALGAAIVVALGLTNPVSFATEGGEPHATPQAYGTIK
FT                   GRLVWDGPLPTPTVLVKKGDRSVKDAAVCSYKELIDRKTQINPETKGVPHAFAYLSRPK
FT                   GSNPERMKELMAQSPTVVIDQKYCEYIPFAAVYVIGQELELKSSDPINHNVRFSPLANR
FT                   AFNQILPPNGSTKIKLDKPERRPTELKCDIHPWMSGWFMALDHPFADVSDENGNFEIVG
FT                   VPAGTQNLIISFPNGVFINEGRARGMEVQVKAGEVTDLGEIKVPASLLK"
FT   sig_peptide     complement(504144..504227)
FT                   /locus_tag="Isop_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(504434..504658)
FT                   /locus_tag="Isop_0350"
FT   CDS_pept        complement(504434..504658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_4095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60945"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW6"
FT                   /protein_id="ADV60945.1"
FT                   /translation="MGRGKLQLAPNSYEAPLPRATHACEPQAQTMLFGMERLEPGWLWA
FT                   YDGTRCSGAVAHRRYVEGVEFLGSTNPRM"
FT   gene            504720..505835
FT                   /locus_tag="Isop_0351"
FT   CDS_pept        504720..505835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0351"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); InterPro IPR002629; KEGG:
FT                   rca:Rcas_2758 methionine synthase vitamin-B12 independent;
FT                   PFAM: Methionine synthase vitamin-B12 independent; SPTR:
FT                   Methionine synthase vitamin-B12 independent; PFAM:
FT                   Cobalamin-independent synthase, Catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60946"
FT                   /db_xref="GOA:E8QXW7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW7"
FT                   /protein_id="ADV60946.1"
FT                   /translation="MRSDSTAPPAPLSRTVGSPARVVEVDRPTPLEATVIGSWSFPGWY
FT                   EALTARIREQPDCFGPFDRAEAVEDATRLAIADQVAAGLQRITDGEMTRVDFNLGFYDL
FT                   LEGLEPLPQERRWGPPAHDQRSKYRCVAPLSAPRGLGTLDEWDRIGRCLPPGTPVKLKM
FT                   PVPGPFTLAGCIQGGAIYADRRAVTEALIPIVNTELKALVAHGVGFLQLDEPSFACHPG
FT                   AAHDFLDVIERVLDGVEAYMSLHLCFGNYRARAVGWRSYRPLFPALGRARVNQLALEFA
FT                   SRELAELELLADLPDTMAVAVGVVDVKNTWVEPPELVADRLRRALAFLPPERLSATPDC
FT                   GFSQTARHIARAKARSLALGAAQVRAEFRLD"
FT   gene            505844..506794
FT                   /locus_tag="Isop_0352"
FT   CDS_pept        505844..506794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0352"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2220 Zn-dependent hydrolase of the
FT                   beta-lactamase fold; KEGG: sli:Slin_6275 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60947"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW8"
FT                   /protein_id="ADV60947.1"
FT                   /translation="MIDHRPDSPPTLIEPVRSDADLVAEIAAERPQPGGATLWWLGQSG
FT                   FLVKFPDLTLLIDPYLSESLTAKYAHTDRPHIRMTRAPLRPEQTAGLVDLVLCSHQHSD
FT                   HLDPATVPEVLRVNPQAKLALPAALWDHALGLGLDPRRLIGLEDGTVIAVPGANLTIRA
FT                   VPSAHETLERDHRGRHLFLGFVIESHEGALRFYHSGDTIRYDGLEQRLGPGPWDLLMLP
FT                   INGRDPSRGVAGNMGIAEGLGLAANLRPRFLIPHHFEMFTFNTADRNEFLRRARQEGEL
FT                   PPEVQPVDLRCGQRWVCPPRRPSASVAASDDMGSV"
FT   gene            506847..508397
FT                   /locus_tag="Isop_0353"
FT   CDS_pept        506847..508397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0353"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="COGs: COG1070 Sugar (pentulose and hexulose) kinase;
FT                   InterPro IPR018484: IPR018485: IPR018483: IPR006000; KEGG:
FT                   plm:Plim_0722 xylulokinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; SPTR: Xylulose kinase; TIGRFAM: xylulokinase;
FT                   PFAM: FGGY family of carbohydrate kinases, N-terminal
FT                   domain; FGGY family of carbohydrate kinases, C-terminal
FT                   domain; TIGRFAM: D-xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60948"
FT                   /db_xref="GOA:E8QXW9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXW9"
FT                   /protein_id="ADV60948.1"
FT                   /translation="MSVTLGIDIGTSGTKTLAIDATGTILASATANYPCDYPKPGWSEQ
FT                   HPELWWNATIQTIQQVMARANLKGEEIKGIGLSGQMHGSVFLDQSGRVIRPALLWNDQR
FT                   TAAECAEIEEKVGGREALVRLVANPALTGFTAPKLLWVRRHEPAHWERVRQVLLPKDYI
FT                   RYRLSGTFATEVSDASGTLMLDVANRRWSYELLGKLDLDPALLPACYESVEVSAQVSAS
FT                   AASETGLAAGTPIVGGGGDQPAGAIGNGIVRPGVVSATMGTSGVVFAHTSELGFDPLGR
FT                   LQRGCHAVPGAYHVMGVVLSAGGSFQWFREEMADSEAHAGREHQVDPYELLTREAALAP
FT                   PGCEGLVFLPYLTGERTPHFDPDARGGWIGLTVRHDRTHLIRAILEGVTFAMRDSLELI
FT                   RAMGTEIREIRVSGGGAKSDLWRSIQANVYGCDVAIPNSTEGPAFGVALLAQVGAARSF
FT                   NTIEEACDATIKTVDSTAVDPKVRKVYDQVYAVYRDLYPALRESNHRLAEIARATTSV"
FT   gene            complement(508559..512821)
FT                   /locus_tag="Isop_0354"
FT   CDS_pept        complement(508559..512821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0165 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60949"
FT                   /db_xref="GOA:E8QXX0"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX0"
FT                   /protein_id="ADV60949.1"
FT                   /translation="MSSSHDRGPSHAHDTPPPPRGSGPPRSHRRRGRRIAAVLAATTIL
FT                   VVVGLVVVALVMVPDWIARRIEAQIDARVRLDGWWIGPNGVGLTNLILEPLTPPVDAQD
FT                   GDRIVAVDSIALQGRWGDLLAGRLSSTVLTLSGVKTTLRFDEEGHLLSPLPAFRESLDP
FT                   QTDFTPPALIRLERADLTLIQGSRSEHFQPVALEATPGPRGWSLVGGLENERLGTWTLD
FT                   GFINEDFSTIRLTARGRSLPLHRIYPTLPLAPPEIWDDFQPLSSLQSMLLEIVWDGSDG
FT                   DAAGGENQGELSYRIEADLTESSWSFPRAAMTGRARDGGLLITPTTIELRSVTLDTLGG
FT                   QLKVGGTLDLSRNPSPGTVRLSAINLDLQRVPDTWGLERFATSGRLSGEATVKLLWDDQ
FT                   GFDFTGSQGQAEIRNALIQNTPVRNLRVTLTAKDRQLTFDQGQTAPIASGEGWFLRLPE
FT                   TVQTQIKLDKVDLGRLARIAAGVGLDPGLAIQGRVSVEAKAVIPLRDLGDWTRYGLDGS
FT                   IRLIEGQFDDLKLGPVTARVKLNDGLLELDDVVGTILDDHTQPNHTPHHTNIHINTDNN
FT                   PRTNTDTNTNAEANAATQDREPPRNGFRVAIRASLKPNGRATIDLATRETPLPPGFLPG
FT                   FTGRVSMIGQGSAPMTSLSNPSAWQAALEIKDANVSPPSLLASWTRQPLNAAAKLRLDQ
FT                   GQLVLEQARVLWAGQPLNGSGELGLTAPYNFTLRLTLTDWDVPRLAAQLAPQLAARRPE
FT                   GQISATVDLTGQLDPPLVTTQGRALATQARLEGRALGPVSVAWRPLERVVENANPGTPA
FT                   TIASENLDPARSLAIEAELLGASWSLTAGPIATASKPDGEAPPRLDPAAAPASSPSPRW
FT                   WSLVGTFRNLDVSRVALMARGDPPPHAGVTSAPLAGIASGSFRLVTDGGLPKGRLRIVA
FT                   NPLQFDALTLRAVDLNAVLSSDSLRYELSGDTLQGRFELRGDLPFNAEDAALALDGPKT
FT                   ASIRASELALGELLAVTGQSEILRKLTGRVNVAANLHLDLQTLSVRTGTVAEARDLGWD
FT                   GSPPLGWIRATARSSPDRWRLDPLVGQFAGGKLVGNGEGNQRADGVWMNRLDLTLNQGD
FT                   LSQLMTAFVDPSWGNRVKGRVNLDVRSRSVGSTWTGNGFVEAPQTRIASFPLNNARIEF
FT                   DWRLGLEMVPPPLQITARRFAGSLAGGSVVGDFDWRSSGLPQSQSLDLNARFTEMNLAV
FT                   LARSLPELPGNASGVLNGTLKLKQANERLSGDLNAELRQAMLFELPVFSQISDRVGLNR
FT                   VGVFERGRLTSRIVTNGLLVESLELQGPVVQMAVTGTVGFDRRLDLEVLVSNNQIVTEL
FT                   SRVLIPRLPVINRLAGEGVGVLDNIIGVLSEQLLKFRVTGTLDDPRVTPDPTIRVTPRA
FT                   ARFFSELLNLPRNLIPLP"
FT   gene            complement(512860..513771)
FT                   /locus_tag="Isop_0355"
FT   CDS_pept        complement(512860..513771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pan:PODANSg5339 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60950"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX1"
FT                   /protein_id="ADV60950.1"
FT                   /translation="MAKDRRSRDQKRKAKQERKVRRGPDQDEVLAYHGGKYRKDPKLHP
FT                   VFEAAEQGIHEADVALNYSLSDSVVVNAMQTLIQGLRKGTLPELVDPDAIENPERDPEG
FT                   FVIACVRASWETRLKTNRPSRDAQVGVLRTMLGGIECRPEDASIGWPILGGSTRGYLGH
FT                   LRLARSKSRDLTRRLLGTNLAPAPCASPSTSTDSEPEDLEDLEDLDKLPDPIPGLIGRG
FT                   LLSRVTLPSHRPSLVPANPMIEAANPLLGLLRGLAAHQARHQSSANNALEHPGEPLKTI
FT                   EPEDSAASSTASTAPTTQLEST"
FT   gene            complement(514059..515504)
FT                   /locus_tag="Isop_0356"
FT   CDS_pept        complement(514059..515504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_0529 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60951"
FT                   /db_xref="GOA:E8QXX2"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX2"
FT                   /protein_id="ADV60951.1"
FT                   /translation="MGGSLVPDLGISPFNWLILSWLAVVILFFKFNRLVSVRNLDLCLL
FT                   FILSPGLMQLVSEPDAQRAWGAYVWLLAGSGLLLARCLVDLGLPRRPVLEPNLNTPGLF
FT                   TLTVALLALLMAETIELPLAHGARRNPAERPERIDEARRGPTVVEAVEETLDSVPAGLP
FT                   KHLPLPSLPERFREDRLREWVSRGLAMGSHLTIVGGLWWLGHRLHGRREIGLAMAACYL
FT                   LLPYTRVALVDSGQLVASALIVAAIVARDRPWICGLLITTAAAWIPACVGLVPIWALRT
FT                   RDRATLKFLASASVVVASSLMVQTLLPEATSWARALGARSFKEAGLQLSDLEFNFTSPP
FT                   EDPPSPQPGVPSQPAANSTPVTSLWSGLEPSYRIPVLTLALAFVMLVSFWPAQKTPAEL
FT                   IAVSCATLITSQFWYLDHGGTLVALYLPLLLILIFRPSRTSPLRRVSPTRGRPHALPPA
FT                   SSLKTNSDTASIASSSSGLSRGG"
FT   gene            515613..515831
FT                   /locus_tag="Isop_0357"
FT   CDS_pept        515613..515831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0357"
FT                   /product="bromodomain containing 2"
FT                   /note="KEGG: cfa:474868 bromodomain containing 2; SPTR:
FT                   Putative uncharacterized protein Brd2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60952"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX3"
FT                   /protein_id="ADV60952.1"
FT                   /translation="MIGSPKAPLIVVFPSSSGNRTYRPRRDETGPPLASKEPTSDRPDP
FT                   AQREELDRRGELSEQVRFVLPGRADSG"
FT   gene            516025..516765
FT                   /locus_tag="Isop_0358"
FT   CDS_pept        516025..516765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:797750 KIAA1447-like; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60953"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX4"
FT                   /protein_id="ADV60953.1"
FT                   /translation="MTPSLMIALGLVGLNPSFDPVQVDPPSATAKSPLELSARSDPPAT
FT                   STSSRRLRRRALTAVNRLELELRISGQGHQAMEVEIKPGHSACFFQPLHLRLDSGAAPS
FT                   MMIRDVVVRSFSVDRDASVEIILREPGHPPKSTRRAVRLLKSPPELLSALQSFEGNRAE
FT                   SQPAHASKDSPQTNQNDHDEHGDDRRQQQEQEALARLEQQLGELIPRQKVTCYLLAPST
FT                   SSPGNSLARDTPSQPTPIPSKIKR"
FT   sig_peptide     516025..516114
FT                   /locus_tag="Isop_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(516928..518379)
FT                   /locus_tag="Isop_0359"
FT   CDS_pept        complement(516928..518379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_0766 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60954"
FT                   /db_xref="GOA:E8QXX5"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX5"
FT                   /protein_id="ADV60954.1"
FT                   /translation="MRPEPNSPPTTSTAPSPETPLHDPRYPERSESRRIVLGLVTAVAV
FT                   GLSLGATLRIPTLIGANDISRWCTIWALVEQGTYRINDCPWQSQTQDKIARENPDDPEK
FT                   PDFYSSKPPLLPTLIAGIIAPFRAVAGVPLDAVIREQERTPRRDRPDEKPEPIKWQAHV
FT                   YYFKPVLILLNIVPLWVVLILYARFLDRHAGPRDWPWMAALTASALAMPWFSFLTTLNN
FT                   HTVGVMCVWVTVLALARLVEGDRKRVTFAVAGFFAAFAACNELPALSLTALALLITLGI
FT                   EPGRTLRVFVPAALVPIAAFLLTQYLALGQFTPAYAEFGTSSYLYKDSYWQEPLEMDAL
FT                   DEPKPIYFFHLTLGHHGMIGLTPVFLFALIGWVRAWREAKVLRPLLAATLAATVVVVGY
FT                   YTLKTNNYGGSTQGARWLFWLFPLWSICLPYGLMSGSDRRWLRRLFWLALVVSVMTVGY
FT                   ALRSPWSHPWAVDLLEHLDLYPLKR"
FT   gene            complement(518458..519615)
FT                   /locus_tag="Isop_0360"
FT   CDS_pept        complement(518458..519615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0360"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: plm:Plim_1158
FT                   glycosyl transferase family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase family 2; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60955"
FT                   /db_xref="GOA:E8QXX6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX6"
FT                   /protein_id="ADV60955.1"
FT                   /translation="MFTPLPPRRAEIAAVSSSIPATDRSAVVPTGVVEVMNAPRTQVHD
FT                   ETNVAQPAVPPELSVVVPVKDERENVAELHRQLVAALESTGRSHEILWIDDGSRDGSWE
FT                   VIAGLVAADPTGRVRAVRLRRNFGKAAALTAGFQKARGRLIFTLDGDLQDDPAEIPRFL
FT                   EAIDANGGLDLVSGWKKTRHDPWHKVYPSLVFNAMVSRLSGCQLHDHNCGFKLYRVEIL
FT                   REIRIYGELHRFVPALAYARGFRVGELAVNHRPRTHGRSKYGVERFVKGFLDLLTVWFV
FT                   TGFRQRPLHILGPLGLLFLATGVFGLTWLALEWLAGVRPIGTRPFLSYSAVSLSIGAQL
FT                   LSLGVLAELLTFYQHRPSDAYSIAQSLGFCEDNKPPLSGNRAGDS"
FT   sig_peptide     complement(519538..519615)
FT                   /locus_tag="Isop_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(519642..520709)
FT                   /locus_tag="Isop_0361"
FT   CDS_pept        complement(519642..520709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nda:Ndas_3773 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0104)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60956"
FT                   /db_xref="GOA:E8QXX7"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX7"
FT                   /protein_id="ADV60956.1"
FT                   /translation="MTQGRDDGSEPPNPAASVEPMDISTGRWTHLAPWIKGAIGVLVLA
FT                   AVGWQIWKTIEEFRERGLTLTIEPNGMIAAGLLYMAGLVIQGSYFYVLLRSSTHPISWL
FT                   AAVRAYVVGHLGKYVPGKAFVVVMRVGLATPFGARAGSVAVAAFYETLLMMAAGGLMAG
FT                   VGFVMAGRSLSNAAFLATLGSGVGLMFLVMCEPRVFNFLTRTISRRWPEAQASFPKINP
FT                   RTLVLGLVMGLPTWTLWGLGHVAVIHGLGNEVAPPLWPILIASVALATVLGFVVAVLPG
FT                   GLGVREWVLMVTLEPLLGLSLAVTSTLALRLIQVFAELVVSGIVLGAIRPPAGRSAVGD
FT                   ESGGTLPAPPDGSGA"
FT   gene            521268..522191
FT                   /locus_tag="Isop_0362"
FT   CDS_pept        521268..522191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rcu:RCOM_0939530 protein binding protein,
FT                   putative; SPTR: Proline-rich extensin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60957"
FT                   /db_xref="GOA:E8QXX8"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX8"
FT                   /protein_id="ADV60957.1"
FT                   /translation="MVTATIRVFVVIASLMPLSATLFDDASESFIMFATLSAVVLLAPA
FT                   LTGGFQPLPPPEWELKKLTTFPSPRDRAAGAAALRKYDWRCRPDLIDALVNALSCDPSA
FT                   KVREEAAESLACLAPPSPVAEAALRRAAACDSNLCVRLKSRKGAKAVAASLARSGPIVV
FT                   TTSRRVELAPAAPPALYDFGMPQGPGIAPVPPGFSDPVFVPPPPLGVVPGTVYPMTGRG
FT                   PTQFDTQARVLDRPAPLNRRVDPRPVRDLPPEFYDDPLTGAPGAAPRRAIPTPTRFLTT
FT                   PPPSALLPNPLPPDEIPALLPPRYGP"
FT   sig_peptide     521268..521345
FT                   /locus_tag="Isop_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(522444..524249)
FT                   /locus_tag="Isop_0363"
FT   CDS_pept        complement(522444..524249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0363"
FT                   /product="sulphate transporter"
FT                   /note="COGs: COG0659 Sulfate permease and related
FT                   transporter (MFS superfamily); InterPro IPR011547; KEGG:
FT                   plm:Plim_3748 sulphate transporter; PFAM: sulphate
FT                   transporter; SPTR: Sulphate transporter; PFAM: Sulfate
FT                   transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60958"
FT                   /db_xref="GOA:E8QXX9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXX9"
FT                   /protein_id="ADV60958.1"
FT                   /translation="MSRHVEIPPGPVTGPRAVLADLVAGFLVFLVALPLCLAVARASNF
FT                   PPVAGIWTAVAGGLVATWLSNSQLTIKGPAAGLIVIVAGSVMELGAAFGPDLPEAARLM
FT                   LGYRLTLGVGVAAGVIQILFGVLRLGKLADFFPLPAVHGMLAAIGIIIFSKQAYIVLGI
FT                   DAPADLSPLELLAALPRSISGLNPAVALIGTISLAVLFGLPMVRFRFIRRIPAPIAVLL
FT                   IAVPLGLAMNLEHRHTYLFPDSFFDAFGTEGEEQQHFSRYEVGPRFLVEMPEVLREPSA
FT                   AFEFPDFRGLATWIGLKYVLLFALIGTLESLLSMKAIDLLDPWRRTSDPDRDLTAIGAA
FT                   NVMVAMIGGLPMISEIVRSSANIGYGARTRRANFVHGLFLLAFVLFLPHLIHQIPLAAL
FT                   GAMLVHTGWRLAHPHEFVKTWLIGKEQLAVFLTTIVVTLTVDLLAGIAAGVAVKLALNW
FT                   WHGMPLLAIVRSEIEVEPIETVAYQVTVRQAAVFANWLALKRRLLGLGLHADVTLDLSD
FT                   VRLVDHTVMEKLHGLAAEFEANGGSLRIVGLDNHTTLSKHPLAARKKSTAARPNPLTNP
FT                   DDIDASSNVQRASPEHASGEESNAR"
FT   sig_peptide     complement(524190..524249)
FT                   /locus_tag="Isop_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(524346..525119)
FT                   /locus_tag="Isop_0364"
FT   CDS_pept        complement(524346..525119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0364"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="COGs: COG3260 Ni Fe-hydrogenase III small subunit;
FT                   InterPro IPR006137: IPR017900: IPR017896; KEGG:
FT                   geo:Geob_1699 NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit; PFAM: NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit; SPTR: NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit; PFAM: NADH ubiquinone oxidoreductase, 20 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60959"
FT                   /db_xref="GOA:E8QXY0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY0"
FT                   /protein_id="ADV60959.1"
FT                   /translation="MLSVLAERLRQKHRTIEYPLAPPVLPDRLRGLPIVDASRCPSGCQ
FT                   ACAEACPTNAIRLDPAGPVIDLGKCLFCTECTTACPQEAIAYTTDHRLAVRRRDDLLRR
FT                   GDAYRLAEKLDAKALRLFGRSLKLRQVSAGGCNGCEADVNVLNTVVFDLGRFGIQFVAS
FT                   PRHADGLLITGPVTKNMVLALEKSHEAVPAPKIVIAVGACAISGGPFAGHAEQSNGADD
FT                   VLPVDLYIPGCPPHPLTILDGLLRLLDKLPEPSIP"
FT   gene            complement(525132..526658)
FT                   /locus_tag="Isop_0365"
FT   CDS_pept        complement(525132..526658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0365"
FT                   /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /note="COGs: COG3261 Ni Fe-hydrogenase III large subunit;
FT                   InterPro IPR001268; KEGG: geo:Geob_1700 NADH dehydrogenase
FT                   (ubiquinone) 30 kDa subunit; PFAM: NADH dehydrogenase
FT                   (ubiquinone) 30 kDa subunit; SPTR: NADH dehydrogenase
FT                   (Ubiquinone) 30 kDa subunit; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; Respiratory-chain NADH
FT                   dehydrogenase, 49 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60960"
FT                   /db_xref="GOA:E8QXY1"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY1"
FT                   /protein_id="ADV60960.1"
FT                   /translation="MTMTAHALPAVANATPLPLAEVPDWSFTAFRAAVLDELAAGNFLS
FT                   AFFGVPDGPDAIRLYAVVTRPDVGTIGVAATRVIDSFPSLTPDAPQAHWFEREIAEQWA
FT                   VVPVGHPWLKPIRFHPSYRDGHDAWRRPSDHIHPGVTDFFRAEGSEAHEVAVGPVHAGI
FT                   IEPGHFRFQCHGEEVLHLEIALGYQHRGIERRLVNGPDKRTIVYMETLAGDTTIAHTTA
FT                   YCQAVEALAGLTPPPRAHALRGVALELERLANHTGDLGALAGDVGFLPTASYCGRLRGD
FT                   FLNTTAELCGSRFGRGLVRPGGVAFDADPPRATRMAERVAVAIRDLNGAHLLWNSVTVQ
FT                   ARFEGTGVVSQRAALEVGLVGPAARACGVERDVRYDFPTGIWQYTHIPVAVLQTGDVFA
FT                   RAYIRALEIERSAAFVGFQLANLPEGPVRRPCELRLAPDSLVVSLVEGWRGEVCHVALT
FT                   NADGRFSAYKVVDPSFHNWFGLTLALRNQQISDFPLCNKSFNLSYCGHDL"
FT   sig_peptide     complement(526617..526658)
FT                   /locus_tag="Isop_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(526655..528166)
FT                   /locus_tag="Isop_0366"
FT   CDS_pept        complement(526655..528166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0366"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="COGs: COG0651 Formate hydrogenlyase subunit
FT                   3/Multisubunit Na+/H+ antiporter MnhD subunit; InterPro
FT                   IPR001750; KEGG: dat:HRM2_39000 HyfF; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: HyfF;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60961"
FT                   /db_xref="GOA:E8QXY2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY2"
FT                   /protein_id="ADV60961.1"
FT                   /translation="MLWTLLLIPTLSGIAAFGIQRHPLRRILLLTAAVGQFAVTARLWM
FT                   DWPQRPAPILDGWIGLDALGLLVLTICGVLFLAAAVYALGYLEHENHGSLHRDFEEGSL
FT                   FVNEPEAVFTGCLLLFLASMNLVTLSRHFGLMWVAVEATTLFSAPLIYFHRHRRSLEAT
FT                   WKYVLICSVGIALAMLGNFALAAARPPGTAHGNSALLVDDLIALAPQMNPLWLQLAFIF
FT                   FLVGYGTKMGLAPFHTWLPDAHSEAPSLVSALMSGALLNCAFLGVLRGHQVCLGAGQGL
FT                   FSRELLVGFGLLSLLVAGVFIVGQTDFKRMLAYSSVEHMGILALAVGLGAGYAAGLHAV
FT                   NHSLAKGALFLTAGNLLASYRTKSVVEVTGVLARLPLTGWLWLAGILAITGTPPFGIFL
FT                   SEFAILRSIVDQQRPWVAGAYLFLLAVIFLGMIAIAIPMTHRGPSQVQPARLGQVEADH
FT                   TPTPWLMKLPPLVLLGGVLALGLHLPSDLTALLREIADSLTEKGS"
FT   sig_peptide     complement(528119..528166)
FT                   /locus_tag="Isop_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(528171..528821)
FT                   /locus_tag="Isop_0367"
FT   CDS_pept        complement(528171..528821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0367"
FT                   /product="NAD-dependent dehydrogenase subunit"
FT                   /note="COGs: COG4237 Hydrogenase 4 membrane component (E);
FT                   KEGG: dat:HRM2_38990 HyfE; SPTR: NAD-dependent
FT                   dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60962"
FT                   /db_xref="GOA:E8QXY3"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY3"
FT                   /protein_id="ADV60962.1"
FT                   /translation="MTGLLEPALIVVILTNLAITASSRLAFGIRLVATQGVVAGLMPLV
FT                   LSPEEVTVRLVVIGGLTVVLKGIVFPRLLDRTLRQAAVRREEDPPFGYKASIVGGVVTL
FT                   GLAFWLTGPNRMPLPAPLASPLQLPAAVFTLLTGLFLIVARNNALNQVLGYLVMENGIF
FT                   LIGLALALEEPLLLEMGILLDVFFGVLVMGVAIFHISRAFDSIEVDELTTLKD"
FT   sig_peptide     complement(528753..528821)
FT                   /locus_tag="Isop_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(528818..529750)
FT                   /locus_tag="Isop_0368"
FT   CDS_pept        complement(528818..529750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0368"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="COGs: COG0650 Formate hydrogenlyase subunit 4; KEGG:
FT                   gme:Gmet_0374 respiratory-chain NADH dehydrogenase subunit
FT                   1; SPTR: Respiratory-chain NADH dehydrogenase, subunit 1;
FT                   PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60963"
FT                   /db_xref="GOA:E8QXY4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY4"
FT                   /protein_id="ADV60963.1"
FT                   /translation="MIASICHLILALVGAPFLLSVINRTKAWIAGRQGQPWLQPYHDLL
FT                   RLLRKGAVYSRTTSWVFRAGPLIGLAAVLTATTLVPFGQARALVAFQGDFIAFVYLLGL
FT                   ARLVTVLAALDTGSAFEGMGANREVWFSALTEPALMLSLAALAREVGGNGSLSLSVLHL
FT                   GMSAAVWSRTGFVLALVAVAWVVVLLSENSRIPVDDPTTHLELTMIHEVMVLDHSGPDF
FT                   AFILYGAALKLWLFAALFVGLLSPVKTGLPGVDSVIALAEVMGVAVGVGLVESVMARLR
FT                   LPSVPQLLIGACAISSLAFLIERHGVLLP"
FT   sig_peptide     complement(529670..529750)
FT                   /locus_tag="Isop_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(529747..531750)
FT                   /locus_tag="Isop_0369"
FT   CDS_pept        complement(529747..531750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0369"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="COGs: COG0651 Formate hydrogenlyase subunit
FT                   3/Multisubunit Na+/H+ antiporter MnhD subunit; InterPro
FT                   IPR001750: IPR003918; KEGG: dat:HRM2_38970 HyfB; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: HyfB;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60964"
FT                   /db_xref="GOA:E8QXY5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY5"
FT                   /protein_id="ADV60964.1"
FT                   /translation="MLPLLTAIGLLSAGGLVALVLGRKPRAAGTVAATACVAAAGVALP
FT                   AVLAALAGGSPESLVLPWATIPGGAFHLVLDPLAAFFLVLVLVIPAVVAVPLADYLAAT
FT                   EPDRSHGLFWLAYTLLAAAMMVVVLAANVLLFLVAWEVMSITAYVLVVFRDDRPEVRVA
FT                   GWSFLAATHLGTAFLLPMFLILARGGPLEFDVLSAKGLPTALVDTVFLLAVSGFGVKAG
FT                   VIPFHVWLPTSYAAAPGPVPAVLSGVMSKLGLYGLLRVLTMLGPPPVWWAWVLIGLGLL
FT                   SGVLGILNALVQRDLKTLLAYSSVENIGVILLGLGTGLLGLSASPDRGGVALEALGFGG
FT                   VMLHILSHAICKSALFLGAGAVERLAGHTEIDRLGGLLKVAPVVGTTFVVASAGLCGLP
FT                   PLCGFSSEFLIFLTAFEEEARLSSVAMLPPLAVVGGLAFVGGLACYAFAKAAGLTFLGT
FT                   TRGPSVPPQRLGWTASAIFIALAIGCLSLGLAAPVVVGQLAPTIAVATRLPAPVVTAAL
FT                   PEVTGPLGGVTTTSTILLGILLLLVVVRKALLAGRVVATAVTWDCGYARPAASMQYTGS
FT                   SFAEPAASVLGGGAGYSREVPSEMPYFPSEPPVRTDAVDPVKAVIYRPLFNALRATLAR
FT                   GRILQLGRVHVYVLYITLTLLGLVVWVLGVKG"
FT   sig_peptide     complement(531670..531750)
FT                   /locus_tag="Isop_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(531752..532447)
FT                   /locus_tag="Isop_0370"
FT   CDS_pept        complement(531752..532447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0370"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="COGs: COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type); InterPro
FT                   IPR000551: IPR010093: IPR002178; KEGG: gur:Gura_0893
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN;
FT                   PFAM: regulatory protein MerR; SPTR: Putative PTS IIA-like
FT                   nitrogen-regulatory protein PtsN; TIGRFAM: DNA binding
FT                   domain protein, excisionase family; PFAM:
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; TIGRFAM: DNA binding domain, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60965"
FT                   /db_xref="GOA:E8QXY6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY6"
FT                   /protein_id="ADV60965.1"
FT                   /translation="MLLTVRDVSRMLRVSEPTVYRWVQEKGLPVQQVNGHQRLNPVHLL
FT                   EWLAENRIPITGEVFPPGNGAIPRLDHAIECGGVYWDVPGSTPSEVLEAIVDRVPMRPD
FT                   VPRDDLLALLRSREGVGSTSLGSGFAVPHPRYPLVHATVPPTLAVCHLAAPIAWDPNNP
FT                   ADMVQTVFTLIAPTPRIHLRLLAKLMYALSDSAFRNVIARKASAEETITAATAIDEALR
FT                   HPRPTSEAG"
FT   gene            532908..533246
FT                   /locus_tag="Isop_0371"
FT   CDS_pept        532908..533246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0371"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="COGs: COG0640 transcriptional regulator protein;
FT                   InterPro IPR001845; KEGG: plm:Plim_3775 regulatory protein
FT                   ArsR; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; SPTR: Regulatory protein ArsR; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60966"
FT                   /db_xref="GOA:E8QXY7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY7"
FT                   /protein_id="ADV60966.1"
FT                   /translation="MGNQLREFKAGIFQALANPTRVAIIELLRDEGEVSVARITESLGI
FT                   EQANASQHLAVLRSKNIVLTRKEGNQVFYRLRDPILGQVLDLMRTYFQNYLAETTELLA
FT                   DVNHPPRK"
FT   gene            533863..534225
FT                   /locus_tag="Isop_0372"
FT   CDS_pept        533863..534225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0372"
FT                   /product="anti-anti-sigma factor"
FT                   /note="InterPro IPR002645: IPR003658; KEGG: plm:Plim_2057
FT                   anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR:
FT                   Probable anti-anti-sigma regulatory factor (Antagonist of
FT                   anti-sigma factor); TIGRFAM: anti-anti-sigma factor; PFAM:
FT                   STAS domain; TIGRFAM: anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60967"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY8"
FT                   /protein_id="ADV60967.1"
FT                   /translation="MSASPGGGNRRIRYEIVDGVTVVSFVDSRITDEEDINEVGEQLYA
FT                   LVDQHHNILLNFSNVQFLASAALGKLLNLKKRVAAARGKLKLCCISPDLYEVFRITRLD
FT                   QVFEIYDEEQDALNQF"
FT   gene            534567..537257
FT                   /locus_tag="Isop_0373"
FT   CDS_pept        534567..537257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0373"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="COGs: COG0249 Mismatch repair ATPase (MutS family);
FT                   InterProIPR007695: IPR007860: IPR007696: IPR007861: IPR
FT                   000432: IPR005748; KEGG: plm:Plim_4057 DNA mismatch repair
FT                   protein MutS; PFAM: MutS III domain protein; DNA mismatch
FT                   repair protein MutS domain protein; MutS II domain protein;
FT                   MutS IV domain protein; SMART: DNA mismatch repair protein
FT                   MutS domain protein; MutS III domain protein; SPTR: DNA
FT                   mismatch repair protein mutS; TIGRFAM: DNA mismatch repair
FT                   protein MutS; PFAM: MutS family domain IV; MutS domain II;
FT                   MutS domain V; MutS domain I; MutS domain III; TIGRFAM: DNA
FT                   mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60968"
FT                   /db_xref="GOA:E8QXY9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXY9"
FT                   /protein_id="ADV60968.1"
FT                   /translation="MDAIADATPMMRQYRELKARDPEALLLFRMGDFYEMFGDDAERAG
FT                   ELLGLTVTSRDKGPNAVPMAGFPHPALESYLAKLVAAGVRAAVCEQVEDPKTAKGLVKR
FT                   EIVRIVTPGTLTDEALLDPRASNHLAAVVEVKGKLGLAWVELSTARFTLTSTHRLEIQD
FT                   EIARLAPAELLIAETAVDAPWVRALRAAAPGMTITPRPSWDFLADQARQLLCEQFRVST
FT                   LSGFGVNDDAIEIQAAGALLAYLRETQKSALLHLRRLHVHRREEVLGLDETTRRGLELT
FT                   RTLREGKRDGSLLHAIDLTVTPMGARLLAEWLNAPLTNLDALRRRHDAVGDLVEDAALR
FT                   EELRRGLATIQDLERLAGRMGTGRATPRDLVGLARSLAALPTLKARLTARRSAALRQLE
FT                   AQLDLCPEIRQAIDETMVDDPPLALKEGGLIRDGFHPLLDELRDIASGGKSWIARFQAE
FT                   QIRRTGIPSLKVGFNKVFGYYIEVTHQHQSKVPPDFIRKQTVKNAERYITAELKEYEDR
FT                   VLRAEDQARELEYELFIQLRDRVAAEAPRLVQVGEALAQLDVLAALAELAARRGYRRPE
FT                   LVSEPILKIVAGRHPVLDILMPEGRFIPNDLDLGGDSGTILLLTGPNMAGKSTYIRQAA
FT                   VLCILAQMGSFLPVKSATIGLVDRIFARVGASDELGRGQSTFMVEMTETANILHNATAR
FT                   SLVILDEIGRGTSTFDGVSLAWAIAEYLHDVIGCRALFATHYHELVDLETVKPGLRNAN
FT                   VSVLEQNGEIVFLHRIVPGGADQSYGIHVARLAGVPNPVLERAKAILAQLEAQHRRMGE
FT                   SAAHSHSDASRSSEGRAASGTTCTNASAAVAVPGLRRVKTGKGMQASLFAALPDPILDE
FT                   LAAVDPETLDPQAALDLIRRLKQLA"
FT   gene            537404..538792
FT                   /locus_tag="Isop_0374"
FT   CDS_pept        537404..538792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0374"
FT                   /product="FG-GAP repeat protein"
FT                   /note="InterPro IPR013517; KEGG: psl:Psta_0040 FG-GAP
FT                   repeat protein; PFAM: FG-GAP repeat protein; SPTR: FG-GAP
FT                   repeat protein; PFAM: FG-GAP repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60969"
FT                   /db_xref="GOA:E8QXZ0"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ0"
FT                   /protein_id="ADV60969.1"
FT                   /translation="MFRPYAGHPVWFVFAVIVSLVVWDRVMSLAAFGRQETPNPSAFAF
FT                   EGRVIDPEVGKVCYALTIANVNNDQHSDLLALTEESLYVYLAPAWTKARLIDPIPPERR
FT                   DGVCVAARDLDGDGRPELVVGSGWRPFDTTFGGWLELYRSDASEPLRYRKIAELGQFPT
FT                   LHRIRFGPTGIGPDPVVQLVITPIFGVGGKGPDWETGPASRIEALTPPPPDRLADPWTR
FT                   ELLDASLHVVHNLAVVDFLNDGPPYDVLLAARQGVFVLTRTADGKWIRTQIGSGSQDTT
FT                   PAKGASEIKLGRLADGTRMVATVEPFHGDQVVIYTEPRPTMKITPPLGETADEPPTLWN
FT                   RAVIDRGRAWGHGLWFADLDGDGDEELVFGQRDPTPQAARATDPNGPRGPAVMVFDPQR
FT                   ERLANGSSELVWTRHLVDDGGVAVEDLLVHDLDGDGKPDLAAGGRATRNVKIYLNRTPP
FT                   RQTP"
FT   sig_peptide     537404..537493
FT                   /locus_tag="Isop_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(538867..539988)
FT                   /locus_tag="Isop_0375"
FT   CDS_pept        complement(538867..539988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0375"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="COGs: COG4783 Putative Zn-dependent protease
FT                   contains TPR repeats; InterPro IPR001440: IPR019734:
FT                   IPR013026; KEGG: cyp:PCC8801_1300 TPR repeat-containing
FT                   protein; PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; SPTR: TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60970"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ1"
FT                   /protein_id="ADV60970.1"
FT                   /translation="MTRTIVLVTIPILLVGWTWFNLASDDRLERAAEFERRGEYDPQLW
FT                   NQTIRLSLDYLNDHPWSRQAARQAARGLCGRDFPDLAEPYFQRAGTLTQDDLHVRAYAI
FT                   TRSNRRDEAVQAYREIVQRDPTDVLAWQRMGGVLISQSKYDEALEVARRLIELPEGQVI
FT                   GHQMAGLSHHANRDYGPAMDEWDALLKLDPRLEKVTLPHEVFWFYVGFDALQMGRADDV
FT                   LTWLTPVVTQELDSPTLWALIGQAHQLQGEHHQAEAAFRRAVDRAPDYAVGWTYLGRTL
FT                   LALNRPEEAVAALRRAIEQDRDIPAAYYALSQAQTRLGRRDLAQAALKEFQAARKRLDP
FT                   NRQPNANTTDADNDALDIPAPRSDHSDLGSPRG"
FT   sig_peptide     complement(539896..539988)
FT                   /locus_tag="Isop_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(540187..541293)
FT                   /locus_tag="Isop_0376"
FT   CDS_pept        complement(540187..541293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0376"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902: IPR001120; KEGG: plm:Plim_3345
FT                   protein of unknown function DUF1559; SPTR: Putative
FT                   uncharacterized protein; PFAM: Prokaryotic N-terminal
FT                   methylation motif; Protein of unknown function (DUF1559);
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60971"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ2"
FT                   /protein_id="ADV60971.1"
FT                   /translation="MRQRRSGFTLIELLVVIAIIAVLIALLLPAVQAAREAARRAQCTN
FT                   NLKQIGLAVHNYMSANQDAFPPAMVDNLRISTNCDQVPCQDFSIHVRLLPYMEQQPLYN
FT                   TVNFMGAARWGPGANPDPVAGGFWGSKVNVTLATTIINTFLCPSDPNPGVLGVSEITGK
FT                   RIGGCNYPVNMGFNRRFNGWRQQGPGYTAMTWDGAQGVVTNIASFTDGTSNTLIFSEWI
FT                   KGPTGGDPFPVSLSKVYVLNRTSDASGYVPINGSREWAVAEACQNEPITGSTAQWGWKG
FT                   EWWSHGWTQGFHMIQTPNRKACFYADIGTYRPARETSVIGASSLHPGGVNALMGDGSVK
FT                   FIKQTISYVSWYALGTMDRGDVVDASAL"
FT   sig_peptide     complement(541195..541293)
FT                   /locus_tag="Isop_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(541875..542099)
FT                   /locus_tag="Isop_0377"
FT   CDS_pept        complement(541875..542099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0377"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: mxa:MXAN_3772 putative lipoprotein; SPTR:
FT                   Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60972"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ3"
FT                   /protein_id="ADV60972.1"
FT                   /translation="MRFGLLAACAATLSLVVVSGCSESNEKTFEQSVKVDTSAPTTPPP
FT                   TTPEDFKKRFNPNYGTPTGMPKDYPGAGS"
FT   sig_peptide     complement(542028..542099)
FT                   /locus_tag="Isop_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            542530..543105
FT                   /locus_tag="Isop_0378"
FT   CDS_pept        542530..543105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1745 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60973"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ4"
FT                   /protein_id="ADV60973.1"
FT                   /translation="MGACFMVWMTIGMSSWSGLPACSPGLVMVWDGGAGWIPGGSTPPP
FT                   RERATEWLRAMSSRELWTRYRLGVATPLPVGRVKGVALPCPDARFGELISRSAGVVWQG
FT                   KIATEGSNLLLNRFFGVRSVPGRMFWGTSRVDGLPCLLVDYSQTSWVYANVRDELRMIA
FT                   PGVYLGPMFRKQRDGSERFEMFFALIAP"
FT   sig_peptide     542530..542592
FT                   /locus_tag="Isop_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(543119..544087)
FT                   /locus_tag="Isop_0379"
FT   CDS_pept        complement(543119..544087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0379"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR003148; KEGG: rba:RB2059 putative
FT                   nucleoside-diphosphate-sugar epimerase; PFAM: TrkA-N domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: NAD
FT                   dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60974"
FT                   /db_xref="GOA:E8QXZ5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ5"
FT                   /protein_id="ADV60974.1"
FT                   /translation="MISSPFAPPQDDSTDNPGLRDSHPPRPGSVLIVGCGYLGRRIARQ
FT                   LIRQGRDVFGTTRSPAKAEQLRSLGIHPVVVDLTDSTTEVVLPRVAGAIYCVGYDRSSG
FT                   MPQRAVVVDALIATLPRLHARADKLAVASTTGVLGGTHGEWVDETTTAPPLTESGRLHA
FT                   EAEQAILEFGQRHVWPVSIVRLAGLYGPGRLIRRADLLAGRPLSGDPDKWLNLIHIDDA
FT                   AAALIASLDHAPPGAIYLAADDRPLPRRDYYLTSARLLGAPEPQFESNPANPDRPAEPN
FT                   RRVRNRRLKQDLNWKPTHPTIDEGLVAALEEEQRDAHAETF"
FT   gene            complement(544084..544635)
FT                   /locus_tag="Isop_0380"
FT   CDS_pept        complement(544084..544635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0380"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="COGs: COG0816 endonuclease involved in recombination
FT                   (possible Holliday junction resolvase in Mycoplasmas and B.
FT                   subtilis); InterPro IPR005227: IPR006641; KEGG:
FT                   psl:Psta_3924 Holliday junction resolvase YqgF; PFAM:
FT                   Holliday junction resolvase YqgF; SMART: Resolvase RNase H
FT                   domain protein fold; SPTR: Putative Holliday junction
FT                   resolvase; PFAM: Uncharacterised protein family (UPF0081);
FT                   TIGRFAM: RNAse H-fold protein YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60975"
FT                   /db_xref="GOA:E8QXZ6"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ6"
FT                   /protein_id="ADV60975.1"
FT                   /translation="MGTILALDHGLKRVGLAISDPGRSIASPLGRLERPGGEAGFTTEI
FT                   QTLKRLVREHGVDRLVMGLPVHTSGRDSPQARAARQWGDRVAKELGLTIIYVDERYSTK
FT                   HADELMREAGLSAAKRKRRVDSLAAVVILRDYLDAGCPDHAQVAPPIPLDDPLNDSSPT
FT                   PADSNPENSPTAHASSPRIP"
FT   gene            complement(544684..545772)
FT                   /locus_tag="Isop_0381"
FT   CDS_pept        complement(544684..545772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0381"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="COGs: COG0836 Mannose-1-phosphate
FT                   guanylyltransferase; InterPro IPR005835: IPR001538; KEGG:
FT                   ttr:Tter_0486 mannose-1-phosphate guanylyltransferase
FT                   (GDP); PFAM: Nucleotidyl transferase; mannose-6-phosphate
FT                   isomerase type II; PRIAM: Mannose-1-phosphate
FT                   guanylyltransferase; SPTR: Mannose-1-phosphate
FT                   guanylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60976"
FT                   /db_xref="GOA:E8QXZ7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ7"
FT                   /protein_id="ADV60976.1"
FT                   /translation="MNARLHAVVMAGGSGTRFWPKSRRDRPKQLLRLYGATTMLQQTLD
FT                   RVAPLTAPERTWIVTGIDQAEATRAQTPDLAPSQILAEPCPRDTAACVGLAARRIVQLD
FT                   PEALMLVMPADHVIEPAEEFRRAARAAVALIAEDPRRLVTFGVPPTRPETGYGYMETGE
FT                   EIGRPEGLAARRALTFREKPDRATAETFLASGRFVWNAGIFVWKAATILEEIARHQPDL
FT                   AAGLDRLASDLGTDRQSHTLAEIFPTLPKLPIDKAVMERSQQVVVLETPYRWSDVGDWR
FT                   ALAGLGGLDDQGNVLQGPTHVVNTRDSVIIADEGNLVAVLGLSEVVVVQSGGATLVARK
FT                   DALDNLKALVEELPKAGFPHVL"
FT   gene            complement(545830..547287)
FT                   /locus_tag="Isop_0382"
FT   CDS_pept        complement(545830..547287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0382"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /note="COGs: COG4284 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR002618; KEGG: rba:RB6977 UDP-N-acetylhexosamine
FT                   pyrophosphorylase; PFAM: UTP--glucose-1-phosphate
FT                   uridylyltransferase; SPTR: UTP--glucose-1-phosphate
FT                   uridylyltransferase subfamily; PFAM:
FT                   UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60977"
FT                   /db_xref="GOA:E8QXZ8"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039741"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ8"
FT                   /protein_id="ADV60977.1"
FT                   /translation="MTTSSASPPTKLVERLERIGQLQVLRFWNELEETARARLITDLEG
FT                   VDLERLADLIDQFVTHRHAQTPHAIPPLDPSRVGPVETIPPGSRSREEQEEALRAGTDL
FT                   LSRGEVAIVLVAGGQGTRLGFDGPKGTFPIGPVSDASLFQIHAEKIVALGRRHGVEPPL
FT                   FVMTSPDNHQATADFFAAHNQFGLKRLRLFTQGQLPAVDAQTGAILLANRDRVALAPDG
FT                   HGGTLRALAAPGPNGGPSCLDEMEEAGIRTIFYFQVDNPLVKIADPVFLGHHLRAGADM
FT                   SFKVVEKHQPDEKLGVVVMVDGRPQVIEYSDLPAELAQRRDPQGRLELRAGSIAVHAFE
FT                   VAFLRRLVGQGGGALPFHQALKKVPHINAEGHLVQPDQPNAIKFETFIFDALPLAQRFV
FT                   VVETQRDEEFEPLKNATGPDSPASVRQRMSDLYAKWLEAAGAKVERRGDGSVPFGIEIS
FT                   PLFALDAADLKGKVPPGIVVNEPLHLR"
FT   gene            complement(547400..548203)
FT                   /locus_tag="Isop_0383"
FT   CDS_pept        complement(547400..548203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0383"
FT                   /product="Metal-dependent hydrolase of the beta-lactamase
FT                   superfamily I"
FT                   /note="COGs: COG1235 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily I; KEGG: rba:RB11859 PhnP
FT                   protein homolog-putative hydrolase; SPTR: PhnP protein
FT                   homolog-putative hydrolase; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60978"
FT                   /db_xref="GOA:E8QXZ9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8QXZ9"
FT                   /protein_id="ADV60978.1"
FT                   /translation="MMESEVASATRRLIILGSGTSTGVPTLGCDCSVCLSRDPRNHRTR
FT                   PSALFRLPQGDLLIDTTPEMRLQLLRENVRFVHAIAYTHDHADHLMGLDDARLFPKYIG
FT                   GPVPVFCEERVEDSIRRIFHYAFQQEVLSYPFGGVPRLAFRRIQPGIAFETLGERVVPI
FT                   RLDHGRIPVLGFRIGGLAYCTDVKRIPEESLPLLTDLDVLVLDTLRYEEHPTHLSLNES
FT                   LALIERLAPRRAVLTHLSHAFDHHAAEKTLPPHVRLAYDGLMIPF"
FT   gene            complement(548337..549446)
FT                   /locus_tag="Isop_0384"
FT   CDS_pept        complement(548337..549446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_2877 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60979"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY00"
FT                   /protein_id="ADV60979.1"
FT                   /translation="MNRRAWIGTSLLATATAWLFGRPHSVSSSTAPAQPPETKPGEFGL
FT                   DPPQRANPPRVENALPPESGFEYREFDISRYTTKIRHESAAPQQAIADWIVRRTGASRW
FT                   FGERSTSLAVDRQLVRIYHDPRIIRQAADIIDRFNNALADLLSIRLRLIAATDTQWRFT
FT                   VFNRLKPLAVGPTGQQVWTLPIEEGIQILTQFQIDRGFRLLDDQKFEVVNGQPVTIKRV
FT                   VNRNYVSGLQEAGPANFGAQAAVKAIEEGVTLKLDPLLQFDGDEVELAMDLRAVTVRSM
FT                   IRTRVIAPRQVGTPELILDVPEAIESRMELNVPALPTDQMLFISAGILPGILQDRRGLA
FT                   NVLGLSNTNTELLVFLEVKPIRTALGRSR"
FT   sig_peptide     complement(549363..549446)
FT                   /locus_tag="Isop_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            549890..551536
FT                   /locus_tag="Isop_0385"
FT   CDS_pept        549890..551536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0385"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1807 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferase of PMT family;
FT                   KEGG: plm:Plim_3516 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM:
FT                   Dolichyl-phosphate-mannose-protein mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60980"
FT                   /db_xref="GOA:E8QY01"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY01"
FT                   /protein_id="ADV60980.1"
FT                   /translation="MAQDQPSASSCPPVPRSAPLAWRWCLVVGGMACLPVLATLNGPGP
FT                   TVDEPLDVLPGRDYLRKLDQVGVVGFLRSEVIDATYRFNKEHPPLGRWLLGIAATLFEP
FT                   WEETIRGDDPTGLNLRAARVAPALAFGLLCAVMARVGSRVGGVWAGLGAVVLTVTMPRV
FT                   WSHAHLAALDTFITVFWLLALFSLDAATRSRRPLVGCLGAGLVFGLALLTKIHAWLLPA
FT                   IGLVWAILRLGPIQGAIGAGLWGAVGFAVFLAGWPWLWNDPVGRLGAYLSTGVERMSIQ
FT                   TLYFGAVYPDRQVPWHYPWVHVLFTTPPIALMLAGWGAAAVWAGSGPRDPSIRLWIGAA
FT                   LAVLLVFSTHVPVYDGERLYLMVFPLLGLLGGVGLARLAAAAPAGRIARLFWWGGVMAS
FT                   IGLNSLEVVRTAPYGLSYYNIFIGGVVGAEARGMELSYWSEGFDDSLLGELARRVEPGQ
FT                   TVAVAPTLAPGFGRVLTTPALAAREVIPKDQEFVSQADWVLIHRRPAYWTQEVRDLVAS
FT                   TPPVAASRVEGVWIAGLWRRPNPAGRNSRGD"
FT   sig_peptide     549890..550003
FT                   /locus_tag="Isop_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(551557..553050)
FT                   /locus_tag="Isop_0386"
FT   CDS_pept        complement(551557..553050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_1513 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60981"
FT                   /db_xref="InterPro:IPR032267"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY02"
FT                   /protein_id="ADV60981.1"
FT                   /translation="MRWFLCSASIVATSFLTGASGGRESTPEALLKAQPARRLEPAPSP
FT                   VDNPLKGLVPYDNPPPNRFPHSLEFFYLPLSDLMIGPNLFDWSSLERKLDAIARRGNQA
FT                   IFRIWVEYPTLETGVPTFLIEQGVKLTRWRNPFENSWNVTPDYGDERLIKALEQFIAAL
FT                   GARYDNDPRVGFLTAGLLGSWGEWHTWPRDDLAPSPEVERRVMNAYEAAFKQVPILLRY
FT                   PAGPNDPVHADNASRTRFGYHDDSFAWATLDTGREEDSWFFLAALKRAGPQAMARWTIQ
FT                   PIGGEIRPELWDSLFDPHQPPHPKGQNFDECVRQTHVTWLMDSGMFHKPVSPARRQRAL
FT                   ESVRRMGYDFRVTTARLNRQENRRLTVELTVINQGVAPFYRNWPLELGWLDRSTGRVIA
FT                   RFPVDWSLTNLLPDAPARVWRTTLTLPPASGNENNCILALRVVHPLPNGKPLRFANADQ
FT                   DRHAPGWLSLGTPNGGASKPPRPSRPRPRRLAEFGALDD"
FT   sig_peptide     complement(552985..553050)
FT                   /locus_tag="Isop_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(553122..553676)
FT                   /locus_tag="Isop_0387"
FT   CDS_pept        complement(553122..553676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_00898
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-
FT                   D-alanyl-D -alanyl ligase; SPTR: Abhydrolase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60982"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY03"
FT                   /protein_id="ADV60982.1"
FT                   /translation="MSRIVTNVIGATPQLDLPPARGLEGGRLSEAADEAGLGAAVGVVR
FT                   DPIRGLSVPPPHHLHPPMRVVRPEDEGAYSIEVGCDETGAAGEAPFDIPSAGSSDTTDL
FT                   AGLIEREALAFARKGTPLALLIAETLDDLASRVRFTGARSVTEYRERIELLDEWADAEM
FT                   HLQSPQGFDQFLPPLFPDRSF"
FT   gene            complement(553947..554957)
FT                   /locus_tag="Isop_0388"
FT   CDS_pept        complement(553947..554957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0388"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="COGs: COG0863 DNA modification methylase; InterPro
FT                   IPR002941: IPR002052: IPR001091; KEGG: psl:Psta_0519 DNA
FT                   methylase N-4/N-6 domain protein; PFAM: DNA methylase
FT                   N-4/N-6 domain protein; SPTR: Adenine-specific
FT                   methyltransferase; PFAM: DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60983"
FT                   /db_xref="GOA:E8QY04"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY04"
FT                   /protein_id="ADV60983.1"
FT                   /translation="MPPSPPYVSAPPAAPSPPSGATQQPLPPTSPPSPSEPGWDQVIHV
FT                   GDCIAGMNQLEDKSVDLIFADPPFNIGYTYDVYNDRCDDQEYLAWSRRWIEAAVRVLSP
FT                   TGTFWLAIGDDFAAELKVLMHRELGLTFRGWIIWYYTFGVHCKRKFTRSHTHLLYFTRH
FT                   PRDFTFNADAIRVPSARQRVYNDKRAHPLGRVPDDTWILRPQDFPGGFGPDQSVWHVPR
FT                   VCGTFRERQGWHGCQMPERILGRIMSACSNPGDLVLDPFVGSGTTLAVARKLHRRGVGF
FT                   ELSADYAMNACQRLESVRPGDPLDGGDGLETLARPRQPRGSTTSPRRRRASPSTT"
FT   sig_peptide     complement(554895..554957)
FT                   /locus_tag="Isop_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            555180..556502
FT                   /locus_tag="Isop_0389"
FT   CDS_pept        555180..556502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0389"
FT                   /product="repeat-companion domain protein"
FT                   /note="InterPro IPR014338; KEGG: hau:Haur_4051 hypothetical
FT                   protein; SPTR: Leucine-rich repeat-containing protein
FT                   typical subtype; TIGRFAM: repeat-companion domain protein;
FT                   TIGRFAM: repeat-companion domain TIGR02996"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60984"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR014338"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY05"
FT                   /protein_id="ADV60984.1"
FT                   /translation="MMDQDNPDHADVSQGDPRDWAFEAHWPFWEAIRQAEPEDHGPLLI
FT                   YADWLEEQGDPARAEWIRVEVERVAVGPGTWRGRLLADRSRRLAKRLEPVGGVEEEGGE
FT                   EPPGRGCEWNSSLAVGHILGLPRLVRTTAEVFRRRGSWFLRRLPIDHLELHPSITRRPE
FT                   VALSGCESLRAIRWLRLRSRSSLEAALDSPHWSGLRTLDLRELGLTTGDLQLVLETILP
FT                   RTVIRPRTLNLQGNRLGVGGIKALLACPNLQGLKRLNLRYARIRVGGLAQLAQSAGLSD
FT                   LEELNLRHETIGDEGMDHLLSWGRLAGLRVLDLGYTRVGEVALANLLNALDRRLTRGEP
FT                   VALEDLGLAGNPIGSDGLEALAFSQVGARLKRLNLKGVPLTTNDARLLAESPLVQGLER
FT                   LVVGESLADSFTAVPLAEALGDRLELESEYEYSIGFRDDPW"
FT   gene            556599..558125
FT                   /locus_tag="Isop_0390"
FT   CDS_pept        556599..558125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0390"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR003590; KEGG: hau:Haur_4051 hypothetical
FT                   protein; SPTR: Leucine-rich repeat-containing protein
FT                   typical subtype; TIGRFAM: repeat-companion domain
FT                   TIGR02996"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60985"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY06"
FT                   /protein_id="ADV60985.1"
FT                   /translation="MFFRAIERAGEFESSDVVRILADWLEERGDGARAEFLRLEMECER
FT                   TPDWEPVKAGLRRRARELEWAHPTWLAAALPPVLQTAFELKKAQGMFQGLELVGQLGGW
FT                   ENPAEWDLLECGLETLSERMPIRTLALGAVIGQVDLDRLLSWSGWSGLVELEVVGISPR
FT                   TWIRLAERLRRGLPRLTRLHLGRLNRIGPAGVHELLREAPPQTRGGPPQPSLLSRLRVL
FT                   NLFGNRLGGAGLTAITHPKGASATVQAESLETLDLGFNNLKPADLRSLWSWEAAPRLRR
FT                   LSLAQNPLQAEGGSGLLDAVWLEGLVELDLGGTRLPPKTLADLVASPRLKRLKCLRLSN
FT                   LQLDAAVIEQVLAGIGGDPPPRLDLSSNYLDDDGLERLARWSGLARVVELNLSHNEFSP
FT                   SGLKALADSPHTERLKVLRIADNRRLVTPRGLQGLVDSPLADRLTRLDVAAAPGMEEEL
FT                   KALLTRATLALRTSSRKDARLDLGTWSDHAGFWEDVDWFAEPAAEEEVDY"
FT   gene            558392..560050
FT                   /locus_tag="Isop_0391"
FT   CDS_pept        558392..560050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0391"
FT                   /product="repeat-companion domain protein"
FT                   /note="InterPro IPR014338; KEGG: hau:Haur_4051 hypothetical
FT                   protein; SPTR: Leucine-rich repeat-containing protein
FT                   typical subtype; TIGRFAM: repeat-companion domain protein;
FT                   TIGRFAM: repeat-companion domain TIGR02996"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60986"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR014338"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY07"
FT                   /protein_id="ADV60986.1"
FT                   /translation="MTRSPVSEEQVPFLRAILAAPDDDAPALIHADWLEENGQPERAEF
FT                   IRLQIERSRLEETDPAFVALRRREFELLRVWEKEWRREARPFDTASRPFERGYLRSGSF
FT                   SHLDRFRRQAVELIDRVPLQRVRIGGFDQSAHGLETLANHPATPGLTTLALRSRRFLAR
FT                   QMQAFPRCSPERFRSLRVLDLGGHNRIGSSGVEALAGSDCVRGVVTLNLGGNDLAEAGL
FT                   RALTASSCLTQLRALGLRGLFLTTAEVDALDRRGRFGELTRLEVSLCSDDPFAIARLVQ
FT                   GELIRRLERLDLVAHWYPDRLFDELELVPPECLRSLRWLGLEGVLSVEQIQRLGRAESL
FT                   EGIRTLRLNRNALNDEGLVALADAPLLERIEHLDLTFNSFGSPGVRALIESPRLGRLKS
FT                   LRIAQRTTRPIIDALETLIRSPLKNQLRLLEVAYSETNAGVLRRLANDSTMILRLRPIN
FT                   QFGLPATAGLGWEEPWRIELDPPLDRGDTWDHAPSLDPSPFAEPPEFSLASGGGPLRLD
FT                   ARAAAGFAEALRFHSARCFSSGTFAPVVVASSPDL"
FT   gene            560104..561426
FT                   /locus_tag="Isop_0392"
FT   CDS_pept        560104..561426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0392"
FT                   /product="repeat-companion domain protein"
FT                   /note="InterPro IPR014338; KEGG: hau:Haur_4051 hypothetical
FT                   protein; SPTR: Leucine-rich repeat-containing protein
FT                   typical subtype; TIGRFAM: repeat-companion domain protein;
FT                   TIGRFAM: repeat-companion domain TIGR02996"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60987"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR014338"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY08"
FT                   /protein_id="ADV60987.1"
FT                   /translation="MGCVAVRCEVHPLSNASDSLTNADRLALFQTILDDPEQDAPRLIL
FT                   ADWLEEHGEATHAELIRLQIERDDLLQRCPTHPALDDLNYRIDRIAHDVEMRVHRRLPR
FT                   IAGVRWGHWEKGWPRLLQVAKLRIYLDHAAELHAAAPWDRLRIEDAPSLADLVELGSRV
FT                   QAAVLLSTLIFRPNSMDHHRVRELARGTHFKRLRRLVLSGHHINRACVEMLTDSLNLSR
FT                   LKVLDLTESRIGLGGMRALSGSNRLEGLTDLNLSGNFADLGDKGLEALARATSLPRLVR
FT                   LSLARNQLGTDDLDILADSPRLERLEILDLSHNRLPGEALAALLYSPAVRNLRRLHLGG
FT                   NAIHAAALREIADSPRLERLEILDLTPIAATPKLADMLTCSIIWPNLAQIVLRRPDDLT
FT                   HHQIDQLHERFEGKLRLWTSRLPTRKTALETTWIDHEVSVW"
FT   gene            561665..563305
FT                   /locus_tag="Isop_0393"
FT   CDS_pept        561665..563305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN8715.2 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60988"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY09"
FT                   /protein_id="ADV60988.1"
FT                   /translation="MGLFGQLWRGGKKSGTAQPVVQTFELACPDCGATIQGRRHESYQA
FT                   IRCPVCRGGVFVLPRSPFAEPPPPPFREPTRVLAGPVAPMMSGTPDDRFRAVDDPVVPD
FT                   IAWTEAERAFEPTPDPSRDRSADLAVVEDEPLEIVWTDEQEDPAPPPPPKPPARPRSTR
FT                   TASTHAAPSPPPTSQPPSPASPPAAKKGKSAAPTAPLPSVDRLNTAQGRPRQDTPPAQP
FT                   FTEADQRITWSEWVQTRRRVLIMLAVVGFVGVTIWQNLRQARLEEYPRIVAEGYERGIP
FT                   ALEAGQFDLAKQLLADALRAVEGLGGQVEHAAEIRQAAREAFLYADLCRESLETVLDEA
FT                   ARSDPVEWPIRFRRLYQGQAVVLEATVEEEPTLGGISIDDRIFTGPGPRPQRVGRFVLA
FT                   DLNAFRDLKPAPRPGDRLRFGARLQSLTLDPDTNEWFIRFEPNSGVFLTHTRALEVLGW
FT                   PGPNRDPIRPITPAGDRDIPAGEDSLIGLSRGHVLGLLGKPERVQLRATQGLLIENWVY
FT                   RRGNQTQTVVFQSRAGNAQPVVKARYVRP"
FT   gene            563677..564048
FT                   /locus_tag="Isop_0394"
FT   CDS_pept        563677..564048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dya:Dyak_GE20054 GE20054 gene product from
FT                   transcript GE20054-RA; SPTR: GE20054"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60989"
FT                   /db_xref="GOA:E8QY10"
FT                   /db_xref="UniProtKB/TrEMBL:E8QY10"
FT                   /protein_id="ADV60989.1"
FT                   /translation="MASNLLDPATQRGAPASRSRRAGVRNVWTLVWIIPVLGLGLMLSL
FT                   GAIWTAQPPPRWWPPDAPSPEEKLAKVRQWDQSAAELERAIDRLAREGSSVLPPSGASS
FT                   SNAAASSPTLVSPTSEQTP"
FT   sig_peptide     563677..563790
FT                   /locus_tag="Isop_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            564045..564272
FT                   /locus_tag="Isop_0395"
FT   CDS_pept        564045..564272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: srm:SRM_00401 conserved hypothetical protein,
FT                   secreted; SPTR: Putative uncharacterized protein; PFAM:
FT                   Cytochrome oxidase maturation protein cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60990"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYL4"
FT                   /protein_id="ADV60990.1"
FT                   /translation="MTLYVAVVLGGAAAFCGVAALALAWAFRTGQFGDLQAGARSIFDE
FT                   AEPIGSTTDDGFASPTSSADSSSSSSRSRS"
FT   sig_peptide     564045..564122
FT                   /locus_tag="Isop_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            564269..565840
FT                   /locus_tag="Isop_0396"
FT   CDS_pept        564269..565840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0396"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG3278 Cbb3-type cytochrome oxidase subunit
FT                   1; InterPro IPR000883; KEGG: srm:SRM_00402 cytochrome c
FT                   oxidase subunit 1; PFAM: cytochrome c oxidase subunit I;
FT                   PRIAM: Cytochrome-c oxidase; SPTR: Putative cytochrome-c
FT                   oxidase; PFAM: Cytochrome C and Quinol oxidase polypeptide
FT                   I; TIGRFAM: cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60991"
FT                   /db_xref="GOA:E8QYL5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYL5"
FT                   /protein_id="ADV60991.1"
FT                   /translation="MSLTVSPPGRSGPAPASERAAASRTEFQDEQRLRAARRTAAIDAS
FT                   TRLPVLVYFASALFWLIMGSVLAILASIKLHAPWFFDEASWLTFGRVRPAHLNTMAYGW
FT                   ASMGSVATALWLTARLTRAPLAYPRLVAGSAILWNLGLLAGAIGILTGSSTSVEWLELP
FT                   PWSAPPIAAAFVIVSVSAFVTFARRTEKHVYVSLWYILAAVLWFPWLYTAANLMMFSQP
FT                   VSGVPLATLNWWYAHNALGLWFTPVGLAAAYYLIPKVIGRPIYSYALSVIGFWSLALFY
FT                   NWNGGHHLIGGPVPAWLVTVSIVASVSMIIPVIAVAINHHMTMTSHFSVLKRSPTLRFV
FT                   VFAAVAYTLTSLQGSMEALREVNRITHFTHYTIGHAHLGLYGFVTMMLFGTMYYAVPRL
FT                   TGREWASATAARLHFWTCALGVVLYVGALSIGGWIQGMMLNDAETPFMKIVETTIPYLQ
FT                   ARSVAAGLMTTGHVIFLGLFIMNLTGFGPRRQGPLTWDERADSAHRGHQLTRPSSSSMS
FT                   LKETRV"
FT   gene            565837..566532
FT                   /locus_tag="Isop_0397"
FT   CDS_pept        565837..566532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0397"
FT                   /product="cytochrome C oxidase mono-heme subunit/FixO"
FT                   /note="COGs: COG2993 Cbb3-type cytochrome oxidase
FT                   cytochrome c subunit; InterPro IPR003468: IPR009056; KEGG:
FT                   sru:SRU_0323 cytochrome c oxidase, cbb3-type, subunit II;
FT                   PFAM: cytochrome C oxidase mono-heme subunit/FixO; SPTR:
FT                   Cytochrome c oxidase mono-heme subunit/FixO; PFAM:
FT                   Cytochrome C oxidase, mono-heme subunit/FixO; TIGRFAM:
FT                   cytochrome c oxidase, cbb3-type, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60992"
FT                   /db_xref="GOA:E8QYL6"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYL6"
FT                   /protein_id="ADV60992.1"
FT                   /translation="MSDHHANGSAPATSERLSLMNYAPPIVLGVALTFLSSWLGLVLAP
FT                   LVQIGDQGPIPTLEGGLDQYPNPSVGRLELGRQVYIENGCLYCHSQQIRPEPFGADIAR
FT                   GWGPRRTTPTDYIYDKPHLLGTSRTGPDLTNIGARQPSAEWHHRHLYWPPSTSPGSIMP
FT                   SFRFLYETRKIVGEPSDRRIVDFEGVPEHLQPPPGYQIVPSEKATALVAYLISLDRTQD
FT                   LPVAGAPTP"
FT   gene            566529..567749
FT                   /locus_tag="Isop_0398"
FT   CDS_pept        566529..567749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0398"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR003088: IPR008168: IPR009056; KEGG:
FT                   caa:Caka_0027 cytochrome c class I; PFAM: cytochrome c
FT                   class I; SPTR: Cytochrome c class I; PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60993"
FT                   /db_xref="GOA:E8QYL7"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYL7"
FT                   /protein_id="ADV60993.1"
FT                   /translation="MSSTRSSDSTATLDPMWEEESQDASAVAVEDRSHGLDDSQEGDEF
FT                   DGYEVTEIHEPILREQSEPRDGYEPLPNWAVALAGALLFWGGYYLQRYSGDFSATILTD
FT                   DPAMVNPAIAALPPPELSPFDLGKKLFAAQGCVSCHQTNGQGVPNQYPPLDGSEWVVGP
FT                   GAEPRLKRILLHGLQGPVTVKGNTYNGNMPAFGDRMDDEKIAAVLTYIRGAWSNQAPPI
FT                   EFESVAATRAATQGRTQPWSESELLSINEDDPFPGAAPASDAAPASGTNASAGDSGATP
FT                   AAAPNPKTTPTPTPPSPNAAAPGAAEVKEASSNANSPPPSASPQPKADATSSSTISNAN
FT                   AAPPPLTAELKAIRRKGGLVYALEGKCVTCHQNSGLGLGNQYPPLAGSEWVVPRRDQGP
FT                   QGALDRG"
FT   gene            567961..570873
FT                   /locus_tag="Isop_0399"
FT   CDS_pept        567961..570873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0399"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR008250: IPR005834: IPR018303: IPR006416: IPR
FT                   001757; KEGG: caa:Caka_0015 heavy metal translocating
FT                   P-type ATPase; PFAM: E1-E2 ATPase-associated domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase;
FT                   SPTR: Heavy metal translocating P-type ATPase; TIGRFAM:
FT                   heavy metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   heavy metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60994"
FT                   /db_xref="GOA:E8QYL8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYL8"
FT                   /protein_id="ADV60994.1"
FT                   /translation="MSSCVDPRSSAPPLCESSEEARTEPVPWRLIVGLLILGQSMALGV
FT                   AVNLLELDDPARGPIQTILLGSALVVTALLGGPLVVALADRLRQGRLTVESLFLLSAGG
FT                   ALVVSTRSWWIGHGPVFFEVVSVILVVYGINRAILARGRRRALERCRTWSGLPERARRV
FT                   VSLGEPNSDATTLETVTVSVDQLVAGDRIEIRAGEPIPIDGRLEADRVSIQESRFTGES
FT                   MPVVKRRGDVVWAGTVVLEGPIIVRVERGEGQRRVDRLLDAVERARYQTPGLSASLDRV
FT                   ASWFTPIVAAIAGAVFAFWTWRDGWETGLLNAMAVLLTACPCALGLAAPLTVWTGLARL
FT                   AEQGIMARRGDLLERLAQIDCVVFDKTGTLTEDRPRLVDWVQIGEDSPNQGGTLPPRES
FT                   FRQAVALVAAGSDHPLTRGLIEAWQREEELQAVVSDAQGDGWVGGLEPDSARPGWRLIA
FT                   RQVHPGWGVSGSIRWDGDETSPTVEIRLGRREWVAALDDSADRFLTDSLKRDKQKKDAG
FT                   PTLWISWNGRLAARATFAERVRSSWRATRDQLERLGLEVAILSGDTQERVAAVAGQGVV
FT                   SWSQASPEEKLTRIADLKARGRRPLMVGDGFNDLGALTTAHVGLAVSGSTAAARHAADA
FT                   QLLHDELTAIAQAVALARRTRTQLRGNLTIALGYNLVGILVASLGWIHPITAAVLMTLA
FT                   SATVVGRSIYAAGSEPTSFSSGEEPALREAPVPVGDTEPIEQLRDDHVTWRSRWLSVGW
FT                   LAQLPIVLALADLEPLSGLTPLGIAAWLGLGWWGPRWWRNLAGSRPRLDRVVGMVAVGN
FT                   LGMALGWWIDLGFQSAVVAHQTGGCACLTVFEADSPSLGLGMWLGMLALGNLAMVWLRH
FT                   PKRPEGSGCPTSAWVLGNVGMIAGMILGGSMAAAWAMEWQVGASHAVLLEWCGMTLGML
FT                   VWMELGHEWGANGWWGCVCGVARPPRSLSQPSVTMDQSQT"
FT   sig_peptide     567961..568029
FT                   /locus_tag="Isop_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(571042..576018)
FT                   /locus_tag="Isop_0400"
FT   CDS_pept        complement(571042..576018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_4113 hypothetical protein; SPTR:
FT                   Bacterial pre-peptidase C-terminal domain family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60995"
FT                   /db_xref="GOA:E8QYL9"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYL9"
FT                   /protein_id="ADV60995.1"
FT                   /translation="MGGQPRETSDQRDWNDQQPGDTPQSERALAGRHPIRRRPARRSEI
FT                   RVESLENRQLLTDGIFARLTGAITPTQRVDVRPFTVSPDDFAFPAATGGPVLMTVTIVA
FT                   TGNRSLDPAAVRIVPTGGSPAPQILAQRQDNPASPNSRIGRSATATVALAPGSYELQVR
FT                   ADRNTSGPYAALFRLAGDVNGDFQVNQIDQNAYNQQLQRRAPQRPPANFDLNLDGRLTL
FT                   ADSKIAALNLFSSTRIRPVSFLTLGVAREFDPNGDGIVTDGRIVLTGVTQPGSTVRLDQ
FT                   GDDGIFDQTTIADATGRYGFTVDLPFGATNFRVETRDAFGQRFVSDLQVRRIPDLTPPT
FT                   IQILSPAQNIQVSQNVTIVGRVSDNLTVASAIRVEAQINVGPFLTVPVEADGTFRLTTG
FT                   LPLDGSADGLQIITFRAIDGSGNVSETAVYRFNLQTDSPTGQLVNPDLIYSARPTLEIR
FT                   FSRPMAPAAFLPENYFLLVTAGIEAGRIVPIRNAVAGPQGDSVFLIPEPPLTAEFYQII
FT                   PTGLVTDLAGNRVRLIDALGNPLDGLPFRVDPIIPVLQTVDISNAVNPVQPSFDLTFSE
FT                   AMGEGAFVTGGYVVTIEGGPNSGQVVPLREVINLNQFDRRTARLVFERPPADGSYRITL
FT                   TRRVTDLAGNVIDVGQPRIVTLELRNPTASINVPPLLNEPVTSIQVRFSEPMSNFTFNA
FT                   VNYQLRIVGGPNDGQVVPLASVARFDAQSLSIIPASPLLNQRYRLILGPGITDLAGKPL
FT                   DPPTTFDFVPDTIRPRASLAISGTQTQSISSFDVLFSEPMADSAFERLQYELFVLEGPG
FT                   QGLPAPIFSVTRISPQTARINLAAPLANGRFRLFLGLGVTDLAGNVAVSEGFLEFAVDS
FT                   TRPTAALSVSGVSAGTLSFLDVTFSEPMGLTAFQPQSYTLTFLGGPAITGLTVVQLDPR
FT                   TVRLIPPQPLTDGNFRLTLDANLTDRVGNALIGQRVFEFSVRAVAPTATVSPMNALPDG
FT                   AVNAVAVTYSRAMNPAAFQASVYQLIGPDGRSLPIRQVERINGSTARVGFDPLAPGTYF
FT                   LRIDGPVADSGGIALVEPRLFSFVAPTSPQQAPPPFALASTTGGVSTLIDSLDLLFSQP
FT                   MSAAAFEPASYQLVRLETRPTVPPIVEELPIGVAAVERLSPTQARLIFTGTLPNGTYRL
FT                   RASEAVVDLASPARPLVTRDFPFDVAVVGGADVIPPRVETILPVNPVISNGLVSFDLVF
FT                   SEVVSLGAFDIANYRLQVRTGFDAQNRPIFQDLPIASIESVGGPGASVSVARITPRVPL
FT                   TNSDEYRLVIDASRVDPITGEVLEFRTPSRIRDLAGNPLEGERIRPLLVRPINPDDLVP
FT                   PRATIDLPAIVVNDLRDIEVFYDEPMAGAAFTAAGYRLVRTDGQPLQPGLTVTVQFLDA
FT                   ARARVSFSEALVDGPYQLRIQPEVTDLAGNPVTAPTVFGFEVRRQAPTLANVLVGTQTV
FT                   PDGGVATLASNTIDLRFNQRMGLSAFQSASYVLTRLDNGQTIPAVSVVQADGDATARLV
FT                   FANALPNAPYELTLLPSVVNAVGAPVTTTSFRFTVNATGGSTSSPIATLSRPAPNRIEL
FT                   AYSVEMAATAFLVSSYTLTNALGNVVPIALATRFDAQTVRLVLPANLTPGNYTLAISPT
FT                   VVDRNGQPVAVGSRLLTFTV"
FT   gene            576531..578615
FT                   /locus_tag="Isop_0401"
FT   CDS_pept        576531..578615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0401"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR013704: IPR007197: IPR006638: IPR020612; KEGG:
FT                   psl:Psta_1639 radical SAM domain protein; PFAM: Radical SAM
FT                   domain protein; Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: Radical SAM domain
FT                   protein; PFAM: Domain of unknown function (DUF3362);
FT                   Radical SAM superfamily; Radical SAM N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60996"
FT                   /db_xref="GOA:E8QYM0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM0"
FT                   /protein_id="ADV60996.1"
FT                   /translation="MSSDRLSSIDGMSGSLGSSASFVGIETLGTPPAPTTREEMKARGW
FT                   DKVDIVLVSGDAYIDHPAFAAGILYRVLEAAGYRVAVLPQPDWRSCEPWRMFGRPRLFF
FT                   GVSAGNMDSMINHYTANKKVRNDDAYSPGGRIGLRPDRATMPYCQRAREAFPGVPVIAG
FT                   GVEASLRRLAHYDYWSDTVKRSILLDSKADLVVFGMGEEPILEIARRLAAGEPVTALRD
FT                   MRGVAYALGAKEPRPEDALVIPSYEEVKTDKRKFALATKIIHQETNPFNARKLIQAHGD
FT                   QAVVANPPSLPVTQERMDWIYDLPYTRRPHPRYRGEPIPAFEMIKDSVTIMRGCFGGCT
FT                   FCSITAHQGRIIQSRSKESILAELRKIGRDPEFKGVVSDIGGPTANMYQMRCTKPEAEA
FT                   KCKRLSCVYPKVCKLLGTDHGPVVELMRESRQVEGVRKVMVASGVRMDLAQQSPEYLDE
FT                   LAAHHVSGQLKVAPEHVNSGVLARMKKPDNIDFVGFTRKFREASARAGKNQRIVPYFIA
FT                   SHPGSDLEAMIELAVFLKRNNYKPDQVQDFIPAPFDIATCMYYTGIDPFTGEEVHSAKK
FT                   LRDRKLQRALLQFFKPENYFAVREALLEAGRKDLIGSGPECLIPANPPREARMARMRAA
FT                   AKSLGEGRYVHTIANPSQGEPPDGCGSGEFKPTGYRPGRTSAKRRQDRKKRGAGRARLS
FT                   "
FT   gene            578937..579230
FT                   /locus_tag="Isop_0402"
FT   CDS_pept        578937..579230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0402"
FT                   /product="protein of unknown function DUF156"
FT                   /note="InterPro IPR003735; KEGG: ele:Elen_1552 protein of
FT                   unknown function DUF156; PFAM: protein of unknown function
FT                   DUF156; SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60997"
FT                   /db_xref="GOA:E8QYM1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM1"
FT                   /protein_id="ADV60997.1"
FT                   /translation="MSEAAEANPYCEEVRRDLHGRLSKAEGQLRGVGRMIDDQRPVGEV
FT                   LQQLASIRSAVKGITKAVMRSYLERRAVEIVKTGDPKAIDAMLETLIKFVKE"
FT   gene            579235..579885
FT                   /locus_tag="Isop_0403"
FT   CDS_pept        579235..579885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0403"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4662 ABC-type tungstate transport system
FT                   periplasmic component; InterPro IPR000515; KEGG:
FT                   sti:Sthe_3396 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60998"
FT                   /db_xref="GOA:E8QYM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM2"
FT                   /protein_id="ADV60998.1"
FT                   /translation="MRAFDPDLLPVVALTLRVTVSALVIAAVVGIPAGVWLGLARFPGK
FT                   RVLTALVYTGMALPPVVVGLLTYMLLSRSGPLAFLEWLFTPNAMILAQTVMALPLVAGL
FT                   VMGAVASVPHDLVLQVRSLGATPWQVRWTILREVRVAVLFALLVAFGRIVSEVGAAYMV
FT                   GGNIQGYTRVLSTAVMMETGKGDFGVALALGGWLMVLALTVNLAAMRLQGRLA"
FT   sig_peptide     579235..579312
FT                   /locus_tag="Isop_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            579882..580610
FT                   /locus_tag="Isop_0404"
FT   CDS_pept        579882..580610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0404"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components; InterPro IPR003439:
FT                   IPR003593: IPR017871; KEGG: sti:Sthe_3397 ABC transporter
FT                   related protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: ABC transporter related protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADV60999"
FT                   /db_xref="GOA:E8QYM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM3"
FT                   /protein_id="ADV60999.1"
FT                   /translation="MSDQPAYRLENLTVAVGSRVVLDLPAFEVVHGEVLCLVGPPGSGK
FT                   STLLRILAGLDSPNAGVAWLRGQRFDRKAPATLKRTVTLMFQRPLLLTGTVRSNVGYGL
FT                   RLRGVSDWRAKAMTMLERVHLKHLADRPATAISGGEAQLVALARALAFGPEVLLLDEPT
FT                   NNLDPARVALVEEVVLADHQERGTTVVWATHNHFQARRVGDRVALLLEGKVIETAPATE
FT                   FFECPCDLRTAAFVQGKMVY"
FT   gene            580612..581442
FT                   /locus_tag="Isop_0405"
FT   CDS_pept        580612..581442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0405"
FT                   /product="ABC-type tungstate transport system, permease
FT                   component"
FT                   /note="COGs: COG2998 ABC-type tungstate transport system
FT                   permease component; KEGG: pth:PTH_0602 ABC-type tungstate
FT                   transport system, permease component; SPTR: ABC-type
FT                   tungstate transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61000"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM4"
FT                   /protein_id="ADV61000.1"
FT                   /translation="MRIIVFFLLFLVGFFGNGCVDSSPTSFIVATTTSTRDTGLFEELL
FT                   PVFQAKTGIEPRVVAVGTGQALEIGRRGDADVLLTHDPDGEQRFVAEGFGTSRMLVMSN
FT                   DFVLVGPVDDPAGVGGATSGADAFLRIARKQAVFVSRGDESGTHRKEKATWALAGLEPS
FT                   GDWYVRSGQGMGAVLRMADEKRGYTLSDKGTFLAQRDKLSLAVVYTGDPTWTNQYAVVP
FT                   VNPARHPHVKHDLAERFAEFLVSDEGQRLIAEFGRAKYGEPLFRANSPRAGGGP"
FT   sig_peptide     580612..580677
FT                   /locus_tag="Isop_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            581439..582767
FT                   /locus_tag="Isop_0406"
FT   CDS_pept        581439..582767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_1705 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61001"
FT                   /db_xref="GOA:E8QYM5"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM5"
FT                   /protein_id="ADV61001.1"
FT                   /translation="MTDHPPPLPSRTRFAVLKVCYLLAVTAAVFVVPAVEATRPARWWV
FT                   VPGLLLLQAAILIGCGVEGRDLLRPLGRLKWLFVVLLACYAFLPGEDERAVAVWRAIPI
FT                   AGWTWWVNLGGLALAALMCLQILTVLLASAVVRLTGPGTDLVVGLRFLGLPKLFVYPLD
FT                   LVLAHLGGARCPRARGGGGGRGRRGVGGGRAAAETLAPGFFSVLRGLTRGDVAAFTTAI
FT                   QKALDDARRQVEENAGEPLDPQFANDAAVIAGVGLVMVGFKMLKLLPGVPIASGHKTLL
FT                   LFPLYLLAARRTHTRWGGTAAGSVMGVVGFLQGDGRFGVLDILKHVTPGLLIDLTKPVV
FT                   ERLPERAWVYGVLGLLAGVARLTTELAVLCLLGTRAEVYIILGVKLVPTLLAGALGGVV
FT                   AVAVLRVFPNDPDQPPNESDGQPKSAVELVAVTHQHENAKENG"
FT   gene            582764..583630
FT                   /locus_tag="Isop_0407"
FT   CDS_pept        582764..583630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0407"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="InterPro IPR001048; KEGG: swo:Swol_2454 uridylate
FT                   kinase; PFAM: aspartate/glutamate/uridylate kinase; SPTR:
FT                   Aspartate/glutamate/uridylate kinase; PFAM: Amino acid
FT                   kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61002"
FT                   /db_xref="GOA:E8QYM6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM6"
FT                   /protein_id="ADV61002.1"
FT                   /translation="MNELIKEGEGRRTHIKSLLMRESLMDRKVLAASDAQEVLPILPDV
FT                   HVVHIGGASILDRGKAALVPLLDEVVRCRQTYKILLGVGGGARMRHTYHIALDLGIPTG
FT                   GLAMVAGAVNEQNRFMVQALLAKHGGVVLHKDHYVVLPLWMAAGMIPILSGMPPYHYWE
FT                   PPTGDRRVPHYREDFGLFMVSEVLGAASMIYVKDEDGLYTADPKTNPDATFIPHITAQE
FT                   LLARNPPELIIDRSVIESMVFARNTRRIQIINGLKPELLGRALAGEPVGTVVTAPRDTT
FT                   KEAADGC"
FT   gene            583620..584450
FT                   /locus_tag="Isop_0408"
FT   CDS_pept        583620..584450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0408"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="COGs: COG0528 Uridylate kinase; InterPro IPR001048;
FT                   KEGG: swo:Swol_2454 uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; SPTR: Uridylate
FT                   kinase; PFAM: Amino acid kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61003"
FT                   /db_xref="GOA:E8QYM7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR030669"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM7"
FT                   /protein_id="ADV61003.1"
FT                   /translation="MAAETPARKTIPTPLRDGTLDAATLLEASQYGSPIRVLPEVNVVK
FT                   VGGQSFFDRGRSAVWPLVEELARCAQSHQIILGMGGGTRSRHAYSIGLELGLPTGILAA
FT                   IGASTALQNAHMMQMLMAKYGGILVSFEEFEKLPMYLRNGGIPIMVGMPPFHHWERPPE
FT                   MGRIPANRTDAGVFLMAEFLGARSMIYVKDEDGLYTDDPKKNPDATFIPRITAQELLDM
FT                   DPNDLVIERVVLGYLQKAHYVRSVQIVNGLKPGLLTRALAGEHVGTIIEAPLDP"
FT   gene            complement(584573..587002)
FT                   /locus_tag="Isop_0409"
FT   CDS_pept        complement(584573..587002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0409"
FT                   /product="Prenyltransferase/squalene oxidase"
FT                   /note="InterPro IPR001330; KEGG: plm:Plim_0306
FT                   A-macroglobulin complement component; PFAM:
FT                   Prenyltransferase/squalene oxidase; SPTR: A-macroglobulin
FT                   complement component"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61004"
FT                   /db_xref="GOA:E8QYM8"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM8"
FT                   /protein_id="ADV61004.1"
FT                   /translation="MIHRQCLPRQALVVFTSGESQRPGLERSNAVHRMGSGLRWAVGLG
FT                   LAVLMWEPGWLMVTPAQAQPRGAQVTQEQVEKAIRLGVKSLRDKQQPDGSWRGFADDFA
FT                   KYHGLTSLATLALINAGEPIDSPTVSRALEFIRRARPDQLDSTYAVALQVMALAAGDPQ
FT                   RDKVRIAAGVAWLERAQFRREDSPRYAGAWTYGMNKGQRPDNSNSQFALLGLYAASEVG
FT                   VEVKDSVWELARNYWERCQNNSGGWPYVIDDDTSTASMTCAGISSLVITGAKRVQSVET
FT                   LVGDKVRNCGEGGVVNNRIQAGINWMARRFQVDFNFTDGLGRQPWTYYYLYGLERAGRL
FT                   SGQRYFGEHDWYLRGAAKLVKEQDPLLGSWNGGGGIEDNPVLVTSYALLFLAKGRAPVL
FT                   INKLVHQPANDWNIHVDDIRNLTNAVSRDWKAFVTWQVVNPNSPDAGLADLLQAPIAFI
FT                   NGKQAPVFTPAAKRLLRDYVEQGGFILAEAGCSEPAFDQGFRALLTEIFPEPDYQLRRL
FT                   SEDHPIWRSYHRLSPNVHELWGIEFGCRTVVVYTPQMLAAYWNHAESQPGNPAVERAIR
FT                   VGQNIVDYATGRELPEDKLKVREIRNFKTDDVKRGALRIAKLRHAGDWNVAPLAIPNLT
FT                   TALRDQLGFDVVINHKELLPRDPNLIYYPLIYVHGRASLSFTPEDMEALRKHLDPGRGL
FT                   FFADAACGSPAFDAAFRKFVAELLPNNPLEPIPPDDELFNVVYDLNAVEFSKAAGGRIG
FT                   PAELEGVKINGRWVVIYSKYDLGCALERHQGSDCKGYKYESALKIVSNIVVYSTLP"
FT   gene            complement(587209..588465)
FT                   /locus_tag="Isop_0410"
FT   CDS_pept        complement(587209..588465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cse:Cseg_3119 integral membrane sensor hybrid
FT                   histidine kinase; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61005"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYM9"
FT                   /protein_id="ADV61005.1"
FT                   /translation="MITLMSRFVRTGLLLSLSLIALAVAAARFAGPESQRRFPDQPTLA
FT                   AIQPQVLGSAAGRLNLLDPDTGETVVVPLPPDMMLDSVVVSPFVDDYGRAQAVGRYRVY
FT                   EGTGAERLIGEVGLLRLSVPDGRILNRQPMDTLPVTPPSFEPGTRACVVYASGDGRIHR
FT                   VDFDEADETGRPLVSRPVPWQVADCPQDQLHIMEIIRVQHPRLRRFGIATVCQVVPNKA
FT                   PLRPDPVTNHTGGLGESASPTSKLGPSKLWWVEFSQTSHAIVAAGPIGLHDGNPATAAR
FT                   HERCPVIVNGASGEPHMVFQIREPGWEVPRLVEVALKFPSVSGPPRFQVDDERVVVPAT
FT                   ARWSQAVVSRDGQRVWLGFSTPPIPLALNRSQPQTTLTSARSVTPVPLDAFQSVRRSAA
FT                   SLLAQGRAVYKDDGPSTLR"
FT   sig_peptide     complement(588376..588465)
FT                   /locus_tag="Isop_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            588817..589296
FT                   /locus_tag="Isop_0411"
FT   CDS_pept        588817..589296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rcu:RCOM_1935260 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61006"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN0"
FT                   /protein_id="ADV61006.1"
FT                   /translation="MTTTRTETVANGVVFEQAMPSLLEAQGGSERLGGLERRRESLDER
FT                   HCVGIVAAARGPDQANRLGRVARASGRRRGTSGQTRGGKVVGRRRGKRNHSSPRRQASL
FT                   RTKTPTAWFQRTKATPLSTQPERQIVGPVTRIHQIRIISYWILLIYRANPGSKLD"
FT   gene            589462..590586
FT                   /locus_tag="Isop_0412"
FT   CDS_pept        589462..590586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0412"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011703:
FT                   IPR003593: IPR016366; KEGG: psl:Psta_1557 ATPase associated
FT                   with various cellular activities AAA_3; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SMART:
FT                   AAA ATPase; SPTR: MoxR protein; PFAM: ATPase family
FT                   associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61007"
FT                   /db_xref="GOA:E8QYN1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN1"
FT                   /protein_id="ADV61007.1"
FT                   /translation="MVATRWACFDAAPTGGVRATGVPLGIQVGKGGGMASASADRISQL
FT                   LEEFHTTRDQMLVELSKVVVGQREVIELILAAIFTRGHCLLVGVPGLAKTLMVSSIARI
FT                   LDVGFKRIQFTPDLMPSDITGTNVLEEPETGRRTFRFIHGPIFSNIILADEINRTPPKT
FT                   QAALLQAMQEREVTVGQETMSLPEPFLVIATQNPIEQEGTYPLPEAQLDRFMFDIRVGY
FT                   PTLEEEEKILSSTTKGEKHELGKMLSGRAILNLQKLVTSVPVSDYVIKYVARLVRATRP
FT                   VDPHAPPWVKEMIDWGAGPRAGQALILGGKAMAAMDGRYSVALEDVRKVAVPVLRHRIA
FT                   ASFKAQGEGLTTEDLIRRLLSEVKEPEIPKYERR"
FT   gene            590661..591572
FT                   /locus_tag="Isop_0413"
FT   CDS_pept        590661..591572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0413"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: psl:Psta_1558 von
FT                   Willebrand factor type A; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61008"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN2"
FT                   /protein_id="ADV61008.1"
FT                   /translation="MSNAETYLKPEVIRQVARLDLKAKFIVEGFLAGLHASPFHGFSVE
FT                   FSEHRKYSPGDDIRDIDWNVYAKTDRFYIKKFQAETNLDGFLAIDVSNSMGMTPHGEMT
FT                   KLDYAICLAASLGYLMIRQQDPVGLFAFSDRIRLSLPPKSRRSQLANILTALESLKPEK
FT                   VASNIAACLHRIAEMVKHRGLIMIFSDLMYPDALAGADPVIEALRRFRYRGHDVIVFHI
FT                   LDQAEALFPFDGLLELEDNETDAKLVVDAAGIRADYLEAVATLRNHYAVECGQSRIDYV
FT                   PLHTGMPFDKALLSYLISRRGR"
FT   gene            591732..594026
FT                   /locus_tag="Isop_0414"
FT   CDS_pept        591732..594026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011933; KEGG: psl:Psta_0478 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Aerotolerance
FT                   regulator N-terminal; TIGRFAM: N-terminal
FT                   double-transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61009"
FT                   /db_xref="GOA:E8QYN3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN3"
FT                   /protein_id="ADV61009.1"
FT                   /translation="MDLTLLHSGLAAGAALAALPILLHLFQRRTPKKVVFPALHLIRAQ
FT                   SIKTNRRLRIKNWLLLLARMALIALMALALARPTLHSQAVLGDEEVSTGLGLVIDTSLS
FT                   MTYQEGGQTLLDEAREAARVLLGKTPSSSQVYLIDSAEPVKIAPLSPSAARARLDEIKP
FT                   RPANRPLNDAIAAAIRSVAESDQPRREVFVLTDLARTSWDVGRALSEAEKTLVADRGIS
FT                   IYVIRLKAEAPRNVAIIALEPTADLITEAAPLAIRATLVNQGPATTRRVDFSVDGQPRG
FT                   VQTVELGADTETQVLFDVPKLARGLHQIEVRLAEGADPLDFDNVRLLAIRVRDPIKVLV
FT                   VSDLVIDGEFIANALDPSLEPLENAQEMGPVARPFRVERRLARQGDWTAPETLDNAAVV
FT                   FVNNVERIDDQQWSRLNAFVRRGGGLVLGVGHRTDPDFYNTALARQVMPAALDQVVRLR
FT                   ESTTFGRAERSHPLIDTPYLDELVTDLAGIPVSVFYAVTPAPSAAVVVTLATNAPALLE
FT                   RNFPGGRAGKVLLWTTPLSRRPNPNDPAAWNEFPNPSFWSFVDLTYRTVPYLAGLASER
FT                   LTYEAGEEVLLTIDPVGTSGGSSVGNPEEGATRQWVVTGPGDTPPERIGTPRGGNLLPI
FT                   LGIETPGFWSVKPVNPNLGPALGFAVNPPAREALLKPIESTEIELLLVKDRLAIAEGLA
FT                   DLKRATAAQRIGRELFPVLMALILILITLENLLANTFYRPAHSHDVQVAAGIGRERQDR
FT                   YEPSADFNSTR"
FT   sig_peptide     591732..591782
FT                   /locus_tag="Isop_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            594034..596385
FT                   /locus_tag="Isop_0415"
FT   CDS_pept        594034..596385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0415"
FT                   /product="protein of unknown function DUF1355"
FT                   /note="InterPro IPR010768: IPR002035; KEGG: plm:Plim_2313
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1355; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1355)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61010"
FT                   /db_xref="GOA:E8QYN4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN4"
FT                   /protein_id="ADV61010.1"
FT                   /translation="MMRLSVNPIGPWALIILGAVSVLAATWWAYRVPVRSGVSRLRWVV
FT                   VGLRIVAVLLCLAALLRPSVLIAERKTESALVLMLVDSSTSMTLTDEVGGRSRWEVALE
FT                   TVQQARAAIERIGGASVSAERIMEEEAAGLQAQYYRFDGQLTEWEPSSNSPKDQEGDQA
FT                   ASRPGVGVETSDSAQDSSSPKPPEGRETALGSMLAEALRRHEGKRIAAMVVVSDGASNS
FT                   GRPPLTVAEQFKARGIPITSVGLGSDRTGPEGRDIAVREIVTAPTVFVKNELQVRGTVR
FT                   ARGFANVPLEVELLADGVKVASTRITARGDDEILSVRDLKHVFETPGEKRLTLRVEPLD
FT                   GETLRANNEVGTYLDVLKGGLAVLYLQGPNFSWEYKYLVTSLDTSPDIQVDLAVLRRPA
FT                   TATTSELPPDALQPGKYDVFVLGDFPARLLTTMQQRQLADRVDQGAGLIMLGGRDSLGP
FT                   GGWRDTALARILPVEVHPGDGDTDPPGGIKVVPNPDALDAYVMKLASNLEESRAIWEAL
FT                   PPIPGASNLNRPKIGSSIWATSPDRRPLLVAQEIGLGRSMVFAGETWVWARASEASFAA
FT                   HRRLWRQIILWLARKEETGENEVKLTLDRRGLRLGQKLDLTIQALDGEKTPIPDASFQA
FT                   EAVRLDANGLAVPETNMPIDLYKSGAEARGSLFATGEPGEYRITATARDAQGEILGTDS
FT                   ARFLLIEDDRELENPAANLALLKQLASITGGEFLPPDKLGDYLEALHRDSPARFEVLTE
FT                   HRIYDNWPYFLAFVTVLTLEWALRRRIGWV"
FT   sig_peptide     594034..594105
FT                   /locus_tag="Isop_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(596459..597850)
FT                   /locus_tag="Isop_0416"
FT   CDS_pept        complement(596459..597850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0416"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR000089: IPR004167: IPR001078: IPR003016; KEGG:
FT                   sth:STH413 pyruvate dehydrogenase E2; PFAM: catalytic
FT                   domain-containing protein of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; SPTR:
FT                   Pyruvate dehydrogenase E2; PFAM: 2-oxoacid dehydrogenases
FT                   acyltransferase (catalytic domain); e3 binding domain;
FT                   Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61011"
FT                   /db_xref="GOA:E8QYN5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN5"
FT                   /protein_id="ADV61011.1"
FT                   /translation="MIFKLPELGEAVQEAELVAWRVNVGDVVRRGQPLMEVMTDKATME
FT                   VPAPFEGRITALKASPGHRVAVGEGVLSYQAVDTPTPVAQAAPVAPSARTETLSRTDAP
FT                   PVVEVAHAAEPPPSNGTNRASTAPPPRPTASPSSPRKQAAPVVRRLARELGLDLDAIPA
FT                   SKTAEGIDRVRLEDLARVLRERAGAVAGSFPSGEPPVAKRDAAAVSSKARGGPAKRNEF
FT                   GEPGQVIPYIGLRRKIGDRMVEAKRTIPHASYVEECDLTALVALRSQIKEAMIQRGVRL
FT                   TYTPFIIKAVARALIDVPIMNATLDETAGRITLHNERHVGVAVSAPSGLVVPVLRHADR
FT                   RPLPALCRDLERLSRAVRDGSITREDLTGGTFTVTSIGNIGGLFTAPILNIPQVGILGV
FT                   GRIVRRPVYDDQDRIRPADLVYLSITFDHRVVDGAAAAEFGNAVVRHLSEPTLLLTEFD
FT                   EPSRV"
FT   gene            complement(597989..599050)
FT                   /locus_tag="Isop_0417"
FT   CDS_pept        complement(597989..599050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0417"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG0022 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type beta
FT                   subunit; InterPro IPR005475: IPR005476; KEGG: mxa:MXAN_4565
FT                   2-oxoisovalerate dehydrogenase complex, E1 component, beta
FT                   subunit; PFAM: Transketolase domain-containing protein;
FT                   Transketolase central region; PRIAM: Pyruvate dehydrogenase
FT                   (acetyl-transferring); SPTR: 2-oxoisovalerate dehydrogenase
FT                   complex, E1 component, beta subunit; PFAM: Transketolase,
FT                   C-terminal domain; Transketolase, pyrimidine binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61012"
FT                   /db_xref="GOA:E8QYN6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN6"
FT                   /protein_id="ADV61012.1"
FT                   /translation="MATLVQAVRMALHYGEEHLGVTDIFGEDVGPPLGGVFTATQGLRT
FT                   AWNSPLDERGIIGAAMGIAYAGGRPVAEIQFCDYAFNCIDLLKVAGNQRWSGAGQYEMP
FT                   IVVMTPNGAGIHGSLYHSHSFESWASRLPGWKIVMPSNAIDAHGLMLSAIADPNPVLYL
FT                   LPKALLRVKSEEKLPGEPEDERTLSEMIDAPVGAARASWTPRWPDIVPRFIPLGQARVA
FT                   REGTDVTVVSYGRTLHLCLKAADRLAQEQGASVEVIDLRTIFPYDWATIRASVAKTGRF
FT                   LVVNEDTEVTNFGEHLLRRVIEDAFYDLIARPRVLMGKHVPGIGLNEVYENHSVPQLHH
FT                   VHEALRDLIAETA"
FT   gene            complement(599229..600332)
FT                   /locus_tag="Isop_0418"
FT   CDS_pept        complement(599229..600332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0418"
FT                   /product="3-methyl-2-oxobutanoate dehydrogenase
FT                   (2-methylpropanoyl-transferring)"
FT                   /EC_number="1.2.4.4"
FT                   /note="COGs: COG1071 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dehydrogenase (E1) component eukaryotic type alpha
FT                   subunit; InterPro IPR001017; KEGG: mxa:MXAN_4564
FT                   2-oxoisovalerate dehydrogenase complex, E1 component, alpha
FT                   subunit; PFAM: dehydrogenase E1 component; PRIAM:
FT                   3-methyl-2-oxobutanoate dehydrogenase
FT                   (2-methylpropanoyl-transferring); SPTR: 2-oxoisovalerate
FT                   dehydrogenase complex, E1 component, alpha subunit; PFAM:
FT                   Dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61013"
FT                   /db_xref="GOA:E8QYN7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN7"
FT                   /protein_id="ADV61013.1"
FT                   /translation="MEPARFLSNPTRMLPSPAPTPPRDGRVYTGNESLPADRIFTLHRL
FT                   MVLGRTLEERMIKLSKSGQAYFWVGGPGEEAFNVCLGLQVKKGRGPAFDYLHLHYRNSA
FT                   TLLAMGMDPRDAIRQMIMTRTDPFSMGRNFVGHFARADWNVVPVFSVIENQYVIAPGTA
FT                   MIQKRLGGDGISIVTGGDAGSAEGDFASGLLWATRPRQELPVLFIVTDNAYGISTLTTS
FT                   QMDEARPLKMAKAHEIPCELVDGNDVVASWHALQRGIDYCRRERGPYLLQARVSRLHGH
FT                   SSSSGAGRIDTEADCIALLESKMIERGLANEADLDQVHRECRDQIERAVEEVLDEARPR
FT                   PEDVERFTYAPSRYDAVYPEDYTGLPR"
FT   gene            600556..600738
FT                   /locus_tag="Isop_0419"
FT   CDS_pept        600556..600738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61014"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN8"
FT                   /protein_id="ADV61014.1"
FT                   /translation="MPGFRVLEVEHIAGFLEKQSDCGGWRLGSDCYGDAARDEMFLPRQ
FT                   RRFEGELSACETPEN"
FT   gene            601113..601367
FT                   /locus_tag="Isop_0420"
FT   CDS_pept        601113..601367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_2735 pyrrolo-quinoline quinone; SPTR:
FT                   Pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61015"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYN9"
FT                   /protein_id="ADV61015.1"
FT                   /translation="MVIDGGLLVRLNDTPKRPQNALPHALVEHSSLLALEPNTGKPLWR
FT                   ARNVIASSAIPIPIEHNGTTSLVTAYNGVVDPRNLPLPD"
FT   gene            602112..604403
FT                   /locus_tag="Isop_0421"
FT   CDS_pept        602112..604403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0421"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG3284 Transcriptional activator of
FT                   acetoin/glycerol metabolism; InterProIPR003018: IPR002078:
FT                   IPR002197: IPR003593: IPR 020441; KEGG: afw:Anae109_3045
FT                   fis family GAF modulated sigma54 specific transcriptional
FT                   regulator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; GAF domain protein;
FT                   helix-turn-helix Fis-type; SMART: AAA ATPase; SPTR: GAF
FT                   modulated sigma54 specific transcriptional regulator, Fis
FT                   family; PFAM: Bacterial regulatory protein, Fis family;
FT                   Sigma-54 interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61016"
FT                   /db_xref="GOA:E8QYP0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP0"
FT                   /protein_id="ADV61016.1"
FT                   /translation="MPSRNGGSERIWSRYVETGDDREARRVLPRVIWESWRRCREDWRL
FT                   DVGLAEVTSRLPEEQWRALRERHRQCWWGGVEPLWNEAARRVGENGGVVAIFDAEGWML
FT                   DLEGDSRARTRLETIRFAPGYNWSEASAGTNGPGLALWRREPVRVRGAEHYIAAWHPWN
FT                   CASAVVRDPETERIVAAVDVTAPAGSEASRSHALAVAATLARAAEAELAHRFEARRAAL
FT                   LDLFRGLAAGRSSEGLLAVDAGLRVLRCNDAAAVHLGPPDRPSLEHCPGLKAAVLNILE
FT                   RYRGPKTHPGIIGSEGDDHPSGEDQIEFERFELTECRHVGSRATRVLVAPAWRDGQLLG
FT                   ALLLLAGSLTRAVVQGRSTSSATIQDKTHPNMTITARRCDQDPLAMLDGQTEALVRLKD
FT                   RARRAAASELPILLMGETGTGKEVLARAIHAASRRGRTGRPFVAVNCGALPESLIESEL
FT                   FGHAPGAFTGATARGRPGRFVEADGGTLLLDEVHDLSPSAQSALLRVLQEGEVTPLGGS
FT                   TRRVDVRVIAACNRDLRAEVAAGRFRADLFYRLHVLTLELPPLRCRRDDIPHLAHLFLE
FT                   EALAAREAGASGSNPIRGWTPRALEALQAYDWPGNLRELKAVVHAAVTFAEGTLLDLDD
FT                   LPDFLRPESLRVVPPPGCPPAFPADSSVASPLLGRTSRTTALGRGDHTAEDVLLPANPA
FT                   NAEPWLRALQDAQGNLAEAARRLGVSRMTLYRRINRRGLIRIRRLQTNGPDPARDIHPQ
FT                   GQGHWDEYRP"
FT   gene            605001..606020
FT                   /locus_tag="Isop_0422"
FT   CDS_pept        605001..606020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0422"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR013154: IPR013149: IPR002328; KEGG:
FT                   rca:Rcas_4434 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: Alcohol dehydrogenase
FT                   GroES domain protein; PFAM: Alcohol dehydrogenase
FT                   GroES-like domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61017"
FT                   /db_xref="GOA:E8QYP1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP1"
FT                   /protein_id="ADV61017.1"
FT                   /translation="MMMMKAAVVRDYGEPLTIEDLPIPCPTEGQVLVKMEASGLCHTDI
FT                   HAAHGDWPIKPPLPLIPGHEGIGIVTQVGPGVREVKEGDRVAIPWLGYACGVCEYCASG
FT                   WETLCEKQLNSGYALPGAYAEYATAFARYVGHVPKGVSPLDAAPLSCAGVTTYKAVKVS
FT                   GARPSDLVAIFGVGGLGHLAIQYAKIAGSTVVAVDLLHEKLDLATSLGADYTINARHED
FT                   PAEAIKKLGGADAAICLAVAPRAFEQAYRSLRRGGRLVFVALPADNHVQIPIFETVLNG
FT                   ISIIGSIVGTRVDLKEVFELHAAGRTKVIYETRKLDEVNHCFEEVEAGKVPARLVFEF"
FT   gene            606178..607680
FT                   /locus_tag="Isop_0423"
FT   CDS_pept        606178..607680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0423"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.5.2"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590: IPR016160; KEGG: aba:Acid345_1381
FT                   aldehyde dehydrogenase (acceptor); PFAM: Aldehyde
FT                   Dehydrogenase; SPTR: Aldehyde dehydrogenase (Acceptor);
FT                   PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61018"
FT                   /db_xref="GOA:E8QYP2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP2"
FT                   /protein_id="ADV61018.1"
FT                   /translation="MSVSTLDPTRHAPVVPKFKPQGMLIDGRWTQAVDDENFETIDPAT
FT                   ETVLAHVPSGGRVDIDLAVKAARQAFESGPWPKMTPSERGRLLWKLADRLEECRDEFAE
FT                   LESLDNGKPLAVARVADVPLAVDLFRYMAGWATKIEGKTIPISAPTAPGAEFLAMTLRE
FT                   PIGVVGQIIPWNFPLLMAAWKLGPALATGCTVILKPAEQTPLSALRLGELIQEVGFPAG
FT                   VVNIVTGFGATAGAALAAHPDVDKVAFTGSTEVGRAIVQAAAGNLKRVTLELGGKSPNV
FT                   VFADADLETAIPGAANAIFFNHGQCCCAGSRLYVQRSIFDRVVEGVANHARSIKLGHGL
FT                   DESTQMGPLISNEQLQRVNGFLESGVREGARAVVGGGRVGHRGFFVEPTVLVDVKPTMK
FT                   VVCEEIFGPVVTAMPFDDPAQVEPAANETIYGLAAGIWTRDIGKAHRLAKRLRAGTVWI
FT                   NCYNIFDAALPFGGYKQSGWGREMGYEAIQLYTETKSVCIGL"
FT   gene            607961..608629
FT                   /locus_tag="Isop_0424"
FT   CDS_pept        607961..608629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: act:ACLA_076560 integral membrane protein;
FT                   SPTR: Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61019"
FT                   /db_xref="GOA:E8QYP3"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP3"
FT                   /protein_id="ADV61019.1"
FT                   /translation="MSTPTPTPDATSHPTWTPTQVGGASQTSGQREPGHPLDALRADLH
FT                   ASLTSNRWSLALAWFGWIHLACFLVCHAMYRRDTHGDVRFPAVWLVELILILTAARLVL
FT                   GKGWIRPPAVNLIARFWITFLILSFSVSLYNVQTGWALDWFKPIWATLSTFLFAGLAWM
FT                   FSLRFLIPAVFMGLVGMLMVQLPDWNYLIYGLAWWLWFQIFAWRCRVAREAPSLPVAPF
FT                   "
FT   gene            complement(608660..611197)
FT                   /locus_tag="Isop_0425"
FT   CDS_pept        complement(608660..611197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0425"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR003338: IPR004201: IPR003959: IPR003593: IPR
FT                   003960: IPR005938; KEGG: mxa:MXAN_2773 AAA family ATPase;
FT                   PFAM: AAA ATPase central domain protein; AAA ATPase VAT
FT                   domain protein; cell division protein 48 CDC48 domain 2;
FT                   PRIAM: Adenosinetriphosphatase; SMART: AAA ATPase; SPTR:
FT                   ATPase, AAA family; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); Cell division protein 48
FT                   (CDC48), N-terminal domain; Cell division protein 48
FT                   (CDC48), domain 2; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61020"
FT                   /db_xref="GOA:E8QYP4"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP4"
FT                   /protein_id="ADV61020.1"
FT                   /translation="MNPTDSTSPRTHHEPAVGSDSLSNSSESLSANSSPTPPDRDASAN
FT                   DHATASPSTKTPFKVAEARPRDQGRGLARLDPADLEALGAAPGAVVEIVGTRRTVARAM
FT                   PAYPEDRERRRVHLDATTRDNAGVALDDLVRVRVVPFTIAEKVGLVPLGDFPDDRDLQY
FT                   LGARFDGLALIAGDLVRIRMIGGALREFEVRSVEPPGPVVVGPDSTLELQRPPSSSSSS
FT                   RSRAGSPRVGDASDGHGHDDASDSGIWGFARSGGLGSPRRAAVWSSGSSSSSLGGGAAR
FT                   SSIPRRPRGGFSSSAGRGGRTVRYEDVGGLKRELNRIRELIELPLRHPEVFQRLGIDPP
FT                   QGVLLHGPPGCGKTLIARAVAAESDAAFFAVNGPEIVHKFYGESEAHLRRIFDEAARSA
FT                   PSIIFLDEIDAIAPKRENAVGEVEKRIVAQLLALMDGMNRRGRVLVLAATNLPNNLDPA
FT                   LRRPGRFDREIALPIPDREGRRDILDVHTRGMPLDDDVDLDQLAAITHGFVGADLEALC
FT                   REAAMVRLRRLMPAIDFDSGALPYNQLKTLKIGMEDFQLALRDIEPSAIREVFVEVPEV
FT                   SWADVGGLAEVRQRLIEAVEWPLRHPDLFASFQARPPRGILLHGPPGCGKTLIAKAIAR
FT                   ESQANFIPVKGPALLSKYVGDSEKAVREVFRKARQAAPCILFFDEIDALVPTRGEGGGS
FT                   DSQVAERVVGQFLAELDGIEDLGGVLVLAATNRVDRIDPALRRPGRFDLIVEVPAPNRD
FT                   DRRAILAIGLRDMPLDPAVSLDELAEVSEGLTGADLRAVCHEAARRVIRRIVAQREAGS
FT                   VATTTTLPKVARTDLLDAIAARKLDHASTAGSL"
FT   gene            complement(611194..611898)
FT                   /locus_tag="Isop_0426"
FT   CDS_pept        complement(611194..611898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_1246 heat shock protein, HSP20 family
FT                   protein; SPTR: Heat shock protein, HSP20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61021"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP5"
FT                   /protein_id="ADV61021.1"
FT                   /translation="MFGEFSANPSQTNDSLSGSNAIKSDCHPPTETRSSPTGNGHGNPN
FT                   RRPPSPDARRARDSCSKTGNVTGLLDGLIGLVRSLGEFADKGRQLRHTVGRGDLKVETT
FT                   VKVRSLLDDYGQPIRDQKDSSDNSESPTEASPPDKVAVKVGGGDDHHDRHAPLTPRYDR
FT                   FDEPEGVTLLFEIPGVNSLDEVDLELDGNLLFLETTAARRYRVEVMLDQTFDPAGLRSR
FT                   LTHGVLEARLNR"
FT   gene            complement(612060..613628)
FT                   /locus_tag="Isop_0427"
FT   CDS_pept        complement(612060..613628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0427"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterProIPR001789: IPR002078: IPR002197: IPR003593: IPR
FT                   020441; KEGG: ank:AnaeK_1971 two component, sigma54
FT                   specific, transcriptional regulator, fis family; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   response regulator receiver; helix-turn-helix Fis-type;
FT                   SMART: response regulator receiver; AAA ATPase; SPTR: Two
FT                   component, sigma54 specific, transcriptional regulator, Fis
FT                   family; PFAM: Response regulator receiver domain; Bacterial
FT                   regulatory protein, Fis family; Sigma-54 interaction
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61022"
FT                   /db_xref="GOA:E8QYP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP6"
FT                   /protein_id="ADV61022.1"
FT                   /translation="MPSSATVGPASACRARVLITDDEPDVRWSLATLLSREGYEPIEAA
FT                   DGPTALELARRNAPDVALLDLNLPRRHGLEVFRDLLEVDPGLPVVVITAHGSPDAARQV
FT                   ASQGAFGYLSKPFNNEDVLFAVGRAAEARRRASATTPAWAPSSPPPSFANPDPIVSELE
FT                   GGSTVWGCVSTAMRRVADQVRRVAPTEFVVVVLGETGVGKEQVAQAIHRGSRRCAGPFV
FT                   PVDCGALPDHLVESELFGHERGAFTGADRSRSGRFETARGGTLFLDEIGNLSESAQASL
FT                   LRAIQDRCATRVGSDTPRRLDARIVVATHARLDDRVAQGRFRRDLFHRLAEFVITVPPL
FT                   RERPEDIAPLARLFVAQTARELERPNPILTDETLRRLHHHSWPGNVRELRNLMRRAVLW
FT                   ADGDQIEPDHLEFAEASPQSQSNVATPRSSESDSRFQLGNDRDPSPSMSHDEPTGSLKE
FT                   IVRRHVAVVERQAVAATLKQTGGNLTRAARLLGVDAKTLRTKARAYGLDFRDPDRAGSS
FT                   GGLEG"
FT   gene            complement(613851..616376)
FT                   /locus_tag="Isop_0428"
FT   CDS_pept        complement(613851..616376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0428"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR006121: IPR008250: IPR005834: IPR018303: IPR
FT                   017969: IPR000150: IPR006403: IPR006416: IPR001757; KEGG:
FT                   rsc:RCFBP_10117 copper transporting P-type ATPase; PFAM:
FT                   E1-E2 ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: Cation-transporting atpase
FT                   protein; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; Heavy-metal-associated domain; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: copper-(or
FT                   silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61023"
FT                   /db_xref="GOA:E8QYP7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP7"
FT                   /protein_id="ADV61023.1"
FT                   /translation="MPNLPSTPSSTGRRSLPTLPLLPSAESSTPAATPSTPSPQPIRGI
FT                   PSDWVVRGMHCASCVTRVERLLNEVPGVVAAQVNLATHQARVWREADDPRASDARLIAA
FT                   LKRGGYEMEPIARGDDNPAATLRAEWDRAARQWRRRWVLGALLSVPTLILALVGEASFW
FT                   GSALASLLALVTWSWVGWPFHQGAWRALGRGRANMEVLVSLGTTAALVAGTVAWWSGIG
FT                   SETKHASHGAGAVHHLADVGIILTVVAFGKWLETRSRRGAGAALERLLDQTPRFASRLE
FT                   PNAGEESDASAGIRTVPVQELRKGDRVRVRAGERVPVDGIIRSGRSAIDESLFTGESLP
FT                   VPRGPGDWVLSGTINGGGLLVVEALRLGEETALAGIGAMVRSALASKTDAQRLADRVAA
FT                   VFAPIVLGLAAVTLLGWLVWDGDATRAVWNAVAVLILACPCALGLATPMAVAVAVGRAA
FT                   REGLIVRDAAALERLARVRLVLFDKTGTLTLGKPQVVAVQTTPALDALDAPRVWRAIAQ
FT                   AEAVSTHPLASAIEHYAREAAQSSVPSANGNVPEPNKRSLDGSHLHGDEITGRGVEAVV
FT                   EGRTVRVGAPEWLEETSVDLTELRDWIHQQRDEARAVVAAAVEGRAVAALALSDPIRPA
FT                   AAELVAALKARGLTVEMITGDGPRAASVVAQALGIPAKAVHSQVRPEQKRHWVESTRAQ
FT                   LVRDEPGAGVAMVGDGLNDAPALAAADVGLAMASGVDLARAAADLVIVGDDPLGVIRAW
FT                   ELSRATRETIRDNLIWAFAYNVVGLPLAALGAFGAWGPIVAACAMAGSSLVVVLRSLRL
FT                   NHHPLRQRSAPPISHFTLSTPSHAWDRPS"
FT   sig_peptide     complement(616302..616376)
FT                   /locus_tag="Isop_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            616636..618060
FT                   /locus_tag="Isop_0429"
FT   CDS_pept        616636..618060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0429"
FT                   /product="sulfatase"
FT                   /note="COGs: COG3119 Arylsulfatase A; InterPro IPR000917;
FT                   KEGG: rba:RB4815 arylsulphatase A; PFAM: sulfatase; SPTR:
FT                   Arylsulphatase A; PFAM: Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61024"
FT                   /db_xref="GOA:E8QYP8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP8"
FT                   /protein_id="ADV61024.1"
FT                   /translation="MSRSWVGGGTRPRWEAWAWALTVPIVLGPSLRGEAREAGRDNAHP
FT                   RPNLVIVLCDDLGYGDLGCYGHPAIRTPRLDRMAKEGIRLTRCHAAVPVCSPSRAGLLT
FT                   GRHPHREGIRDWIPADSGIFLRADAPGLAKLLRAAGYRTAHVGKWHLNSRLDGTEPTPG
FT                   DHGFEHWLATQNNAAPSHMNPNNFVKNGQPTGPLEGHATTLVMDEALDWLKQRSDEEPY
FT                   FLNIWFHAPHEPVATPEEFRAPYRRFDEESEPNRSVYYGSVELIDHEVGRLLDAIDARG
FT                   DAARTLVVFTSDNGPETLRRYRGAVNSYGSPGPLRGRKLHIYEAGHRVPALIRWPQRIV
FT                   PGGVLDEPVGLIDLLPTMAELIDISLPEGVEFDGTSLVPLLQGQPLRRDVPLVFEYERA
FT                   LSRPFTGAVIDGPWKLLADAQAQRFELYRIDRDPGEQVNLLEHNKDQDREIAAVFERLT
FT                   RALAERRRAIEPPESR"
FT   sig_peptide     616636..616734
FT                   /locus_tag="Isop_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            618067..618300
FT                   /locus_tag="Isop_0430"
FT   CDS_pept        618067..618300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_151536 hypothetical protein;
FT                   SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61025"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYP9"
FT                   /protein_id="ADV61025.1"
FT                   /translation="MVGLTGDSSLWARNLQKIPPCLNRPRPLLSASVNPVIANVNTREF
FT                   IAIEYALEIVGLAPETQPVPNPDSTSRTESLK"
FT   sig_peptide     618067..618156
FT                   /locus_tag="Isop_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(618341..618877)
FT                   /locus_tag="Isop_0431"
FT   CDS_pept        complement(618341..618877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psl:Psta_3507 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61026"
FT                   /db_xref="GOA:E8QYQ0"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ0"
FT                   /protein_id="ADV61026.1"
FT                   /translation="MSSPTPLRDTTSAVDTEPIAEAVETDSEPPSPTNANTKAGAAKPK
FT                   RMFSWALLNFTLDAVLLAALLGLLWVSAVLVLVFPRATEADGWLLWGLSFDQWRNLQTA
FT                   FLVIIALLALEHLVLHWTWVCGVVNTKILKLKNKPSDAVNYMYGIGFFYGMVILMAIGV
FT                   IIAMLTVSAPPPPEF"
FT   gene            complement(619080..622271)
FT                   /locus_tag="Isop_0432"
FT   CDS_pept        complement(619080..622271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0432"
FT                   /product="membrane-bound dehydrogenase domain protein"
FT                   /note="InterPro IPR013428: IPR013427: IPR009056; KEGG:
FT                   psl:Psta_1994 membrane-bound dehydrogenase domain protein;
FT                   SPTR: Membrane-bound dehydrogenase domain protein; TIGRFAM:
FT                   membrane-bound dehydrogenase domain protein; heme-binding
FT                   protein; PFAM: Cytochrome c; TIGRFAM: putative
FT                   membrane-bound dehydrogenase domain; putative heme-binding
FT                   domain, Pirellula/Verrucomicrobium type"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61027"
FT                   /db_xref="GOA:E8QYQ1"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR013428"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ1"
FT                   /protein_id="ADV61027.1"
FT                   /translation="MFATSHFDFERFRSHARRSSSHPAASWRVAAALIGVMTTLSWGVA
FT                   TSGQDEPVPHNQDRPPNPARDPETARAAMTVPDGFHVELVAAEPDLVNPVAMTIDEKGR
FT                   FWITESLEYPRRSAGPGRDRLKVLEDTNGDGKADKVTVFADGLNIPSGVAVGGGGVWLA
FT                   NAPDLLFLKDTNGDGQADHREVVLTGFGRDDTHELPNSLTWGPDGWLYGLNGVFNPSTI
FT                   AYRGRIHKFTCALFRIHPVTREFEVFAEGTSNPWGVAFNHEGDAFLSACVIDHLWHLVE
FT                   TGYYHRQGGPYPPHTWKAESIVDYGHQKAAYCGIHFFDSDAYPPAYRGKLYMGNIHGGC
FT                   INVDEVNPVGATYKGTKHPDFLTANDAWFMPVVQKTGPDGCLYVLDWYDRYHCYQDANR
FT                   DPEGIDRLRGRLYRIRYGDTPRVVGLNLAAETDAQLLERLGASNDYLRDQARRLLWERG
FT                   TPAIAQRLQQMILDDSLPRVTRLNALFTRVAIGNLPVEDHLTLLSHPDPTVRAWAVRAV
FT                   GNAPAGPPARREAVAVRDEAGRTPVPSRQVDRRVWHRIVELALDPDPKVALQVAVAARK
FT                   MPDGIIDPVELLATLARHPSQDDLLARVVWQNLHPLLPGDPEGGDDAPATTRKPDGSRG
FT                   ATVFLNALANAPADQPAPNLEPMLARLAGIVEPADAARLLDLTQQRFAQRLDEVLSVLV
FT                   ARVGDGGSSPRAAWIEALGSKIGRLARRDTAPFAARQLAALLGDNASRTALLNLLAGDQ
FT                   VDPGQRLAVLETLLRAIPPDSDEAQRIALTVIDRLGDDATPLEDRARWLSALGRCESPA
FT                   LAAPLLESFDRLPAPLQPRVVELLTQRASWSEALLEAIAQGALDRSAVNLTQARKLQAS
FT                   GHPKVAKRAVELLGKVREGRNPEREQVVARMRELLFRTPGDPQRGKLVFAKVCAQCHVL
FT                   HGEGYDVGPELTNNGRNSYDQLISNTFDPSLVIGQAYQAVLVVVDDGRVLSGLKVEDGP
FT                   ERVVLKLQGGQLETLPRAAIEEIHVSESSLMPEKLEEQLTTQEIADLFEYLSWDKPPGA
FT                   PGARRLPDAPNFNAR"
FT   sig_peptide     complement(622128..622271)
FT                   /locus_tag="Isop_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(622770..624467)
FT                   /locus_tag="Isop_0433"
FT   CDS_pept        complement(622770..624467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0433"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="COGs: COG0568 DNA-directed RNA polymerase sigma
FT                   subunit (sigma70/sigma32); InterPro IPR007627: IPR007630:
FT                   IPR014284: IPR000943; KEGG: psl:Psta_2560 RNA polymerase,
FT                   sigma 32 subunit, RpoH; PFAM: sigma-70 region 4 domain
FT                   protein; sigma-70 region 2 domain protein; SPTR: RNA
FT                   polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70
FT                   region 2; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61028"
FT                   /db_xref="GOA:E8QYQ2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ2"
FT                   /protein_id="ADV61028.1"
FT                   /translation="MAGLFRHSAMKLLRDQQLRVATPERRLEQVNRIEALLEELEADRY
FT                   YPFEYLCYRVTGFRSEPSQAEPGLMLDGAEARHDLTRLLHDLAASVAQPIETVGEPIWT
FT                   VESLSRKFNVSVRTVSRWRRQGLVARRFLINGKPRVGFLDSSVARFVAAHQAQVERGSR
FT                   FRHVTPEEREDIIRRARRLAEEDRVGLGLIEIARRIAVAMERSTETIRTTLRDYDRDHP
FT                   DRPIFPEWSAPLEDETKQMIFNQHRLGVAVEVLAKQHRRTRSSIYRIINEVRAQRLLAT
FT                   KLEFIDNEEFPAIAADPVRKAEVLGPMPMPEDGKTPRKAKAPKGLPPYLASLYEVPLLS
FT                   REQETHLFRKMNFLKYLAQKLRDQVDPARARAGDLDQIEALQEEALAVKNQIISANLRL
FT                   VVSIAKRHVGPSNNFFDLVSDGNMSLIRAVEKFDFARGNKFSTYASWAIMKNFARTIPE
FT                   ENYRRDRFVTGHEEMFEAAADNRSDEHEQESNQRRMREGVNGMLSKLEPREQKIIVSRF
FT                   GINGAKEMTLEQLGKELGITKERVRQIEARAQQKLRKIAQEEKIDLPI"
FT   gene            complement(625762..626703)
FT                   /locus_tag="Isop_0434"
FT   CDS_pept        complement(625762..626703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB7149 signal peptide; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61029"
FT                   /db_xref="GOA:E8QYQ3"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ3"
FT                   /protein_id="ADV61029.1"
FT                   /translation="MNHPDPANKTSPPPIDHDLDGFATGTHSDPASKLPSSPRKTNQRG
FT                   WAGCIALGCVSLVVVGVVGMIAAGVLLRVLYREVLAYSEDQPQPLPRVEPLPEPLVRSL
FT                   KSDYETFKRRLESSLPPPSSGPSQRPESKPPTPIPNPPSSPPIAQTSPGADPPVEPAPA
FT                   DLQSQPPARWEPDLLELRLNADQINTLIQDHPDFRELRDRIVVFIEQDHLHCQFSVPIS
FT                   WIGIRLEEERYLNGEARIAVALKDGRLKLDVHDVRIKGRTLPTNLLNRLRRLDFNAQIE
FT                   TQSDGKRLLRSLESIEIRDGFLILRLAAPAEP"
FT   gene            complement(626859..628259)
FT                   /locus_tag="Isop_0435"
FT   CDS_pept        complement(626859..628259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0435"
FT                   /product="serine/threonine protein kinase with FHA domain
FT                   protein"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR000253: IPR017442: IPR020635: IPR002290: IPR
FT                   017441: IPR008271: IPR000719; KEGG: sro:Sros_3456
FT                   serine/threonine protein kinase-like protein; PFAM:
FT                   Serine/threonine-protein kinase-like domain;
FT                   Forkhead-associated protein; SMART: serine/threonine
FT                   protein kinase; Tyrosine-protein kinase, catalytic domain;
FT                   Forkhead-associated protein; SPTR: Serine/threonine protein
FT                   kinase-like protein; PFAM: Protein kinase domain; FHA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61030"
FT                   /db_xref="GOA:E8QYQ4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ4"
FT                   /protein_id="ADV61030.1"
FT                   /translation="MINPGELFVVGRSRFAQCPIPEDQVLSRDHFLLEVRDQRCVLRDL
FT                   GSTNGTFVNAARVTEVQLEAGDVIAAGASRFTLDWVCGDPPDDATSTATLSPPARAELL
FT                   SSRTTAEWSTTRAPIGESPSSQTGELVESRVRCLGCGRRAPAGLNVAGGSPSQPGPGGN
FT                   ESITWLCEACRGKAAESPQPIPGYTLLRQLGRGGMGVVHLARHEPTGRAVALKLIVPEV
FT                   AATRSAVDRFNREVSVLRKLKHPHIVELFDHGVSRGQIWFAMEYVAGPNLDELVRRHPG
FT                   PYPVGRACRVALQVLKALDHAHALGIVHRDVKPENILIGPGPEGVDRPRAPRVAKLTDF
FT                   GLAKSYRGLGLSGGLTFSGELRGTLPFLPPEQVTDFRSVLPSGDLYALAATLYHLLAGR
FT                   PPRDLPEDGGELMRALLEEPTIPLRRFRPDAPPGLEEVLRVSLAPNPADRFPTARAFRH
FT                   ALKPFAHD"
FT   gene            628543..629520
FT                   /locus_tag="Isop_0436"
FT   CDS_pept        628543..629520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0436"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="COGs: COG2313 Uncharacterized protein involved in
FT                   pigment biosynthesis; InterPro IPR007342; KEGG:
FT                   rce:RC1_0645 indigoidine synthase A like protein; PFAM:
FT                   Indigoidine synthase A family protein; SPTR:
FT                   Pseudouridine-5'-phosphate glycosidase; PFAM: Indigoidine
FT                   synthase A like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61031"
FT                   /db_xref="GOA:E8QYQ5"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ5"
FT                   /protein_id="ADV61031.1"
FT                   /translation="MKPSPTRPPTPTPMDEPDAVSDLGAPTDVPGWTGSPLVALESTLI
FT                   AQGLPWPDNLATALEAQRAVAESGAEGRTLAILEGKPRLGLSVEELEGMARRGSSRFRK
FT                   AARRDLAAALALGWDAATTVSATLFLARRAGIRVMATGGLGGVHRGWTERPDLSGDLLE
FT                   LADAHGCVVVCSGFKSILDLPATLEALETLGVALVGYCTDDLPAFTERSSGLPVPARVE
FT                   TPDQIAKIVRAHRTLGLPGAIVVVQPVDQAVALEDRLAREALDEALIDAERQGVHGAAL
FT                   TPFLLGRLRDRTGGASLIANRRLIVDNARLAGAIAVALAGTGTD"
FT   gene            630120..630971
FT                   /locus_tag="Isop_0437"
FT   CDS_pept        630120..630971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0437"
FT                   /product="succinate dehydrogenase (or fumarate reductase)
FT                   cytochrome b subunit, b558 family"
FT                   /note="InterPro IPR011138; KEGG: amu:Amuc_0986 succinate
FT                   dehydrogenase (or fumarate reductase) cytochrome b subunit,
FT                   b558 family; SPTR: Succinate dehydrogenase (Or fumarate
FT                   reductase) cytochrome b subunit, b558 family; TIGRFAM:
FT                   succinate dehydrogenase (or fumarate reductase) cytochrome
FT                   b subunit, b558 family; TIGRFAM: succinate dehydrogenase
FT                   (or fumarate reductase) cytochrome b subunit, b558 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61032"
FT                   /db_xref="GOA:E8QYQ6"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ6"
FT                   /protein_id="ADV61032.1"
FT                   /translation="MLKAFSTSVGKKAIVAVTGLGLFLFVFGHMVGNLQFFLGRDTLNR
FT                   YAEFLHSVPELLWVVRLGLLAFIVLHIAVTVKLWAENQAARPTRYVYQNYQRATLGSRY
FT                   MILSGLTVLAFIVYHLLHFTVRVVPDDYAYLYEDKIDGIPVVLSRESPLPGHGPATKVV
FT                   VRVASPSPSLADDATESQAAAEMTVSSRNLRHDCYGMVLAGFSQPPVVAFYLLAQVLLA
FT                   FHLSHGASSMFQTLGWNSPRYRPLVSRIGPVMATIICLGFISVPIAIQIDVWTGVFGFA
FT                   AG"
FT   sig_peptide     630120..630203
FT                   /locus_tag="Isop_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            631198..633126
FT                   /locus_tag="Isop_0438"
FT   CDS_pept        631198..633126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0438"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR003953:
FT                   IPR004112: IPR010916: IPR011280; KEGG: chl:Chy400_2032
FT                   succinate dehydrogenase flavoprotein subunit; PFAM:
FT                   fumarate reductase/succinate dehydrogenase flavoprotein
FT                   domain protein; SPTR: Succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; TIGRFAM: succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein subunit;
FT                   PFAM: domain; FAD binding domain; TIGRFAM: succinate
FT                   dehydrogenase or fumarate reductase, flavoprotein subunit,
FT                   Bacillus subtilis subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61033"
FT                   /db_xref="GOA:E8QYQ7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ7"
FT                   /protein_id="ADV61033.1"
FT                   /translation="MRVLDERLDAKIPDGPLAEKWTRHLGSIKLVSPANKRKFTVIVVG
FT                   TGLAGGSAAATLGELGYNVLAFCFQDSPRRAHSIAAQGGINACKNYQNDGDSVQRFFYD
FT                   TIKGGDFRSREANVYRLTELSCNIIDQCVAQGVPFAREYGGTLANRSFGGTQVSRTFYA
FT                   RGQTGQQLLLGCYSALARQIHAGRVKMFPRTEMLELVVENNRAVGIVTRDLVSGKIQSW
FT                   AGDAVVLATGGYGNVFYLSTNAKGCNVTATFRAYRKGALFANPCFTQIHPTCIPPHGEQ
FT                   QSKLTLMSESLRNDGRVWVPKKPGDKRHPNDIPEEERDYYLERKYPSYGNLAPRDISSR
FT                   SAKEVCDEGRGVGPTGIGVYLDFRDAIKRFGKSVIEARYGNLFDMYERITGENPYEVPM
FT                   RIYPASHYTMGGLWVDYNLMSNLPGLFVIGEANFSDHGANRLGASALLQGLVDGYFVLP
FT                   YTIGDFFANHGQSKVPTDHAAFVEAERQTTERNAKLLSINGQRTVDSFHRELGKIVWDK
FT                   CGMSRNAQGLRQALEKIPAIREEFWRNVKVTGSGEELNAQLENAGRVADFLEFAEVMCL
FT                   DALVREESCGAHFREEYQTPDGEAERNDRDYAHVACWKSNGVGQEPDLIKEPLNFEFVQ
FT                   PTTRSYK"
FT   gene            633126..633941
FT                   /locus_tag="Isop_0439"
FT   CDS_pept        633126..633941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0439"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterPro IPR017900:
FT                   IPR004489: IPR017896; KEGG: sro:Sros_8456 succinate
FT                   dehydrogenase/fumarate reductase iron-sulfur subunit; SPTR:
FT                   Succinate dehydrogenase/fumarate reductase iron-sulfur
FT                   subunit; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61034"
FT                   /db_xref="GOA:E8QYQ8"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ8"
FT                   /protein_id="ADV61034.1"
FT                   /translation="MSHSNGHASANGHASANGHGKTLNLTLHIWRQSGPDAPGRMVPYK
FT                   LEGVSTDCSFLEMLDLLNEQLILKGEDPIAFEHDCREGICGCCGVVINGHPHGPEQTTT
FT                   CQLHMRSFQDGAELYIEPWRAKAFPVIKDLVVDRSAFDRIIQAGGYISTNTGSAPEANS
FT                   ILVKKEEAEAAFNAATCIGCGACVAACPNASAMLFVAAKVAHFAHLPQGQIESSRRARA
FT                   MVAQMDQEGFGNCTNHGECEAACPKGISLDNIVLLNREYLKASLATAGT"
FT   gene            634063..634608
FT                   /locus_tag="Isop_0440"
FT   CDS_pept        634063..634608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0440"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="InterPro IPR011449: IPR013424; KEGG: lch:Lcho_2328
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1555; SPTR: Putative uncharacterized protein; PFAM:
FT                   PEP-CTERM motif; TIGRFAM: PEP-CTERM putative exosortase
FT                   interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61035"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYQ9"
FT                   /protein_id="ADV61035.1"
FT                   /translation="MRRFTTPLGFRPFCVECNCEPYLQNNPGGSGYAGNGPTATWQISN
FT                   FTQASGVRWPVDLTTDPGGLGVQVGGPFLTLADWLNPSVDHGAAAGFQNIASVLNAGTI
FT                   VTVQIGQGAGNPNTIGYVESITYTYTYTAFSGPTTYVGNFGVTPLDNVVPEPSTWVLTA
FT                   LVLVGSGLAWRRRRSRWD"
FT   gene            complement(634623..634931)
FT                   /locus_tag="Isop_0441"
FT   CDS_pept        complement(634623..634931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ncr:NCU02592 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61036"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR0"
FT                   /protein_id="ADV61036.1"
FT                   /translation="MVRWFGLHAASRVLGSDPDRSDRPPWHGRGLLVDPARPFLRLERR
FT                   PFGLACPASSRGVAVRSDSGCLVDRLGSANLVARVTPTCRGSRSPSFPIPTRAKMTR"
FT   gene            complement(635034..635318)
FT                   /locus_tag="Isop_0442"
FT   CDS_pept        complement(635034..635318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0442"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="COGs: COG1551 Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing); InterPro IPR003751;
FT                   KEGG: psl:Psta_2371 carbon storage regulator, CsrA; PFAM:
FT                   carbon storage regulator; SPTR: Probable carbon storage
FT                   regulator; TIGRFAM: carbon storage regulator; PFAM: Global
FT                   regulator protein family; TIGRFAM: carbon storage regulator
FT                   (csrA)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61037"
FT                   /db_xref="GOA:E8QYR1"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR1"
FT                   /protein_id="ADV61037.1"
FT                   /translation="MLVLSRHRDESIIIGDDIVITVVDIRGDKVRLGIAAPIEVSVHRQ
FT                   EVYEAIQRENKQASRLDPQEARQLDRVSPPFRRETRRRGDDQTRNANRS"
FT   gene            complement(635575..636099)
FT                   /locus_tag="Isop_0443"
FT   CDS_pept        complement(635575..636099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0443"
FT                   /product="protein of unknown function DUF180"
FT                   /note="COGs: COG1699 conserved hypothetical protein;
FT                   InterPro IPR003775; KEGG: gsu:GSU3040 flagellar assembly
FT                   protein FliW; PFAM: protein of unknown function DUF180;
FT                   SPTR: Transmembrane protein; PFAM: FliW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61038"
FT                   /db_xref="GOA:E8QYR2"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR2"
FT                   /protein_id="ADV61038.1"
FT                   /translation="MNLVTTRFGVVQVTDDQLIRVPEGLVGFRSLTSYALIPDPVVAGL
FT                   TWLQSTTDPETAFALVTPEQVVTEYKLDLRPGDKAALELTNGDDAVVYVILNRGETGGL
FT                   TVNLQGPLVINPHRRLGRQIVLTSSRYAVRYPLGSSASVAQPASSQDSDSSEPVEAAAA
FT                   GLIDVVARVSL"
FT   gene            complement(636722..637939)
FT                   /locus_tag="Isop_0444"
FT   CDS_pept        complement(636722..637939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0444"
FT                   /product="dipeptidylaminopeptidase/acylaminoacyl-peptidase"
FT                   /note="COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; KEGG: phe:Phep_0342
FT                   dipeptidyl aminopeptidase/acylaminoacyl-peptidase; SPTR:
FT                   Putative uncharacterized protein; PFAM: Prolyl
FT                   oligopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61039"
FT                   /db_xref="GOA:E8QYR3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR3"
FT                   /protein_id="ADV61039.1"
FT                   /translation="MRPLTRSHPLHPVVPTRRGFMGVAIAASWGWAGRIWACVSAASSY
FT                   RDRHDRPDLVIDSQGNTRALRNRDEWNERRQRIREAMQQVMGPLPVEGPCRQGPLNTTI
FT                   LQREEVEHDGIPIRRTLLTYAPDPGPAGDSKPVAVPAWLLEPLDCQDRSKPTRRPAMLA
FT                   LHQTIRIGKDEPVGLGDHPNRRYGVELAARGFVVLAPDYPGFGAHRVDPYALGYVSATM
FT                   KAIRDNLRGVDLLTALDSVDPARIGAIGHSLGGHNALFTAVFDERLAATVTSCGFTSFP
FT                   RYKNGDLSGWSHQGYMPRIRTVHHLDPARMPFDFPEVVAAVAPRGLFVSAPLHDDNFDV
FT                   QGVKDCLEAARPIFKLWDAPEALVAEFPDTGHDFPPATRQRAYQWLEQRLAARSSIQPI
FT                   KSNPAE"
FT   sig_peptide     complement(637829..637939)
FT                   /locus_tag="Isop_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(637973..640093)
FT                   /locus_tag="Isop_0445"
FT   CDS_pept        complement(637973..640093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0445"
FT                   /product="isoamylase"
FT                   /note="COGs: COG1523 Type II secretory pathway pullulanase
FT                   PulA and related glycosidase; InterPro IPR004193:
FT                   IPR006047: IPR006589: IPR011837; KEGG: dak:DaAHT2_1644
FT                   glycogen debranching enzyme GlgX; PFAM: glycoside hydrolase
FT                   family 13 domain protein; alpha amylase catalytic region;
FT                   SMART: alpha amylase catalytic sub domain; SPTR: Glycogen
FT                   debranching enzyme GlgX; TIGRFAM: glycogen debranching
FT                   enzyme GlgX; PFAM: Carbohydrate-binding module 48
FT                   (Isoamylase N-terminal domain); Alpha amylase, catalytic
FT                   domain; TIGRFAM: glycogen debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61040"
FT                   /db_xref="GOA:E8QYR4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR4"
FT                   /protein_id="ADV61040.1"
FT                   /translation="MTSSLSRATWLRRNRTYQFRGRELKVTRGAPLPLGATPTPQGINF
FT                   ALLCRNGTAVTLALFDVCGVVPQAEIPLDPKVNRTGDHWHIRIDGLPADLEFSYGYRVD
FT                   GPKGPKHAYNPDLILIDPNAPGMSCGKPWGHRGGPPRYSLIADFSRDDSVEVSPRIPRE
FT                   DSILYELHVRGYTIHPSSGVTHPGTYAGLIEKIPYLKDLGVTGVELLPVDEFDENDCPF
FT                   RNPFTGERHRNFWGYNTITFAAPKAAYASDPTGTNPLTEFRSMVRAFHHEGMEVILDVV
FT                   FNHTAEGGKGGPTYSFRGLDNALYYMLDDQGRYLNFSGCGNTVNGNHPIMREHVISSLR
FT                   GYVARAGIDGFRFDLASVFGRDRTGNVLVEPPIVEMITEDGLLADVKLIAEPWDAGGLY
FT                   QVGSFPFGNRWMEWNGKFRDDVRRFWKGDENMVPALASRICGSQDLYRDRSPLHSVNFI
FT                   TCHDGFTLWDLVSYNEKHNEANGEGNRDGCNYNHSWNCGVEGETDDPEVLKLRYRQVRN
FT                   LMATLLLSQGVPMILGGDEFLRTQRGNNNAWCQDNEIGWVDWNRARDQADFLRFVTMLI
FT                   ALRKRHPVLRRRTFLTGEGPEPDIHWHGVKPNKPDFAPWSRTLALAYDGRRCDRERVVD
FT                   RDLYIAFNAYHEPLEFVIPQSPTGRKWRRAIDTARPSPHDIVGLDQGPIVEFFKPQTLE
FT                   ARSLLVLVSESR"
FT   gene            640515..641945
FT                   /locus_tag="Isop_0446"
FT   CDS_pept        640515..641945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0446"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: dre:100330916 hypothetical
FT                   protein LOC100330916; SPTR: Cell surface flocculin"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61041"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR5"
FT                   /protein_id="ADV61041.1"
FT                   /translation="MRTGKALGWRQVATGLGLALTMAWGAAEAMATGHGLRRGGDIVVG
FT                   PVETVLVEPSTYVVPTAFVVPATRTTFLPVSTVRYQLVPTTRLVTAPVTTTYVASPTVL
FT                   VAGQPVRNVFRRLAPTRYDRITTTSGVLIETDPLVVAPTRLVETTSLVLPSSSVVVSEV
FT                   VSSDSVCCGGTAVVTYGAPIASNETVVITESPSASSTGMASTPTDRSRDRAAQPATTMT
FT                   PERRNRIANLSRPLNTPQIANDRQSVVAPVAPRIESTPMNTPPPPARTSPPAKSTPEPR
FT                   SKPSVDSLDDADLPPLPPADDGILDPAPRLESPPPNPATPPERTGESDTVPLPNSSGDA
FT                   TPAASSPKPSTRLEESDPVEIPSLDLPPAVGSGINRRDARKPVVMAILEGRVLNGQTRL
FT                   PEAGVRVILSDLERKQEDRVVQTDAQGRYLVKLPDGVWNLSAQFDDGRMRNYGDFVVMD
FT                   GVVTDANGRVYANVVLRR"
FT   sig_peptide     640515..640601
FT                   /locus_tag="Isop_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            642267..642512
FT                   /locus_tag="Isop_0447"
FT   CDS_pept        642267..642512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS03706 transcription regulator protein;
FT                   SPTR: Probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61042"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR6"
FT                   /protein_id="ADV61042.1"
FT                   /translation="MSDEIEVGLVSNDVEATLVVNLLLEKGIAARSDASSTGPLFGGAS
FT                   FDAGHRILVPVESARKAREILEHYPNFKPRDASADS"
FT   gene            642493..643794
FT                   /locus_tag="Isop_0448"
FT   CDS_pept        642493..643794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0448"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: afw:Anae109_1425 glycosyl transferase
FT                   group 1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61043"
FT                   /db_xref="GOA:E8QYR7"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR7"
FT                   /protein_id="ADV61043.1"
FT                   /translation="MPPPTLEPITQLAFLSTASLEPGSEPSEVGDGQRLRVGLLVSWFY
FT                   PAESGAERQALEQGRELLRQGHQVGVVTGRLPGRPSFERIDGLEVHRVIRSIRLGPLFG
FT                   LSYLASAVAALIRLGPRFDVIHTHQALWEAIAAGLARPGLGRVPVLVQPASSGAFGEAD
FT                   QLRTLRGWPILLRWMLRNDGFVAISREIADQWRTLGVPEDRLWLSRSGVDARRFHPGPS
FT                   AWDRPTVDSPPSPLPPRPRVVFTGRLHPQKNLDFLIDVWPEARRRAGGVGSLLLAGDGP
FT                   ERDRLERLAACRLEEFGPEAVGSIRWLGRVADPSELLRACDLFVLPSVAEGMSNSLLEA
FT                   MASGLPSVVSKIGGNVDLISEGPEATGRLVDPTDRDGWINALSDLLSDPTTRQAMGRRA
FT                   RARIEAEYDLPVVVAANLKIYRELIRRRSRGAAT"
FT   gene            643924..644997
FT                   /locus_tag="Isop_0449"
FT   CDS_pept        643924..644997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0449"
FT                   /product="phosphate:acyl-(acyl carrier protein)
FT                   acyltransferase"
FT                   /note="COGs: COG0416 Fatty acid/phospholipid biosynthesis
FT                   enzyme; InterPro IPR003664: IPR012281; KEGG: plm:Plim_2567
FT                   fatty acid/phospholipid synthesis protein PlsX; PFAM: fatty
FT                   acid synthesis plsX protein; SPTR: Phosphate
FT                   acyltransferase; TIGRFAM: fatty acid/phospholipid synthesis
FT                   protein PlsX; PFAM: Fatty acid synthesis protein; TIGRFAM:
FT                   fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61044"
FT                   /db_xref="GOA:E8QYR8"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR8"
FT                   /protein_id="ADV61044.1"
FT                   /translation="MRIALDVMGGDHAPGPIVKGAVEATRDQPGLTVVLVGPTERIEAE
FT                   LTQFPEADRDRLPIVEASEFITMEDKPVEALRRKRDNSIAKCWGLMARGEVKAVVSAGN
FT                   TGAMVAAGLMNAKMYLPGIRRPGIAAIFPSHQGPIVIMDVGANLAAKPEDLYQYGVMGA
FT                   IYSEHVLGVTAPRIGLLNIGSEEGKGNELVRAAFTLFQQSHLANRFVGHVEGRDLYEGH
FT                   ARVVVCEGFVGNVLLKAGEGAVEFLFSVLNQDFAQLSTALPGDLGLQLRDRLRCIKTRF
FT                   EYQEFGGAPLLGIQGACIICHGSSGDRAIHNALRVAATMAEVKLNELILDALADSPAQP
FT                   SHADANPVPLGSDPNPA"
FT   gene            645138..646049
FT                   /locus_tag="Isop_0450"
FT   CDS_pept        645138..646049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0450"
FT                   /product="(Acyl-carrier-protein) S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /note="COGs: COG0331 (acyl-carrier-protein)
FT                   S-malonyltransferase; InterPro IPR014043: IPR004410; KEGG:
FT                   psl:Psta_1725 malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; SPTR: Malonyl
FT                   CoA-acyl carrier protein transacylase; TIGRFAM: malonyl
FT                   CoA-acyl carrier protein transacylase; PFAM: Acyl
FT                   transferase domain; TIGRFAM: malonyl CoA-acyl carrier
FT                   protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61045"
FT                   /db_xref="GOA:E8QYR9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYR9"
FT                   /protein_id="ADV61045.1"
FT                   /translation="MGRTAFLFPGQGAQVVGMGCELIRDRAEARDLFARANDLLGFDLT
FT                   AICLDGPPEALNATDVSQPAIFVASLAALEDLKATRPEVVAACEGAAGLSLGEYTALTF
FT                   AGALDFEAGLKIVRLRGQAMQEAALASPSGMTSVIGLDEAAIDQLCQRLAPYGRLWKAN
FT                   LLGHGNIVVSGENAALEHLEPIAAELGASRCVPLTVAGAFHTPLMKPADQRLAAALAEI
FT                   ELRPPRLPVYSNVDARVHTDPDEIRDLLVRQVIAPVRWEESMNAMIADGFDSFIEIGPG
FT                   RVLAGLLKRIHRKIPCENIPAR"
FT   gene            646149..646931
FT                   /locus_tag="Isop_0451"
FT   CDS_pept        646149..646931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0451"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002198: IPR020904: IPR011284:
FT                   IPR002347; KEGG: psl:Psta_1726
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR:
FT                   3-oxoacyl-(Acyl-carrier protein) reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61046"
FT                   /db_xref="GOA:E8QYS0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS0"
FT                   /protein_id="ADV61046.1"
FT                   /translation="MSSAAETFQGCLVDLTGQTALVTGASRGIGRAIAHQLARCGANLA
FT                   LVARSEASLHSVIEEIAALGTPGKVQAFPGDVGKAEEIEAIVAKVEETMGGRIEILVNN
FT                   AGITRDGLLLNMSDDQWDEVILVNLRSVFVFCRAVARLMLRQRYGRIVNVSSVSGVVGN
FT                   AGQTNYSASKAGVIGFTKALSRELGKRKITANVVAPGFIATDMTERLPDDIKKMVKEKT
FT                   SLQRMGEPSEIADAVTWLVGPGAGYVTGQVIVVDGGLT"
FT   gene            complement(647025..648866)
FT                   /locus_tag="Isop_0452"
FT   CDS_pept        complement(647025..648866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0452"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902: IPR001120; KEGG: plm:Plim_1302
FT                   protein of unknown function DUF1559; SPTR: Putative
FT                   uncharacterized protein; PFAM: Prokaryotic N-terminal
FT                   methylation motif; Protein of unknown function (DUF1559);
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61047"
FT                   /db_xref="GOA:E8QYS1"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS1"
FT                   /protein_id="ADV61047.1"
FT                   /translation="MYTIFFFKNEVSSFSSVLCETSDYFFRLTRESEHEPFVVNAIVQK
FT                   EGGQDYRKFQISLDLQVDSLIKAAFTISMVPIKTILGHPSFRIVKTSESLSAEGEPQVK
FT                   FEFRCDDPSHWVGDGSVTLLPNSDWAIAEYDVKLLPRGIREGTPAGMREKARIRYQRGP
FT                   KGEILPKEIVSQFVPSKGAAEEYIHQFETFEPTKVADSQFKLSQFGLPDSLLDFEPGGE
FT                   PAWPTWSIWAGLAVVALLVSIVLRVVALRSNRVASLSAARSGFTLIELLVVIAVIAALI
FT                   ALLLPAVQSAREAARRAQCANHLKQFGLGLQNYHDVFGCLPPGRIKSYDPRYSGPNPPC
FT                   TSLLIDKSLHVFILPFVEQTPLHNAINQNLTVFGVENRTIHTVSVGIYACPSDPDSGRP
FT                   REMAFEGRFTPDDLLSPDTRLQMVFTSYVGCMGTLRTHGFPLPWDNCVVPPMRFAQMNG
FT                   VFHDLSPVTLAMVRDGLSHTLFVSEKATTLLRELDALDPSLSKRFGWYVAGNWGDTVFT
FT                   TMYPPNAPKKLSRVATLGWIHSASSLHPGGLNALMGDGSVRFVKETISSWPNNVASGLP
FT                   VGASEHSQGWWENVPASGVWQMLSTRNGGEIISAEDY"
FT   gene            complement(648877..649086)
FT                   /locus_tag="Isop_0453"
FT   CDS_pept        complement(648877..649086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61048"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS2"
FT                   /protein_id="ADV61048.1"
FT                   /translation="MPVLLCSLFFGAMISLVIQENPPGWEARLKAEYPDAAAKLETAVA
FT                   EVQCEGASREGKNHEYRFLIYTQN"
FT   sig_peptide     complement(648994..649086)
FT                   /locus_tag="Isop_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(649190..649420)
FT                   /locus_tag="Isop_0454"
FT   CDS_pept        complement(649190..649420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:749912 hypothetical protein LOC749912;
FT                   SPTR: Copper-exporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61049"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS3"
FT                   /protein_id="ADV61049.1"
FT                   /translation="MSRLIRLSSSLSAAATTFLFGLALFASAGNSWADDPQTPTPIALQ
FT                   CVDVKCTCTGNVTCPTAMCADCRCFGTLCVI"
FT   sig_peptide     complement(649322..649420)
FT                   /locus_tag="Isop_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(649504..650046)
FT                   /locus_tag="Isop_0455"
FT   CDS_pept        complement(649504..650046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cat:CA2559_07901 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61050"
FT                   /db_xref="GOA:E8QYS4"
FT                   /db_xref="InterPro:IPR011467"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS4"
FT                   /protein_id="ADV61050.1"
FT                   /translation="MSINMIESKVAPSQFRVKLGPALIVASVGLIGLATWVFAWFGSIG
FT                   VASAYLAGARLIPDTHSKSFGTIDRGTDGIVVFHLTNWKTQPITIVGAQSVCTCVATGD
FT                   LPMTIPPGETRPLNVKLKTTLEDEGPVSQEILLFTDDRKHRTVGLRVSGVVRSAGRSIE
FT                   ELVQENLEKTIPNESRK"
FT   sig_peptide     complement(649900..650046)
FT                   /locus_tag="Isop_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(650384..650566)
FT                   /locus_tag="Isop_0456"
FT   CDS_pept        complement(650384..650566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0456"
FT                   /product="IKI3 family protein"
FT                   /note="KEGG: act:ACLA_046450 IKI3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61051"
FT                   /db_xref="GOA:E8QYS5"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS5"
FT                   /protein_id="ADV61051.1"
FT                   /translation="MPTRLADSTRLNVRFVRIGLAALLVFVFTTLAWSNLNRSHSTPPA
FT                   ERLFPLHVAPDPVSL"
FT   sig_peptide     complement(650444..650566)
FT                   /locus_tag="Isop_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(650817..651596)
FT                   /locus_tag="Isop_0457"
FT   CDS_pept        complement(650817..651596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dpe:Dper_GL18878 GL18878 gene product from
FT                   transcript GL18878-RA; SPTR: GA17967"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61052"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS6"
FT                   /protein_id="ADV61052.1"
FT                   /translation="MGQSKPQPKPRLVKPAPVRGAAPSPPKPAPPPPKPVNDLADLDPF
FT                   EAKMKRDPLPTSSEVRVVVLIARETETDRADGEAVAQSLTTLLSERRRPSEVRIEPIAP
FT                   DGVAAALTRATQDAEQPIILIAASRQPWTAAHLDPLLQVLDLADHVVGHRRAGWFVELK
FT                   RMLARWPWRFLMAVPAFDLNSPASIHRRDPWKGLILQSRGRFAQVEWLAKATFQTQIVS
FT                   TVPIPPLDSIDLDAAGPHGVADRWAVLTQPRFQPNPA"
FT   gene            complement(651598..652590)
FT                   /locus_tag="Isop_0458"
FT   CDS_pept        complement(651598..652590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0458"
FT                   /product="aminotransferase class IV"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR001544; KEGG: tkm:TK90_1969 D-amino-acid transaminase;
FT                   PFAM: aminotransferase class IV; SPTR: D-amino-acid
FT                   transaminase; PFAM: Aminotransferase class IV; TIGRFAM:
FT                   D-amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61053"
FT                   /db_xref="GOA:E8QYS7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS7"
FT                   /protein_id="ADV61053.1"
FT                   /translation="MSDVAGPRSLACLNGEFAPPEETRVPIWDRGFLFGDSVYEVVRLY
FT                   DGRCWLESAHLRRLEHSLAAVRITGVDLTQLMSRTRQTIEQSGVREGTVYIQITRGVAP
FT                   RRHAFPAPGTPPTELIVVQPFDVRPTRLRQETGVGVVSRPDHRWKRCDIKSTNLLANVL
FT                   AAQDAAEAECLEAVLFDARGYVTEATHSSVLWVRGGRIAATPEGPEILPGTTRHLARKL
FT                   AERIGRSFVEEEVTLDELRTQTAEVMLVGTTIEVMPVVKLDGRPIRDGRPGPITRALQD
FT                   AYAQALAEWLAAGPNAPDPWADFGVGMRRSSAHHDTSSASSASLTTAAS"
FT   gene            652921..653253
FT                   /locus_tag="Isop_0459"
FT   CDS_pept        652921..653253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0459"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR013766: IPR017937: IPR005746: IPR006662: IPR
FT                   017936; KEGG: tal:Thal_1357 thioredoxin; PFAM: Thioredoxin
FT                   domain-containing protein; SPTR: Thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61054"
FT                   /db_xref="GOA:E8QYS8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS8"
FT                   /protein_id="ADV61054.1"
FT                   /translation="MAGHVAEFTDANWTTEVMESPIPVLVDFWAPWCGPCRTLAPTIEK
FT                   LAAEFEGRVKVGKMNTDENPNIPGGLRISAIPTVILFHEGKVVDRLVGVTPEGKFRDVL
FT                   AKINIQ"
FT   gene            653402..654139
FT                   /locus_tag="Isop_0460"
FT   CDS_pept        653402..654139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0460"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="COGs: COG0135 Phosphoribosylanthranilate isomerase;
FT                   InterPro IPR001240; KEGG: gme:Gmet_2492
FT                   N-(5'-phosphoribosyl)anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); PRIAM:
FT                   Phosphoribosylanthranilate isomerase; SPTR:
FT                   N-(5'-phosphoribosyl)anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate (PRA) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61055"
FT                   /db_xref="GOA:E8QYS9"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYS9"
FT                   /protein_id="ADV61055.1"
FT                   /translation="MSLPDHAYAAVSSSSPLRVKICGVVNLAAANAARRAGADWIGLNF
FT                   SPPSPRALDPPESAAEIVAALGHERVVGLFVNRPVPEIAAFAQRVGLRLIQLHGDETPK
FT                   EAQLLASAGLQVIKAFRIGDAEAIAQARRWLDQAHALTQGQVPFACLFDAFVPGRFGGT
FT                   GATLAASLLEGLRPMMASSALRPILAGGLTPENLAERLELCPARPWMVDVAGGVESAPG
FT                   VKDPTRMAAFVAAARRFAASRFE"
FT   gene            654206..656896
FT                   /locus_tag="Isop_0461"
FT   CDS_pept        654206..656896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0461"
FT                   /product="peptidase U32"
FT                   /note="COGs: COG0826 Collagenase and related protease;
FT                   InterPro IPR001539; KEGG: psl:Psta_3009 peptidase U32;
FT                   PFAM: peptidase U32; SPTR: Peptidase U32; PFAM:
FT                   Collagenase; Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61056"
FT                   /db_xref="GOA:E8QYT0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYT0"
FT                   /protein_id="ADV61056.1"
FT                   /translation="MSASPDPSPGSTALSPLTPPELLAPAGDWECLRAAIENGADAVYL
FT                   GLRGGHNARARAANFALEELPEVMATLHHRGVKGFVTLNTLVFPRELDDLEPLVRRIAE
FT                   AGTDAVIVQDLGLVRLIRAITPDLEIHASTQMSVTSASGVRLARELGCARVVLARELSL
FT                   KEIAAIRREVDLPVEVFVHGALCVAYSGQCLTSEALGGRSANRGACAQACRMPYEIVRD
FT                   GELMDLDHQKYLVSPQDLAAHDLIPQLAALGVASLKIEGRLKGPEYVAGVVRHYRRVLD
FT                   QLADRGPEEATRAALDPEAIRTLELTFSRGLTHGFLEGLNHKKLVRGDYAKKRGLFLGQ
FT                   VTSVRGGWIGVNLAAPVKPGDGLVFDGDERLDVPEQGGRVYQLRRLSRRARLDPVDRAE
FT                   AGLVELAFSRRDLDPNQIHVGQRVWKTDDPELNRALRATFEGGKPRRRLRLDLTLRARL
FT                   GAPLRLEGRVPEWSRMESGKELHVVVESPEPLVEAHSRPIEEAELRNQLDRLGDTVYQL
FT                   GRLTIERDPAAHLPKSLLNQMRRALTAQLDRLATAPPHRVLASEPVLPALRRAVPRCDV
FT                   GTTTTPTESPRLSVLCRNSAQAEAIAALGPDLLTLEYHDLRNYRESIARIRSIAPNLPI
FT                   HVATPRIEKPGEAPIFRYLMKSKPDGLLVRNHGGLEFCATHKVPFVADFSLNAANELTV
FT                   ALLLDKGASRVTASYDLSLEQVLDLLEPTRLDPSRVEIVLHQHIPMFHMAHCVFCAFLS
FT                   PGTDKTNCGRPCDRHEVKLRDRVGAEHPLKADVGCRNTLFNATAQSAVRDLPRLRERGA
FT                   VWYRVELLDEPPQTAAAIVELYQQALQDATIGRSVWTKLNAEFGYGLTRGTFGHQTPES
FT                   NLVQIRRRSPAHGVREGVGLGGSSP"
FT   gene            complement(657189..658505)
FT                   /locus_tag="Isop_0462"
FT   CDS_pept        complement(657189..658505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0462"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR006311; KEGG: plm:Plim_1207
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; SPTR: Probable dehydrogenase; PFAM: Oxidoreductase
FT                   family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61057"
FT                   /db_xref="GOA:E8QYT1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYT1"
FT                   /protein_id="ADV61057.1"
FT                   /translation="MRKVAPASLDPVAPPPAAIGVPNRRAFVKTAAGASLLTMVPLVHA
FT                   AGTDTLKVALIGCGGRGTGAAENALSADPNTKLVAMADAFADQIESSLAALQQSPVASR
FT                   VEVPSDRRFVGFDAYKAATDEADVVILASTPRFRPDHMAYAAERGKHAFVEKPIATDAP
FT                   GVRKFLDACKVAQSKNLSVVAGLCWRYYKPRVEGMAKVHDGAIGDLVAIETTYNSGGVW
FT                   EPRVTRDQCQSEMEYQMRNWYYYDWLSGDHIVEQAIHGIDTMAWAMKDVPPVRCFGVGG
FT                   RQSRTDAKYGNIYDHFSIVYEYENGVRGYHQCRHWRQTANQVKDYVLGSQGVFDVFAPR
FT                   ITGAQPWRNRDRAQHNMYQYEHEVLFTSIREGRPKADGDFVAKSTLLAIMGRMAAYTGQ
FT                   VITWDMAMNSTEDLGPATLAWTDEVPKRPVPIPGVTKFA"
FT   sig_peptide     complement(658371..658505)
FT                   /locus_tag="Isop_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(658891..659715)
FT                   /locus_tag="Isop_0463"
FT   CDS_pept        complement(658891..659715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0463"
FT                   /product="LamB/YcsF family protein"
FT                   /note="COGs: COG1540 conserved hypothetical protein;
FT                   InterPro IPR005501; KEGG: bcv:Bcav_1377 LamB/YcsF family
FT                   protein; PFAM: LamB/YcsF family protein; SPTR: LamB/YcsF
FT                   family protein; PFAM: LamB/YcsF family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61058"
FT                   /db_xref="GOA:E8QYT2"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYT2"
FT                   /protein_id="ADV61058.1"
FT                   /translation="MSDVPTSAPPAFRPRLIDLNADLGEGLPWDAAILPEITSANLGCA
FT                   RHAGTPDDVRRTLEAIARQRDSHQPGATPTLRVGAHPGHPDPDHFGRRVLPITPQGLRD
FT                   LLLEQTHDLIAWAGEFGLTVAFLKPHGALYHQILDDPDLVDTALDVAHLLGLDLVGMPH
FT                   TPLFERATRRHPALRVVAEGFVDRRLTSQGRLWPRSQPGAILTDPEDIARQIEDLLTRG
FT                   VETLCVHGDRPEAVELARWTRQVIKRSGWQVGWPTPRQTSDATPIPLPSPKA"
FT   gene            complement(659712..660392)
FT                   /locus_tag="Isop_0464"
FT   CDS_pept        complement(659712..660392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0464"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="COGs: COG2049 Allophanate hydrolase subunit 1;
FT                   InterPro IPR003833; KEGG: nde:NIDE1154 putative allophanate
FT                   hydrolase subunit 1; PFAM: Allophanate hydrolase subunit 1;
FT                   SMART: Allophanate hydrolase subunit 1; SPTR: Putative
FT                   uncharacterized protein; PFAM: Allophanate hydrolase
FT                   subunit 1; TIGRFAM: conserved hypothetical protein
FT                   TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61059"
FT                   /db_xref="GOA:E8QYT3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E8QYT3"
FT                   /protein_id="ADV61059.1"
FT                   /translation="MMEPLGERGWLMRFECVERASAFARWVERASWPGVLDVVAAFETV
FT                   AVLVDPDRIDPAEELPCRLREGLRWIEEGKRVVSVVHHTIPVRYDGPDLEWVADRVGLS
FT                   PEAVAAAHAAATYRVAAIGFLPGFPYLEPTTPSSPLRAIPRLARPRPRVEVGSVALAGD
FT                   QTGIYPRVSPGGWRLIGRTPLILADLERDWFRFHVGDSVSFQPIDPDEFQRLRDHPPDP
FT                   IPRP"
FT   gene            660637..662229
FT                   /locus_tag="Isop_0465"
FT   CDS_pept        660637..662229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB13032 putative permease; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61060"
FT                   /db_xref="GOA:E8QZD3"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD3"
FT                   /protein_id="ADV61060.1"
FT                   /translation="MSDVLTSVMGGVLRLLQAGGDAVPHLLVGVITAGVAWAIGPRRVR
FT                   ALLGAEEGRGFLMASFKVWLVGLALPLDALGVLPVLPILTGSGVRLGLVVMFALSAPLF
FT                   NPLSLAYAAGSMTLGLVATHLGLAWLFPALVGWLAERLARVWSAGDETHTPPLASLGSS
FT                   DRATRAIRAVGWSAAGAGGWWRDVAWALAGTILVGAFYPNWLMDDHTGQGDPTAPLRMA
FT                   GLTSFYLVNPEKLVPLLAQAEQKAGSSGASVVLTLLGVGLSLGLISYLARVCSLRLALS
FT                   VLGLTLGLGLALAQAVHGFLPTRSSEYDYNHAFDQMARPPVSENFNTFFQKLRETITPV
FT                   PNGTANPAAPTGLGMLLAIVVVGTIDRRRVQARRSEDSQNEAVVDPDGGPIGGGGWNVI
FT                   FPQWLVVLLGGLIALGVLVGALYAFLPGPQATLDAIGIARAEVASFGAAEARSDRLVQL
FT                   HAWRTALGRLDWGMRLRGQRLTPDQVHMVRTILGHLDEAIARTEAGDDEAAMAAFRQAN
FT                   LLHPALRTAVLEH"
FT   sig_peptide     660637..660750
FT                   /locus_tag="Isop_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            662481..663878
FT                   /locus_tag="Isop_0466"
FT   CDS_pept        662481..663878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plm:Plim_0653 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61061"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023917"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD4"
FT                   /protein_id="ADV61061.1"
FT                   /translation="MAIPARLVMVEDDAVAGLDPLTLTRPAFELRLGMTTLRDKAARAA
FT                   GLQQAPHAALIRSHLAAYWRERDPCLAINTLATEGRLHDQPALVVNARFIPGETFDLVH
FT                   TIAQANRPVLGFCDDLPAFALVGPDQLRGLDEVHAVGAWFERLATQPGVETVATDGEWI
FT                   RYPWDLVARNARHLERDFQNLTRKTNGQGPRFDLDEFLAGGQRALVGPADRLWIDPTAR
FT                   IDPFTVLDTTGGPIVIEAGALLQPFTRVEGPCYIGARTQLFRANLRGGVSLGPECRIGG
FT                   EVEESLVLGYSNKYHEGFLGHAYIGEWVNLGAITSNSDLRNDYGPVVVPLGGDPVPSGM
FT                   LKVGCFVGDHTRTGLGSMINTGTVVGVMCNLLPAGTLLPKHVPSFTAVLYGKVAPGFDL
FT                   DHLFATARTVKGRRGLSFTAAEEEFYLTLFERTRFERERAFTRSAAKRWAHPASLPSVS
FT                   ASQQQHG"
FT   gene            663981..665828
FT                   /locus_tag="Isop_0467"
FT   CDS_pept        663981..665828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0467"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR000583: IPR001347: IPR005855:
FT                   IPR017932; KEGG: plm:Plim_1342
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: sugar isomerase (SIS); glutamine
FT                   amidotransferase class-II; SPTR:
FT                   Glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: SIS domain; Glutamine
FT                   amidotransferases class-II; TIGRFAM:
FT                   glucosamine--fructose-6-phosphate aminotransferase
FT                   (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61062"
FT                   /db_xref="GOA:E8QZD5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD5"
FT                   /protein_id="ADV61062.1"
FT                   /translation="MCGIVGFTGGRPAAPAILAGLRRLEYRGYDSAGMATLTRERGLVW
FT                   VKRAGRVDALEHHLQVEPLAGCCGIGHTRWATHGPANDVNAHPHLGGRDLQAPLVALVH
FT                   NGVIENHEPLRNQLRDEGYLFQSQTDTEVIAHLVARELEAGRNLFDAVRHVTELLEGTY
FT                   GLAAISPREPGVIVGARLGSPLVVGVGEDEHLVASDASALVAHTPHVIYLQDGETVRLT
FT                   PRHCRVEHRERGSVTPRIDRIDWKPDAVELGRFEHYMRKEIHEQPNTVRDALRGRLRLA
FT                   EASAQFGGLNLTARQLRRVRRVVFAACGTSWHAALLGEHYIEKLAHLPAEVEYASEFRY
FT                   RNAPLDDQTLFFVLSQSGETADTLGALREARRRGFPTLAIVNTVGSTIAREADGGVYLH
FT                   AGPEIGVASTKAFTSQLVVLALLALHLGRLRHLSYDEGRRLIAALEELPDQIERVLAIE
FT                   PQVEEAAHRMVQATSALYLGRDLNFPIALEGALKLKEISYLHAEGYPTAEMKHGPIALI
FT                   DPATPSVFVAPRGGLHAKTLGNIEEVRARKGPVLAVGTQGDDQLARLVDQMLPIPEAHP
FT                   LTQPILACVPLQLLAYHVARLKGCDIDKPRNLAKSVTVE"
FT   gene            complement(665846..667465)
FT                   /locus_tag="Isop_0468"
FT   CDS_pept        complement(665846..667465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0468"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR001173:
FT                   IPR013216; KEGG: plm:Plim_3541 glycosyl transferase family
FT                   2; PFAM: Methyltransferase type 11; glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase, family 2; PFAM:
FT                   Methyltransferase domain; Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61063"
FT                   /db_xref="GOA:E8QZD6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD6"
FT                   /protein_id="ADV61063.1"
FT                   /translation="MRGLGYLDSTFAHMQFQKNQLTIFHDNLVRVVVVVPCFNEARRLD
FT                   RDAFARFLQGADPGVRLLLVNDGSTDRTLEHLRELAAHHPERLDVLDLTRNVGKAEAVR
FT                   QGVLRGLEHWPSAEFVGYWDADLATPLEEIPGFLRVFQDRPHLVAVIGSRVKLMGRQIE
FT                   RRATRHYLGRVFATFASLSLGLSVYDTQCGAKLFRVSEPLRAVFAEPFHSRWIFDVEIL
FT                   ARMQRLARLEALPPVETVVYEYVLSQWRDVAGSKLKPTDFLRAALELVRITRHTRHWVP
FT                   QQMQTRPEILNPKIMLEPEYERMYRTEDHYWWFVARRELVADWVARLNLPEGAVILDVG
FT                   CGTGANALAWTRFGTVVGVDFSDQALERCQRRGLSELARGDATKLPLGDATADALVATD
FT                   ILEHLEDDRAALIEWKRVLKPGGHLVLTVPAYRFLWGEHDVALMHHRRYVASELLARAR
FT                   EAGFEVTRSTYAFSLLLPVAVVQRLLTRKPPGDRPPEAKFPAVPDWLNTALIRFQRLET
FT                   SLLRHLSTPFGLSVLAVLKRPT"
FT   gene            complement(667483..668193)
FT                   /locus_tag="Isop_0469"
FT   CDS_pept        complement(667483..668193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0469"
FT                   /product="Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro IPR003382; KEGG:
FT                   tad:TRIADDRAFT_49959 hypothetical protein; PFAM:
FT                   flavoprotein; PRIAM: Phosphopantothenoylcysteine
FT                   decarboxylase; SPTR: Putative uncharacterized protein;
FT                   PFAM: Flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61064"
FT                   /db_xref="GOA:E8QZD7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD7"
FT                   /protein_id="ADV61064.1"
FT                   /translation="MIMARVVLGTTGSVAALKTPEVVRLLRGRGHEVRVIATARALHFF
FT                   DPSDFDDPTVELLRDEQEWPEERYQRGDPIPHILWRDWGDLLMVAPLDAQTLARFALGL
FT                   CDNALACVYRAWLPERPVLLAPAMNTAMWRHPVTCRHLAMIARDLADDPNDPDAIPRFH
FT                   LEDAAVTIHRHVRRLTLAAPIVKTLACGDHGVGAMAEPTDLVEWVEFALRRAGHPTTTH
FT                   HATPTNDNHPPLAT"
FT   sig_peptide     complement(668146..668193)
FT                   /locus_tag="Isop_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(668403..668648)
FT                   /locus_tag="Isop_0470"
FT   CDS_pept        complement(668403..668648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_1503 Tat pathway signal sequence
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61065"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD8"
FT                   /protein_id="ADV61065.1"
FT                   /translation="MPMISTTPPRPLTSLKLPGEYDGLEGLIEIDLQALVHVLASQAHE
FT                   RLRLTPRQRDALETNLWNRLVTAVNETMEPFTIENR"
FT   gene            669325..670755
FT                   /locus_tag="Isop_0471"
FT   CDS_pept        669325..670755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0471"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="COGs: COG0124 Histidyl-tRNA synthetase;
FT                   InterProIPR002314: IPR004154: IPR004516: IPR015807: IPR
FT                   006195; KEGG: rba:RB251 histidyl-tRNA synthetase; PFAM:
FT                   tRNA synthetase class II (G H P and S); Anticodon-binding
FT                   domain protein; PRIAM: Histidine--tRNA ligase; SPTR:
FT                   Histidyl-tRNA synthetase; TIGRFAM: histidyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61066"
FT                   /db_xref="GOA:E8QZD9"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZD9"
FT                   /protein_id="ADV61066.1"
FT                   /translation="MIDPRVASGLRDLPPSLAIPREHLATVFRGVFARAGFVPIETPHI
FT                   ERLEVLTGKGAGSEEVLRQIFDVTNKGGKPGELALRFDLTVPLARFIAKHVDTVGVPFK
FT                   RYAIGSVFRGERPAKGRFREFTQCDVDIVGVDGPLADAEAVLAIHDALKAAGIPPFRIK
FT                   LNHRAILDGLLETLGASERLPAVLRSLDKLDKIGRDKVIEELTGVRRRPEGQGESDAAA
FT                   PCSPPEETECEPVLTPEQAARVLNFAEKGRGGLEVLDLAKIDPEAAAHPKAIAGVERLR
FT                   QVVELAQAGGADPERIGVDLGLARGLDYYTGIILETVVLGWERFGSVASGGRYDNLAGL
FT                   FTSRRLPGVGASIGLDRLLALLEEAGTLETRGTIAPVLVTWFPGVPGAVPLGLAARLRA
FT                   VGVGAEVYPEPIAVGKQMGYGSQRGHRLGLIVGPDEVAARVFNLRDLASRDELKAIPWD
FT                   RLESTIQHRLNLSEGAPA"
FT   gene            670752..672521
FT                   /locus_tag="Isop_0472"
FT   CDS_pept        670752..672521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0472"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="COGs: COG0124 Histidyl-tRNA synthetase; InterPro
FT                   IPR002314: IPR006195; KEGG: hau:Haur_3835 histidine--tRNA
FT                   ligase; PFAM: tRNA synthetase class II (G H P and S); SPTR:
FT                   Histidine--tRNA ligase; PFAM: tRNA synthetase class II core
FT                   domain (G, H, P, S and T)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61067"
FT                   /db_xref="GOA:E8QZE0"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE0"
FT                   /protein_id="ADV61067.1"
FT                   /translation="MTADPPANVSQPNEPASSPQLAASLDDPDLEPPIEPIRGTRGWSP
FT                   HSFESLEVVEEALMASFLQAGYDRLRTPVLEPVELHARKSGAAIVSKLFEVNGAEVPAC
FT                   LRPEFTAGIVRTFSAMEQTPTLPWRVCVSGPVFRNEAVGELAERPEPNGITQPKLREFH
FT                   QVGVELLGASGPEIDAEIIWLADWSLARLGIEQRLIRLGDLSLAREVLAGAGLPPALLA
FT                   PLIEMVSEGAAQGGSVRSMERGLDQLSRWAALSVSGGPDRHDEESAHASASASMSNASS
FT                   TDLERMLGVALPGQAGRGRRDPAEITRRLQRKWTLARQLPAVLDRLRGGVERLHDLRGP
FT                   APTILPRLEREFGAVAPASTAAIQDLVASLADHGVDPDRIELDLGLGRGLGFYSRMVFE
FT                   IVARTPRGPVELGGGGRYDGLARVLGSTRDDRGVGFALGLERVWHVLNASGRLRSSPWR
FT                   EPLGFLVLPDGPRRIPQAVGLAVHLRDLRQRAVLETNLHPHHPEAQARAAELGVAHVVV
FT                   VRGPWRDSGSLLIQSPPAAPPRAVGLEELTALTAENPGSGPGRGSSASTATSVGLSNAS
FT                   NPSAATTRWTARD"
FT   gene            672527..673663
FT                   /locus_tag="Isop_0473"
FT   CDS_pept        672527..673663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0473"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="COGs: COG0040 ATP phosphoribosyltransferase;
FT                   InterPro IPR013820: IPR018198; KEGG: hau:Haur_2634 ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; PRIAM: ATP
FT                   phosphoribosyltransferase; SPTR: ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61068"
FT                   /db_xref="GOA:E8QZE1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE1"
FT                   /protein_id="ADV61068.1"
FT                   /translation="MTHSSHGLLDPLDPIRLALPSKGELADGAVDLLKSAGFKVKRTSP
FT                   RQYEAQIAGRPRFHVVFMRPTDIVTQVHEGRCHLGVTGGDLHAERAAQADQARIVLPDL
FT                   GYGGCRLVVAVPESWVDVAHMIDLAELAHDFKTRGRAFRVSTKSPRLVRDHFHHWGIFS
FT                   FQIVESDGALELHPSLGIADIIVDLTSSGTTLKDNRLKEIAEGTVLESSAVLIGHTPSL
FT                   RTLLAEGDDGPLAHLLDAIEGAREAETCHHLEVVGGRPMVYGDADAEKVAAYLAARGAS
FT                   QIYRGEVRDEEGRIGWRVTARIAAGQVVACQRALFDLGASRIVALPTHFVFDRERPRAF
FT                   DRLRAELLGSDAKPAPTATLPTAVPAPEPPAASPTGSA"
FT   gene            673712..674566
FT                   /locus_tag="Isop_0474"
FT   CDS_pept        673712..674566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0474"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: rba:RB2626 hypothetical protein; PFAM:
FT                   Methyltransferase type 11; SPTR: Putative uncharacterized
FT                   protein; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61069"
FT                   /db_xref="GOA:E8QZE2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE2"
FT                   /protein_id="ADV61069.1"
FT                   /translation="MHDQKHQQRNKHTCDRYDDPRAWPSWRLPEGTDRGLWEYVHSDEI
FT                   ARTEFDLFRDDPLCRTDEAILMEWTPKSPGRVLDLGCGAGRHSLLLAANGFEVVAVDLS
FT                   QPLLREVKRRTYDAGLARRIAPLRANLRRLECLADASFDLAVCLFSTLGMVRGADHRAA
FT                   VVRQVARLLKPDGSLILHAHNLWLNLRVPGGRRWLLGQLGSALAGNPYWGDRSACYRGV
FT                   ANVVVHLFTWGELVGLLRSAGLRVVRKLPLHEATARPIPAPWLFPHIRAGGWILQARRS
FT                   NQN"
FT   gene            675151..675669
FT                   /locus_tag="Isop_0475"
FT   CDS_pept        675151..675669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0475"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="COGs: COG0290 Translation initiation factor 3
FT                   (IF-3); InterPro IPR019814: IPR019815: IPR019813:
FT                   IPR001288; KEGG: psl:Psta_1536 translation initiation
FT                   factor IF-3; PFAM: Translation initiation factor 3-like;
FT                   SPTR: Translation initiation factor IF-3; TIGRFAM:
FT                   translation initiation factor IF-3; PFAM: Translation
FT                   initiation factor IF-3, C-terminal domain; Translation
FT                   initiation factor IF-3, N-terminal domain; TIGRFAM:
FT                   translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61070"
FT                   /db_xref="GOA:E8QZE3"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE3"
FT                   /protein_id="ADV61070.1"
FT                   /translation="MPNAAPDRGLRINEQIRISPIRVVSADGEMLGILPRERALELARE
FT                   AGLDLVEVSPNERPPVCKIMDYGKFKYEQKKKASKNKPHQAVLKEIRVRPKTGEHDIEF
FT                   KVKQARGFLADKDKVQLVVQFRGRELAHIEEGRKVMNEVLQMLEDVAKIERAPTMENRK
FT                   MIAIVAPKV"
FT   gene            676123..676401
FT                   /locus_tag="Isop_0476"
FT   CDS_pept        676123..676401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0476"
FT                   /product="ribosomal protein L35"
FT                   /note="InterPro IPR021137: IPR018265: IPR001706; KEGG:
FT                   pfr:PFREUD_14060 50S ribosomal protein L35; PFAM: Ribosomal
FT                   protein L35; SPTR: 50S ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35; PFAM: Ribosomal protein L35;
FT                   TIGRFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61071"
FT                   /db_xref="GOA:E8QZE4"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE4"
FT                   /protein_id="ADV61071.1"
FT                   /translation="MPSIKAKTHKGIKKRFKVTGTGKVIHKRCGSSHLNSHKSGKKIRQ
FT                   LRRKSVITVNAVAQKLRRHLRTREVITPGRGKAAAEPATPTTESSES"
FT   gene            676723..677115
FT                   /locus_tag="Isop_0477"
FT   CDS_pept        676723..677115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0477"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="COGs: COG0292 Ribosomal protein L20; InterPro
FT                   IPR005813; KEGG: psl:Psta_0380 ribosomal protein L20; PFAM:
FT                   ribosomal protein L20; SPTR: 50S ribosomal protein L20;
FT                   TIGRFAM: ribosomal protein L20; PFAM: Ribosomal protein
FT                   L20; TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61072"
FT                   /db_xref="GOA:E8QZE5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE5"
FT                   /protein_id="ADV61072.1"
FT                   /translation="MRAPKGAARNKAKKRIFKRSKGFVGGRRRLLKSAKETLLRAGVFA
FT                   YRDRRTKKRQFRRLFITRLNAAARMRDLRYSELINGLKLSKCGLDRKSLSELAIFDPEV
FT                   FDVIVARAREALQQAAAHRNTAKAAV"
FT   gene            677353..678375
FT                   /locus_tag="Isop_0478"
FT   CDS_pept        677353..678375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0478"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COGs: COG0016 Phenylalanyl-tRNA synthetase alpha
FT                   subunit; InterPro IPR002319: IPR004529: IPR006195; KEGG:
FT                   psl:Psta_0379 phenylalanyl-tRNA synthetase, alpha subunit;
FT                   PFAM: phenylalanyl-tRNA synthetase class IIc; SPTR:
FT                   Phenylalanyl-tRNA synthetase, alpha subunit; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, alpha subunit; PFAM: tRNA
FT                   synthetases class II core domain (F); Aminoacyl tRNA
FT                   synthetase class II, N-terminal domain; TIGRFAM:
FT                   phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61073"
FT                   /db_xref="GOA:E8QZE6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE6"
FT                   /protein_id="ADV61073.1"
FT                   /translation="MSASPPETAPEVSQALDDLRCLEMEGRAAFEAAATPEAVEAARVD
FT                   FLGMKSGRLKSAQARLKELNPAGKRIYGQAFNETKAALEQAHEAARLRVSSQRGVASRL
FT                   DVTLPGTAPRLGHRHPLTQTIEELIDLFARFGFSLALGPEVEDVFHNFEALNIPETHPA
FT                   RDPSDNFYLNTGALLRSQTSTVQIRVMEAQRPPVRIISLGRVYRPDEMDQTHSFMFHQI
FT                   EGLMVDRGVTMADLKTVLRMFCSAYLGEEVTIRFRPSFFPFTEPSVEVDMKWIGGDHWV
FT                   EMGGAGMVDPNVLRAVGYDPEQVTGFAFGLGIERLCMRRHQIDDIRLFYQNDARFLRQF
FT                   "
FT   gene            complement(678395..679246)
FT                   /locus_tag="Isop_0479"
FT   CDS_pept        complement(678395..679246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0479"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: psl:Psta_2472
FT                   phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR:
FT                   Phospholipid/glycerol acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61074"
FT                   /db_xref="GOA:E8QZE7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE7"
FT                   /protein_id="ADV61074.1"
FT                   /translation="MNQRIISDIITIKAFSLTVIIGLAALVGALVVRRASVGPQTFDPR
FT                   RIPFPPEDAVGPAAACLWWINWLYCRLMHRLVVVNPCPLPHSGPALLICNHTCGIDPFL
FT                   LQAACRRVLGFMVAREFAEPWWARPIIRMVGGIPVRRDGSDLAAAREAIRALKRGRVVP
FT                   IFPEGRILPLSGKELLEARPGAAFVALKAGVLVIPAYLRGTPPTNNVFRAFVTPSRAEL
FT                   RFGPPILADQLREGLDPNRRERDQLNEVARRLMSAIDDLRRQAWGDTLDSNPNSTFPPG
FT                   LS"
FT   sig_peptide     complement(679142..679246)
FT                   /locus_tag="Isop_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(679397..680743)
FT                   /locus_tag="Isop_0480"
FT   CDS_pept        complement(679397..680743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0480"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR019775; KEGG: rca:Rcas_1659 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61075"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE8"
FT                   /protein_id="ADV61075.1"
FT                   /translation="MMVKRGVQSGSRVAAATWATLMLAGWSGGGTIPAARADALGWADG
FT                   IWMVRTSWQAIREGSSPTASDAFEPDSVSAETTPSGNSSSPGAVSRPVVTWSQNRPTTT
FT                   VPTRFNAEAPATAPRAFAFRQPEIVPPEPIVVPTHFYSLPHRLPVPSPPPSLTSAPTNP
FT                   GPSFSSTTNLLRRSDYDAFINFSSGPYAFADSLTVGTPGPWYQSPAITRFFQGQPPDPA
FT                   TQRQLIDQILSKVEGVYTRSFERYAPEGVSVPELELTINPNDFTRRSLSVVSGASYGPI
FT                   PSAVGIAHTGFHGFTFVDKFTQPQTLDELITALSNNIAHELMHVFGVDHHDTTGLYLDS
FT                   GITSWEVITDPEAVFGPEAVADLLSRDFRSVSHRPGVRLGQEIGDRPSCALGNTCSLHG
FT                   GGWTEILPQDAVQAQILAAPVPEPHAVLVWTLSGGALAILAARRRTNRA"
FT   sig_peptide     complement(680633..680743)
FT                   /locus_tag="Isop_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            681555..682550
FT                   /locus_tag="Isop_0481"
FT   CDS_pept        681555..682550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_144070 flagellar associated
FT                   protein; SPTR: Flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61076"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZE9"
FT                   /protein_id="ADV61076.1"
FT                   /translation="MSASQTSPSTWNDATAEELGGFDRNHVARLYVGDPVARLLLDHFA
FT                   AVAPEKASYVNSLESLLIRKSLSEDFPAPSRRQIVDVLQELEQAGCGEYWAGKHDWSSR
FT                   FNWSVDSNDVGRLAAEHAGLIDPGELVSTNGQEVQAAEGGATVSSEGAPLAAGGSADTA
FT                   VAGADLVEAASFTAEAFSQLGAAWGDLAAEAEALVETPVESPPSSEPSSDWNAAASAPV
FT                   EVAREEPVAEAVEAPVEPAQVDQPEPEPAAVAAVEESAAWHSEPVAANEPSIVASGAAI
FT                   VDEESENAAYLEHSFQLRPGLRITLTLPTDLTRSEARRLAIFLKSLPFQD"
FT   gene            682773..683891
FT                   /locus_tag="Isop_0482"
FT   CDS_pept        682773..683891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0482"
FT                   /product="repeat-companion domain protein"
FT                   /note="InterPro IPR003590: IPR014338; KEGG: amd:AMED_5837
FT                   leucine-rich repeat-containing protein; SMART: Leucine-rich
FT                   repeat, ribonuclease inhibitor subtype; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: repeat-companion domain
FT                   protein; TIGRFAM: repeat-companion domain TIGR02996"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61077"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR014338"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF0"
FT                   /protein_id="ADV61077.1"
FT                   /translation="MARQQHRGKNPSQVDWAERSHFMEAIRAAGEFDDTPVLIYADFLE
FT                   EQGEPERANFIRLQVEAARSWGDSAERRRTVRRTIQELLETHAGLWRERELPLIRGLNW
FT                   NHYERGLVRTITVRRLQIVVEYADTIFNAAPIDGVCLRDPPSDAFISNTLLNQTPADQL
FT                   AWIEHPVWDWIQRFDFKGCELRGRLLVFVERARWPKARTLNLSGCRLEDEDLQGMAFGR
FT                   WEPLTRVIRLNLNHNTFSDEGLITLAESLAHGTKMLPLEELFLAGHCESVWRPSEVPEE
FT                   PPPSPSLFERLRERLSFRGSRPQETRPPRGQFHLEARGRLTKQVIPALVKLANAAPKLR
FT                   TIDLSDHPALVEPEVVQPLRDSGIRVCIGMRR"
FT   gene            complement(684103..684585)
FT                   /locus_tag="Isop_0483"
FT   CDS_pept        complement(684103..684585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0483"
FT                   /product="Ferritin Dps family protein"
FT                   /note="COGs: COG0783 DNA-binding ferritin-like protein
FT                   (oxidative damage protectant); InterPro IPR008331:
FT                   IPR002177; KEGG: psl:Psta_1613 ferritin Dps family protein;
FT                   PFAM: Ferritin Dps family protein; SPTR: Ferritin Dps
FT                   family protein; PFAM: Ferritin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61078"
FT                   /db_xref="GOA:E8QZF1"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF1"
FT                   /protein_id="ADV61078.1"
FT                   /translation="MFPTRNDLPESTRTAMIALLNERLADAIDLRLRAKHAHWNVKGPQ
FT                   FIALHELFDDLADAVAELSDDLAERAVQLGGVAHGLIGQVESGSKLPAYPTKAVSGHDH
FT                   VEALADALAALAKATRAAIETAEQHGDAVTVDLFTQASGVLDKQLWLLEAHLHAKN"
FT   gene            complement(684727..686742)
FT                   /locus_tag="Isop_0484"
FT   CDS_pept        complement(684727..686742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0484"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="COGs: COG0308 Aminopeptidase N; InterPro IPR014782:
FT                   IPR015211; KEGG: amc:MADE_03140 putative cold-active
FT                   aminopeptidase; secreted using a signal peptide; PFAM:
FT                   Peptidase M1 membrane alanine aminopeptidase; Leukotriene
FT                   A4 hydrolase; SPTR: Peptidase M1 membrane alanine
FT                   aminopeptidase; PFAM: Leukotriene A4 hydrolase, C-terminal;
FT                   Peptidase family M1"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61079"
FT                   /db_xref="GOA:E8QZF2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR015211"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR034015"
FT                   /db_xref="InterPro:IPR038502"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF2"
FT                   /protein_id="ADV61079.1"
FT                   /translation="MKHHALPNRSLWFLLAASASQTLLTLVGWIAFTWANLLNPISSRA
FT                   DFPMNIPAASEHIDTHSRGRPWEIAVNHLALDLTADFQAKRLQGEATLTLKVAPDVPKE
FT                   THLYLDVKGLDIIGVAAVGPVGEPECPLSYRLDGNDPILGSALIVTPPEGDPARFATTR
FT                   VKITYRTTPEAGALQWLEPVQTAGGRHPFLFSQSQAIQARTWLPLQDSPGARLTFEAIL
FT                   RVPPELTALMAAQRLQPRPDDPPGLFRFRLDQSIPPYLIALAVGDLAFAPLGPRCGVFA
FT                   EPSVLPKAAAEFDEIEAMIAAVEARFGPYRWGRHDILVLPPSFPFGGMENPCLTFATPT
FT                   ILAGDKSLVALICHELAHSWSGNLVTHATWRDFWLNEGFTVYLERRILEQLYGPERRDM
FT                   EAVLGYESLKQALKDLPEADQRLYIDLTGRDPDDGLTEVPYEKGALLLTRLEQAFGRER
FT                   FDRFLKDYFDHFAFQSIRTADFVDWTQTRLFPLDPQAAATIDLDAWLNQPGLPADAPTP
FT                   RSNRFEAVVQVADQFARGQLPAEALPVANWTTHEWIHFLESLSDRPNASLVADLERVHH
FT                   LFHQGNAEIRQRFLMLALRSDPATAWPHVERFLGSVGRRKFLMPLYNELIKTEEGRRRA
FT                   EAIFEKAKAGYHPIAVDSIARKLAQAAGQVPPANVP"
FT   sig_peptide     complement(686608..686742)
FT                   /locus_tag="Isop_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(686739..688322)
FT                   /locus_tag="Isop_0485"
FT   CDS_pept        complement(686739..688322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_1892 isochorismatase hydrolase; SPTR:
FT                   Isochorismatase hydrolase; PFAM: Isochorismatase family;
FT                   Trehalose utilisation"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61080"
FT                   /db_xref="GOA:E8QZF3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF3"
FT                   /protein_id="ADV61080.1"
FT                   /translation="MRIPLEWHRLILATVTLATTLDPGGSLARADQPSAPLHIVMLSGS
FT                   DEYESARTLPAFAQELTRRFGVSCRVLQAQGVERLPGLEALDACDLMIVFTRRLRIQGD
FT                   DLARIQGYCASGKPIISIRTGSHGFQTWLEFDRIHLGGNYRGHYNKNVLMTAHVVPDHR
FT                   DHPILKGLEVAALRSRSSLYQSGPLAEDCQALVMGRTAQGEEPIVWVRDHAPGRVAAIS
FT                   IGSPEDFENGTFRQLLIQTIAWATGRPLVEPQGDPPPPSTSNTNQRLTWTQRRRLIDHG
FT                   QVQVVETHVAIPARRVAFLICDMWDDHWCPSAARRCDQLAQRMASLVDRLRQAGVTIIH
FT                   CPSDTMGFYRGHPAREWVSRLPRPAADRFPVVERPDPPLPIDDSDQGCDTPGVAPFRAW
FT                   MRQNRRLSIHPEDAITDNGEEVLALITHRGIEQVIVAGVHTNMCVLNRSFGIKALTRRG
FT                   VSCVLARDLTDAMYNPASPPYVSHERGTELVVEHIETHWCPSLDSASMMVDDSPAAQPA
FT                   ASSSSGNAPR"
FT   sig_peptide     complement(688233..688322)
FT                   /locus_tag="Isop_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(688409..690763)
FT                   /locus_tag="Isop_0486"
FT   CDS_pept        complement(688409..690763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0486"
FT                   /product="VWFA-related domain protein"
FT                   /note="InterPro IPR002035: IPR017802; KEGG: plm:Plim_0632
FT                   hypothetical protein; PFAM: von Willebrand factor type A;
FT                   SMART: von Willebrand factor type A; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: VWFA-related
FT                   Acidobacterial domain protein; PFAM: von Willebrand factor
FT                   type A domain; TIGRFAM: VWFA-related Acidobacterial domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61081"
FT                   /db_xref="GOA:E8QZF4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF4"
FT                   /protein_id="ADV61081.1"
FT                   /translation="MKLARRSSRTEPSNRKPSPRPLPSLGVAFALLGWLLGFHLGVPTY
FT                   AQKSDPAFERAVANAIEQGIAWLRDRQSPQGIYSLGRFNLGMTALAGLAFLENGVPAND
FT                   PAIAKICGVVLETASRDRETYNVALAILFLTRLRLEAQPDTDSSDASALDQFLFDLARR
FT                   LDAGEAGGMWDYNVPIDDDPALATSARRRAERRANRLEPEPETQPQADSPIADRRPRRP
FT                   NRPKRGDNSNTQFALLGLWAAGRAGDPEAGTRFDCNGGLEAIDRHFRETRNPRGGWGYR
FT                   PGAGDTPAMTCAGLMGLAIGASRPERAELRTARARGADLANDPAFREALAVVARDVRTI
FT                   GPQSDVYYLWSLERVCVALGLTELDGVDWYRVGAEELIRRQRPDGSWPDHPGWGALPNT
FT                   ALALLFLRKANLAFELDRVLRLPPLEAGRPDRPAALTPVSFQQSNANDEPFDFDLEDNA
FT                   ALNDPNGVRVIIRSADETNFPKITLDFEVKGPDGKAITSARKEDFKVTEYDREVEILDF
FT                   VSPKGEVQLRPTTVVLVLDTSGSMLQDNRIGALKEAVGVFLGTLPPGSKVAVIEFNSFV
FT                   NPLVFGPANEIFTTRFDDVKSQVNRFRANGGTSYYDAVDRALELIANQTGRRAVLALTD
FT                   GEDTSSRLAGLDSVILKARNLGLPVHTLGVGREDEIEVGELQRLARETRGRYFPARDAT
FT                   KLRVIFAELAQSLRESYSLTYRTDRDLPDGTLRPVKVFYRGRVESAGERALYIPGMVVP
FT                   ATGWSPLFLGIVAGLIALAVLPGRLKSRPAA"
FT   sig_peptide     complement(690626..690763)
FT                   /locus_tag="Isop_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(690767..692461)
FT                   /locus_tag="Isop_0487"
FT   CDS_pept        complement(690767..692461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0487"
FT                   /product="Forkhead-associated protein"
FT                   /note="InterPro IPR000253; KEGG: pic:PICST_67887
FT                   hypothetical protein; PFAM: Forkhead-associated protein;
FT                   SPTR: Predicted protein; PFAM: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61082"
FT                   /db_xref="GOA:E8QZF5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF5"
FT                   /protein_id="ADV61082.1"
FT                   /translation="MTKGTVPGHRHPLPSRPGDKALVLGNRLNGELGIDLRDQEPPNSP
FT                   RRMSGRHARIDPPAQPGESPRLTDLEGSTGTFVNRQRLLAGQVRPLKAGDLIQLGPVQL
FT                   KVVAEALTEPQTPTRPSPPPSAAAPSRPVAAKAQNTPVSALAKPVARTPQPQPNSLPNP
FT                   PGTTTRPPQPQSQSSSPPPSGKASVTLAGFQLKNGPLCRSWQDFARVSAQRWGSLREEL
FT                   VSGRLAGFFHAQGRPDLAPDPNAPGSPDERLDAWLARLPITPPPAPELDLNPTTLNVRM
FT                   PPPGASTTRTIRVSNVGYRILKGGPPRVEPANTPWLKLSPPFDRRAIVVIDQPVDIPVD
FT                   IALAETADPAALAGKRAAILFDTNGGVGRVEVVLERAPQLQTEPNFASPPDDPAASAIL
FT                   GASWIAELRAELADTPPLRRLILGGLALGGLRLLAGLLNAGFALAGLPIGSDEPAALGV
FT                   ALPLTLLGVFAGLKLASERSDTQWNDRPPLAIAGAIGGLCLTALITATFRSIEDALGLR
FT                   SLEPPWLASALAVPLWFVVGGVLLAFFGSRPPTTSRSTPPSPSPSGA"
FT   gene            692768..693394
FT                   /locus_tag="Isop_0488"
FT   CDS_pept        692768..693394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_6850 type IV secretory pathway VirD4
FT                   protein-like protein; SPTR: Type IV secretory pathway VirD4
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61083"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF6"
FT                   /protein_id="ADV61083.1"
FT                   /translation="MRMWLREWAMALGVALAVGLGPSCQPGLALTLAESVGPGDRLGVL
FT                   DSFLGEWEGRVKGSEGTSPIFRARYTRMLDGAAVLYELKVEPSPGTDLNNLILKYTYAH
FT                   HTIIFWDAGVNSPRARGVNTNGDAWDAVWTLSEPGNADTSAGRVWTIESTILDAEGHTS
FT                   AMTILKTCDGPDRFVETLQPRSEPNNPTPGPDLIIEFVRVKPAAK"
FT   sig_peptide     692768..692866
FT                   /locus_tag="Isop_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            693513..694634
FT                   /locus_tag="Isop_0489"
FT   CDS_pept        693513..694634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0489"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG4638 Phenylpropionate dioxygenase and
FT                   related ring-hydroxylating dioxygenase large terminal
FT                   subunit; InterPro IPR017941: IPR001663; KEGG:
FT                   chl:Chy400_2532 Rieske (2Fe-2S) domain protein; PFAM:
FT                   Rieske [2Fe-2S] iron-sulphur domain; SPTR: Rieske (2Fe-2S)
FT                   domain protein; PFAM: Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61084"
FT                   /db_xref="GOA:E8QZF7"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF7"
FT                   /protein_id="ADV61084.1"
FT                   /translation="MAIYERPPMPPDAVGLPARCYTELSWFLREREVFFGKGWVCVGRT
FT                   HDLAEPGDYRLVEIAGESLIVLRDRDGLIRAFFNVCRHRGTRLLNEAEGRLGNTIQCPY
FT                   HSWTYRLDGSLRAAPHMESSAAFQPENLGLIAAAVDEWDGHLFVSLEENPPPLAERLEG
FT                   LVELARPYEMGRLKRGARVVYEVKANWKLIIQNYSECLHCPANHPALKKVTHYLSGDNG
FT                   PARPGFLGGSMDLLDGVETMSATGKRRTLHPNLPERLHTKCQFYAVLPNLLLTLQPDSM
FT                   MTHLLWPRDPGHTTIVCDWHYDPSDLNQPDFDPSPEVELWDQTNREDWRLSELTQLGMA
FT                   SRAYRPGPYSNREDLLYAFDRLVVERVGDPSAS"
FT   gene            complement(694648..695565)
FT                   /locus_tag="Isop_0490"
FT   CDS_pept        complement(694648..695565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA3330 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61085"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF8"
FT                   /protein_id="ADV61085.1"
FT                   /translation="MRRGERGWEAHWRLRLARLGLEWRGALESSRDEEGVVDRIAGWSS
FT                   GVDSVFLERAGHACRAVGRLEWEKTRDRVAPVHLGTAMLISPRLVAFAALSIPPELGRG
FT                   SRKPGHHHATTFDLSALRVVFGEGHDSEGRIRPPQRFVLEEHHVVWVEPSLGVVVAAVA
FT                   ETNSEGHAVGDRGYLPLLDDTGAVVPGERISQIHHGEQHAQRIVLRGRRIDRVGGTRYR
FT                   LKPSIAPDEPGSALFNDQWEWLGLTVGLDDQGRALASRAGALRTGLARELRRQRLQPMW
FT                   SAEGIDRIEEALDPLVEPWVVGLP"
FT   gene            complement(695714..697885)
FT                   /locus_tag="Isop_0491"
FT   CDS_pept        complement(695714..697885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0491"
FT                   /product="protein of unknown function DUF255"
FT                   /note="COGs: COG1331 Highly conserved protein containing a
FT                   thioredoxin domain; KEGG: psl:Psta_0467 protein of unknown
FT                   function DUF255; SPTR: Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61086"
FT                   /db_xref="GOA:E8QZF9"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZF9"
FT                   /protein_id="ADV61086.1"
FT                   /translation="MSASDSGFQATSRPANRLARETSPYLLQHAHNPVDWFPWGEEAFA
FT                   KAKAENKPIFLSVGYSACHWCHVMERESFESPTIAALMNQWFVNIKVDREERPDIDQIY
FT                   MAAVQALNQGHGGWPMSVFMTPEGEPFFGGTYYPPHDARGMPGFPRILEGLATAWRERE
FT                   PEVREAAARLVEHLRKRNEPMPPLIKGPALDHPAADDRDGLDPGWIAEAARALGRVFDS
FT                   RYGGFGSAPKFPHPMDLKLLLRHHQRVQDPRALAMVIQTLDHMSRGGIYDHLGGGFARY
FT                   ATDERWLVPHFEKMLYDNALLISALAETIQCRPDPTLARVVVETLDYLAERMTGPPEAP
FT                   GFFATEDADSEGVEGKYYVWSRDEMLETLGEPLGSLFAEVYDVTEAGNWEGHSILNLPE
FT                   PLDRVAQRLGRPTDQLAAELAQARALLKARRDRRIPPGKDTKILTSWNGLMLAAIAEAA
FT                   WVVDRPDHLERAEKAAGFLLDHLRQPDGRLFHVFKDGRARFNGYLEDYAYLIDGLTRLG
FT                   QVTGTTRWIREARDLSRLMIEEFGDEVIDGVGGFAFTGVRHETLVARPRDLFDNATPSA
FT                   AAMAVTALLRLAALTDDQALRGRGLAGLRALAPLMKHAPTAAAQSLIALDFALRDPEIA
FT                   LVVPGQLDPSDTLAQVLRLLHRDFQPGRLLLVRSLDPPHPHDLHLLPPLQGRDHPHDHV
FT                   TLYLCRGQTCQAPLVGVEAIAQALTSPPT"
FT   gene            complement(698010..698816)
FT                   /locus_tag="Isop_0492"
FT   CDS_pept        complement(698010..698816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0492"
FT                   /product="glucosamine/galactosamine-6-phosphate isomerase"
FT                   /note="COGs: COG0363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase; InterPro IPR006148; KEGG:
FT                   gym:GYMC10_1212 glucosamine-6-phosphate deaminase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; SPTR:
FT                   Glucosamine/galactosamine-6-phosphate isomerase; PFAM:
FT                   Glucosamine-6-phosphate
FT                   isomerases/6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61087"
FT                   /db_xref="GOA:E8QZG0"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG0"
FT                   /protein_id="ADV61087.1"
FT                   /translation="MSPPPSPIKSWTVDALTIEVYNDRAALGRAGAARAAQAMRQALAS
FT                   RGVARVVFAAAPSQNELLDALVDQEAKELDWSQVMAFHMDEYLGIAPDHPASFRRYLRT
FT                   RLFDRVGIGSALGGPRLIPGERTDDPLAVCLDYAHALSERPLDLVCAGIGENGHLAFND
FT                   PPVADFLDPVAVKTVRLDHACRVQQVNDGCFANLSEVPTHAYTLTIPTLLSASTLVVAV
FT                   PGPRKADAVAHTLRDPIAEACPATALRRHAGATLLLDRDSARLVLE"
FT   gene            699035..699802
FT                   /locus_tag="Isop_0493"
FT   CDS_pept        699035..699802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0854 ubiquitin-specific proteinase
FT                   31, putative; SPTR: Ubiquitin-specific proteinase 31,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61088"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG1"
FT                   /protein_id="ADV61088.1"
FT                   /translation="MPFGFVHARASRPVRRRRVARPALFDDLEERQLLNAAPVAPVNAA
FT                   PREVRVFAPLATAANRRGLVPIRLNLNAHPRTTPARLNPTPRLNANLNLNPNVRLNNQL
FT                   NDLVRQVRVTPALQTQINRLLDQLNTRLDGVDVPQANLDAVSRAAENALRSATRLPSLT
FT                   SIRTLARDLDTAGADNQITQAEQDLLIASAENVLRSARVPQANIDALRNAVADLSEVTG
FT                   VDRNDVPLFADTLRAIASEFLRANPLIRSLLGR"
FT   sig_peptide     699035..699166
FT                   /locus_tag="Isop_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            700025..700987
FT                   /locus_tag="Isop_0494"
FT   CDS_pept        700025..700987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0494"
FT                   /product="protein of unknown function DUF820"
FT                   /note="InterPro IPR008538; KEGG: rca:Rcas_2194 hypothetical
FT                   protein; PFAM: protein of unknown function DUF820; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF820)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61089"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG2"
FT                   /protein_id="ADV61089.1"
FT                   /translation="MTPFDTLATEDQKAARIRELDAQNLLFPDCDGEPMSYGTLQYFWI
FT                   VLIKENLEAYYRDNPNVFVAADLLWYVNPRNDKERLAPDVLVVFGRPKGKRGSYMMWRE
FT                   ENVPMHVVFEILSPGNTREEMEKKRQFYERYGTEEFYVYDPEENSGKLEIWLRHEGMLE
FT                   PVAESEVVGFVSPRMGLRFQPDEYPMGIYRPDGERFRPIEEVFLEEAEARHQAERERQA
FT                   RAEAQRQAEQERQARAEAQRQAEQERQARAEAQRQAEQERQARAEAQRQAEQERQARAE
FT                   AQRQAEEARRLAEEQARLIAELQARLRQVGEGGSGSDSQ"
FT   gene            complement(701035..704181)
FT                   /locus_tag="Isop_0495"
FT   CDS_pept        complement(701035..704181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0495"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="InterPro IPR011444: IPR009056; KEGG: rba:RB6511
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1549; SPTR: Putative uncharacterized protein; PFAM:
FT                   Planctomycete cytochrome C; Protein of unknown function
FT                   (DUF1549); Protein of unknown function (DUF1553)"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61090"
FT                   /db_xref="GOA:E8QZG3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG3"
FT                   /protein_id="ADV61090.1"
FT                   /translation="MSPQTTSALPGLIALLVWVGSIGEPTFQPLHAEPSADARVVSPNR
FT                   RDQTMQENDRRQVRDLLERRCVACHREGNAKGGLALDSLDGLRRGGAGGPAIEPDDLEA
FT                   SLLLDKITPTAPDQRAEMPKSGPPLTPEETAILRRWILQAAPWPGDSPDQRLAATESEP
FT                   PAPAAEDWWSLRPLARPEVPEVAEVPATFPIRNPIDAFILQRLQAEGLSPNPSADRTTL
FT                   LRRLSFDLTGLPPTPEEIDAFVNDPASDDDALETVADRLLDSPAYGERWARHWLDVVHY
FT                   ADTHGFDKDKPRPHAWPYRDWIIHALNTDLPYDQFLRLQLAGDALAPNDPDAIAATGFV
FT                   VAGPWDFVGQVELREGTVEKEKTRVLDRDDLVTNALSTFTSVTVHCARCHNHRFDPIPQ
FT                   DDYYRLQAVFAGVERGDRPWPSRQRAQRLAHLEQRRADLSAQRDQLDQQLFQSLPAEAV
FT                   EIHTRLEALNSQQADLNTAVESGEVVSRTHGYHSAISPTPNPATPKWVRVLWTPPRRLT
FT                   EIRLVPARPTDFPDTPGFGFPVRYRVELIQPNGHRLVIADLQDNDQPNPGHDPVVLRCE
FT                   PTEAIGVEVVASRLRERANDYILALGELQAVDADGRPLVNPDPSANPDAGRVEALDSIE
FT                   SSRWSRDFLIDGFDSRFHLDAEPFTQRVALASERIDLQRQLDQILDQNPNLAQIQRQRD
FT                   AVAARLDKTVQEITTLSIDYVYGIRSTSPRPIHLLHRGEVEQPRHLVGPGALSALEPLG
FT                   LPFEFDPNLDDPGRRLALANWLSDPRNVLTWRSIVNRVWHFHFGRGLVATPNDFGRNGA
FT                   TPSHPELLDWLAVCFRDDLNGSLKRLHRWIVTSSTYRQSSQADEARAAIDADNRLLWRA
FT                   PRSRLDAESIRDAMLLASGALDRTMGGPGFQPFRFQDDHSPTYDHLDPAHALAPQTRRR
FT                   TIYRFVVRSVPHPWIDCLDGADPNQSTPVRTITTTPLQALALWNDPFTLEQAQLMAQRL
FT                   EQRHGADALQAALIDATRWTWGRVPTDDQLASLTQHAQRYGLAATIRVLFNTSAFLFVD
FT                   "
FT   sig_peptide     complement(704086..704181)
FT                   /locus_tag="Isop_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(704233..705246)
FT                   /locus_tag="Isop_0496"
FT   CDS_pept        complement(704233..705246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0496"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="COGs: COG0564 Pseudouridylate synthase 23S
FT                   RNA-specific; InterPro IPR002942: IPR006145: IPR006225;
FT                   KEGG: sds:SDEG_0791 ribosomal large subunit pseudouridine
FT                   synthase D; PFAM: pseudouridine synthase; RNA-binding S4
FT                   domain protein; SMART: RNA-binding S4 domain protein; SPTR:
FT                   Pseudouridine synthase; TIGRFAM: pseudouridine synthase,
FT                   RluA family; PFAM: RNA pseudouridylate synthase; TIGRFAM:
FT                   pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61091"
FT                   /db_xref="GOA:E8QZG4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG4"
FT                   /protein_id="ADV61091.1"
FT                   /translation="MTRSPRPDPPRWRRIVQPPPIIGPLVRLDKLVAQRFGLSRRAAGD
FT                   AVLNGRIDLEGQLCDEPGRLVPPESVLRFNPNRPKERKVVTAKLDILFEDRHLLIVNKP
FT                   AGLLTLETEARETDTLRGRVLKHQSLRRRGRPFVGIVHRLDRETSGAIALALTPEAMKP
FT                   LQALFRSHAVERRYLAIVAGAVAEDHGVVEAAIVSRPGEVRRRLARPGDPDARDALTRF
FT                   RVLERFGCDASLLACELETGRGHQIRVHLASIGHPVLGDRLYAPRKDKHAFQGGSGTIL
FT                   FDRQALHAETLGLVHPVAGGTVWVEAPPPGDFRKLIARLRHANDPQRRSAARHSDR"
FT   gene            705275..706252
FT                   /locus_tag="Isop_0497"
FT   CDS_pept        705275..706252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0497"
FT                   /product="inositol monophosphatase"
FT                   /note="COGs: COG0483 fructose-1 6-bisphosphatase of
FT                   inositol monophosphatase family; InterPro IPR000760; KEGG:
FT                   chl:Chy400_3622 inositol-phosphate phosphatase; PFAM:
FT                   inositol monophosphatase; SPTR: Inositol-phosphate
FT                   phosphatase; PFAM: Inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61092"
FT                   /db_xref="GOA:E8QZG5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG5"
FT                   /protein_id="ADV61092.1"
FT                   /translation="MVVYLSGLARRTPPRPCRVFWRELVTDSMSRISRAGSQPPFYHPP
FT                   AFAEELAFARQLAAQASAVALERCRHLSPREKANRSFVTDLDLDVERLLRDRLAARFPE
FT                   DALTGEEHDREGGDGPRRWSIDPIDGTGNLVHGLPLWAISIGLLVESPSGDGESAAESE
FT                   SSPPHPVVGVIAIPPLGETFWAVQGGGAWLDDQPLPPLAEWDAESFHPQDNVSLSTNAL
FT                   RRLDPRRVPGRIRDLGAACVELAFLAAGRLRAAVFLGEAEHDLAAGAVLLGEVGASIRR
FT                   LDAEGTRLTPARLVAETPVRIPTLLGPRGRVDALFERLDPYATT"
FT   gene            706361..706846
FT                   /locus_tag="Isop_0498"
FT   CDS_pept        706361..706846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbz:LbrM27_V2.1500 hypothetical protein; SPTR:
FT                   Paramyosin"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61093"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG6"
FT                   /protein_id="ADV61093.1"
FT                   /translation="MGYWGVKSYEEDDADFALDAGFERVHGAVYLQLMDDRDPTPLEEV
FT                   QRRLADRRTLAAALNALANEFQGRPLEEYDDDQRISYCGVVVRHVECGVVPPRAVRDRA
FT                   LRWLQEETVEWDDPAARRRRLAWEIELLRRTAVVEIEEDTAPLPDADAPASESSRRE"
FT   gene            706967..707509
FT                   /locus_tag="Isop_0499"
FT   CDS_pept        706967..707509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0499"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR017504; KEGG: cmi:CMM_1969 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   Planctomycetes uncharacterized domain TIGR03067"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61094"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG7"
FT                   /protein_id="ADV61094.1"
FT                   /translation="MNIRAKVLIMIATVVAAANPFASVQAQTQAEARPLPQPSPDQAAA
FT                   LKPLIGVWTAEKLGVTQTSAAKLTIREDATYQMEMTLDTKEVIVVEGRLRLNDQVQPKT
FT                   IDLIDNQGYAQANPQEKSPLDNRQGLYAVEGDTLTIVADARRPTSLDPPTEPSRPRPIT
FT                   FRRLPRNANPNPPPGED"
FT   sig_peptide     706967..707062
FT                   /locus_tag="Isop_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            707706..708347
FT                   /locus_tag="Isop_0500"
FT   CDS_pept        707706..708347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0500"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="InterPro IPR014284; KEGG: clj:CLJU_c27510 putative
FT                   RNA polymerase sigma factor; SPTR: RNA polymerase sigma
FT                   factor SigD; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: ECF sigma factor; TIGRFAM: RNA polymerase
FT                   sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61095"
FT                   /db_xref="GOA:E8QZG8"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG8"
FT                   /protein_id="ADV61095.1"
FT                   /translation="MDDLVTQMFTDASASAGHVPGTITRHIIRFQAGDQTALDDLLRVM
FT                   LPLITRVVNQRLARRNAARHAEDLIDDIWVAIYLMLTKQRCSQLNDRENLLKLIHTIAR
FT                   RGDKSLIDRERRQPVSGEAIFPFLESELRPDDMAAYHRAMDKVFRELEKARQLNKIDDV
FT                   DLKLLDLRLTTTLTSKEIADRVGRSTRQVQNRLNALRQRIQRILELDPEP"
FT   gene            708549..711905
FT                   /locus_tag="Isop_0501"
FT   CDS_pept        708549..711905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0501"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR017442: IPR002290: IPR017441: IPR008271: IPR
FT                   000719; KEGG: rba:RB5593 serine/threonine-protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; SPTR:
FT                   Serine/threonine-protein kinase; PFAM: Protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61096"
FT                   /db_xref="GOA:E8QZG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZG9"
FT                   /protein_id="ADV61096.1"
FT                   /translation="MTNRNEEEFREKGLGENDPGFEPPLHRFQITTAPPSFDAPDPTAR
FT                   APVSAGLDGTAGSDELWETSRRIDLSERFCEEWDRATASRHRGLGLTPRPRIEDYLEMI
FT                   PLRWRPGLTLDLLTEELRLRRRDGEVPEAEDYRDRFPDYDAWIKEDCVRHRQRGLALLT
FT                   GLMAWSIGLSDLERVAQAAREWKALTEGHSQEADSDGLASLEPGRSEFIPVLMRVAQFN
FT                   PDDRDLLMRCVERHRRRHQDDLAACFHHFPQAGLIPPGPLHGIDSDFDSWLSHLGGRPA
FT                   RYQPYKLLGIGGMGEIWAARDNELRRRVVIKRLPVEKNLPHHRRWFIEGVRTHARLFEP
FT                   GLIPVLDAGWFADGSPFAVFPLIRTAKTLRYEIEAFHRRLAQTHHHSGARTRNAPKEEH
FT                   PDSPAARISQAATQVDQFASVRSREVGLSTPLQDCRFQSDPSKPASAAHERRNSHALPS
FT                   EMSPRAHFRRLIIWFESLCRTVHYLHVQTSSTVIHRDIKPENVMIGRRGELYLIDLGIS
FT                   RSLRLKHDQDFGPFSGLGQAVPTLLSPTPDPTGSGEATSTPQLEHAGTFGYQPPETLHG
FT                   QVDHLSPRLDVFGLGATLYHILTNRPPLLRGAFPHPIEPHVLAEAVADYLRRRAFPHPT
FT                   QRFPWICPRLEAICFKAIAADPELRYQTADELADAVRRWLDDQDRLPDPDPIPIPKAGL
FT                   RAVGARCSSWLGAGVLIGCLSLAVWGLRNEVVRSNADQQRLANLIPVLEARFDQGEIID
FT                   PQELHDVTALNPSRRFPLPEVSGSSVQTSTWLARCRLLVARHGLRQAQWNPGQFDDQPF
FT                   IETLNEIEKTANEINVSDSSHLMTIRYALFHAWLELAQLQGWMERFNDADVSLGRAEAF
FT                   CSRLHPQVRRIAELEWKRVALDCDERWRPASRVTRSWSALAAECQRAFEQTLASASTWT
FT                   EELTQPPLVALAARVWSESAIRVALAMARSNRTAEISHVINRVVTALASLQESDNPSTF
FT                   DHHLVSILDQLRLVAEAAHLLESGNALFDSELGRSFGIGLDGTRLTIVRERCRSCLHQP
FT                   PRHPAILELLARLEVMVAASLAQRQSLTEARTWANWACRHLDLLPPSHRNALALLREEA
FT                   VGIGMGGFNPR"
FT   gene            711877..713322
FT                   /locus_tag="Isop_0502"
FT   CDS_pept        711877..713322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0502"
FT                   /product="galactokinase"
FT                   /note="COGs: COG0153 Galactokinase; InterProIPR019539:
FT                   IPR006204: IPR013750: IPR000705: IPR 006203: IPR006206;
FT                   KEGG: rrs:RoseRS_3819 galactokinase; PFAM: Galactokinase
FT                   galactose-binding domain; GHMP kinase; GHMP kinase domain
FT                   protein; SPTR: Galactokinase; TIGRFAM: galactokinase; PFAM:
FT                   Galactokinase galactose-binding signature; GHMP kinases C
FT                   terminal; GHMP kinases N terminal domain; TIGRFAM:
FT                   galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61097"
FT                   /db_xref="GOA:E8QZH0"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZH0"
FT                   /protein_id="ADV61097.1"
FT                   /translation="MGWAGSTHVDVTAGLVALGLKEESSVSMGGTAWNWREVRRMTLDT
FT                   DDGWRCPAVEAVNEFRRRFGGEPMGLVVAPGRVELLGNHTDYNQGPVLGCAIDRFTVIA
FT                   WRPSMTDQPSERLVRVVFATLADDPDDPPMVTSAMSTLIALESPLKFGCHHAWAHGVRY
FT                   LQGALATWHDTQRDADHRHRPTGFDAVITGNLPMGSGLSSSASLLCGLLGMLAELGRVG
FT                   LDRPEDRLGLARLARQAEHRAVGVACGLLDPACVLLSRSDHALMLDCRDETIAYCPLID
FT                   AQTGRAPCIVLVESFESRRLAEGLYNRRRDECGRALAALVRCGHAVASLREIDADDLDA
FT                   LRDAPEFLADPTAWRRARHVAGEVRRVLEGADALVRGDVTTMGRLMSESHESSRSLFEN
FT                   SSPALDALIDAARDAPGFLGGKLTGAGWGGCVVCLVRPEQMDGFCAVLIERATRRLGRS
FT                   PGLLVVRPSAGARVMSARGLTRT"
FT   gene            complement(713308..714228)
FT                   /locus_tag="Isop_0503"
FT   CDS_pept        complement(713308..714228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0503"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="COGs: COG0846 NAD-dependent protein deacetylase SIR2
FT                   family; InterPro IPR003000; KEGG: svi:Svir_35400
FT                   NAD-dependent protein deacetylase, SIR2 family; PFAM:
FT                   Silent information regulator protein Sir2; SPTR:
FT                   NAD-dependent protein deacetylase, SIR2 family; PFAM: Sir2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61098"
FT                   /db_xref="GOA:E8QZH1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZH1"
FT                   /protein_id="ADV61098.1"
FT                   /translation="MAKPATPHVQMNPETPSQHRDAIVQAAAILDQADALLIHAGAGMG
FT                   VDSGLPDFRGNEGFWVAYPPFKARGLSFVDLANPTWFYHDPHLAWGFYGHRLDLYRRTT
FT                   PHAGFSILKRWGDRMSRGCFVFTSNVDGHFQAAGFAEDQVCEVHGTLAAAQCLHQCGVG
FT                   LIPTRDLVVQVDPADFRARDPLPTCPRCGGPIRPNVLMFGDFGWDSSRTDQQRQRLRSW
FT                   LSHATEPHGRLAIIELGAGRAIPTVRSFSEHLAQSHNVTLVRINPREPEIPSNHQGRHL
FT                   SLALGARAALEAIDRQRTDAASGSR"
FT   gene            complement(714306..715337)
FT                   /locus_tag="Isop_0504"
FT   CDS_pept        complement(714306..715337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Isop_0504"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509; KEGG: chl:Chy400_2903
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: NAD-dependent
FT                   epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Isop_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADV61099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8QZH2"
FT                   /protein_id="ADV61099.1"
FT                   /translation="MKLWITGATGFVGGYAVEAALARGDQVQGWAGRGRWPEDLGHLDG
FT                   QVPLEPLDLTAPETTNDLIRRLQQDRPEAILHLAAQSNPRASFDDPPATWRINLGGTLA
FT                   LLEAMRKAAPLSWQAGSSSHLHWPRLVVISSGMCYGRPEPPDRPPFGPNDPLAPRDPYS
FT                   ASKAAADLAALQYHHAHGFDVVIARPFQQTGPRQSERYVLSGMARQVAEVEAGMRSEVS
FT                   VGNLEVERDFTDVRDMVRAYLRLTRHAVLGRIVVLGRGRGIKLADALDHLRGLADRPIP
FT                   VRIDPARLRNDDPPRILGDPQALHEALGDQPLIPIETTLADLLNWWRGRIRGSQSRPSD
FT                   IAS"
FT   sig_peptide     complement(715272..715337)
FT                   /locus_tag="Isop_0504"
FT