(data stored in ACNUC7421 zone)

EMBL: CP002355

ID   CP002355; SV 1; circular; genomic DNA; STD; PRO; 2574824 BP.
XX
AC   CP002355;
XX
PR   Project:PRJNA43399;
XX
DT   03-DEC-2010 (Rel. 107, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 4)
XX
DE   Sulfuricurvum kujiense DSM 16994 chromosome, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Sulfuricurvum kujiense DSM 16994
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Helicobacteraceae; Sulfuricurvum.
XX
RN   [1]
RP   1-2574824
RX   DOI; 10.4056/sigs.2456004.
RX   PUBMED; 22675602.
RA   Han C., Kotsyurbenko O., Chertkov O., Held B., Lapidus A., Nolan M.,
RA   Lucas S., Hammon N., Deshpande S., Cheng J.F., Tapia R., Goodwin L.A.,
RA   Pitluck S., Liolios K., Pagani I., Ivanova N., Mavromatis K.,
RA   Mikhailova N., Pati A., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Brambilla E.M., Rohde M., Spring S.,
RA   Sikorski J., Goker M., Woyke T., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Kyrpides N.C., Klenk H.P., Detter J.C.;
RT   "Complete genome sequence of the sulfur compounds oxidizing
RT   chemolithoautotroph Sulfuricurvum kujiense type strain (YK-1(T))";
RL   Stand Genomic Sci 6(1):94-103(2012).
XX
RN   [2]
RP   1-2574824
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Bruce D., Goodwin L., Pitluck S.,
RA   Kyrpides N., Mavromatis K., Pagani I., Ivanova N., Mikhailova N.,
RA   Chertkov O., Brettin T., Detter J.C., Tapia R., Han C., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Spring S.,
RA   Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (22-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6a9af961dade59a5bb22db7462dcdaca.
DR   BioSample; SAMN00713566.
DR   CABRI; DSM 16994.
DR   EnsemblGenomes-Gn; EBG00001219512.
DR   EnsemblGenomes-Gn; EBG00001219513.
DR   EnsemblGenomes-Gn; EBG00001219514.
DR   EnsemblGenomes-Gn; EBG00001219515.
DR   EnsemblGenomes-Gn; EBG00001219516.
DR   EnsemblGenomes-Gn; EBG00001219517.
DR   EnsemblGenomes-Gn; EBG00001219518.
DR   EnsemblGenomes-Gn; EBG00001219519.
DR   EnsemblGenomes-Gn; EBG00001219520.
DR   EnsemblGenomes-Gn; EBG00001219521.
DR   EnsemblGenomes-Gn; EBG00001219522.
DR   EnsemblGenomes-Gn; EBG00001219523.
DR   EnsemblGenomes-Gn; EBG00001219524.
DR   EnsemblGenomes-Gn; EBG00001219525.
DR   EnsemblGenomes-Gn; EBG00001219526.
DR   EnsemblGenomes-Gn; EBG00001219527.
DR   EnsemblGenomes-Gn; EBG00001219528.
DR   EnsemblGenomes-Gn; EBG00001219529.
DR   EnsemblGenomes-Gn; EBG00001219530.
DR   EnsemblGenomes-Gn; EBG00001219531.
DR   EnsemblGenomes-Gn; EBG00001219532.
DR   EnsemblGenomes-Gn; EBG00001219533.
DR   EnsemblGenomes-Gn; EBG00001219534.
DR   EnsemblGenomes-Gn; EBG00001219535.
DR   EnsemblGenomes-Gn; EBG00001219536.
DR   EnsemblGenomes-Gn; EBG00001219537.
DR   EnsemblGenomes-Gn; EBG00001219538.
DR   EnsemblGenomes-Gn; EBG00001219539.
DR   EnsemblGenomes-Gn; EBG00001219540.
DR   EnsemblGenomes-Gn; EBG00001219541.
DR   EnsemblGenomes-Gn; EBG00001219542.
DR   EnsemblGenomes-Gn; EBG00001219543.
DR   EnsemblGenomes-Gn; EBG00001219544.
DR   EnsemblGenomes-Gn; EBG00001219545.
DR   EnsemblGenomes-Gn; EBG00001219546.
DR   EnsemblGenomes-Gn; EBG00001219547.
DR   EnsemblGenomes-Gn; EBG00001219548.
DR   EnsemblGenomes-Gn; EBG00001219549.
DR   EnsemblGenomes-Gn; EBG00001219550.
DR   EnsemblGenomes-Gn; EBG00001219551.
DR   EnsemblGenomes-Gn; EBG00001219552.
DR   EnsemblGenomes-Gn; EBG00001219553.
DR   EnsemblGenomes-Gn; EBG00001219554.
DR   EnsemblGenomes-Gn; EBG00001219555.
DR   EnsemblGenomes-Gn; EBG00001219556.
DR   EnsemblGenomes-Gn; EBG00001219557.
DR   EnsemblGenomes-Gn; EBG00001219558.
DR   EnsemblGenomes-Gn; EBG00001219559.
DR   EnsemblGenomes-Gn; EBG00001219560.
DR   EnsemblGenomes-Gn; EBG00001219561.
DR   EnsemblGenomes-Gn; EBG00001219562.
DR   EnsemblGenomes-Gn; EBG00001219563.
DR   EnsemblGenomes-Gn; EBG00001219564.
DR   EnsemblGenomes-Gn; EBG00001219565.
DR   EnsemblGenomes-Gn; EBG00001219566.
DR   EnsemblGenomes-Gn; EBG00001219567.
DR   EnsemblGenomes-Gn; EBG00001219568.
DR   EnsemblGenomes-Gn; EBG00001219569.
DR   EnsemblGenomes-Gn; EBG00001219570.
DR   EnsemblGenomes-Gn; EBG00001219571.
DR   EnsemblGenomes-Gn; EBG00001219572.
DR   EnsemblGenomes-Gn; EBG00001219573.
DR   EnsemblGenomes-Gn; EBG00001219574.
DR   EnsemblGenomes-Gn; EBG00001219575.
DR   EnsemblGenomes-Gn; EBG00001219576.
DR   EnsemblGenomes-Gn; Sulku_R0001.
DR   EnsemblGenomes-Gn; Sulku_R0002.
DR   EnsemblGenomes-Gn; Sulku_R0003.
DR   EnsemblGenomes-Gn; Sulku_R0004.
DR   EnsemblGenomes-Gn; Sulku_R0005.
DR   EnsemblGenomes-Gn; Sulku_R0006.
DR   EnsemblGenomes-Gn; Sulku_R0007.
DR   EnsemblGenomes-Gn; Sulku_R0008.
DR   EnsemblGenomes-Gn; Sulku_R0009.
DR   EnsemblGenomes-Gn; Sulku_R0010.
DR   EnsemblGenomes-Gn; Sulku_R0011.
DR   EnsemblGenomes-Gn; Sulku_R0012.
DR   EnsemblGenomes-Gn; Sulku_R0013.
DR   EnsemblGenomes-Gn; Sulku_R0014.
DR   EnsemblGenomes-Gn; Sulku_R0015.
DR   EnsemblGenomes-Gn; Sulku_R0016.
DR   EnsemblGenomes-Gn; Sulku_R0017.
DR   EnsemblGenomes-Gn; Sulku_R0018.
DR   EnsemblGenomes-Gn; Sulku_R0019.
DR   EnsemblGenomes-Gn; Sulku_R0020.
DR   EnsemblGenomes-Gn; Sulku_R0021.
DR   EnsemblGenomes-Gn; Sulku_R0022.
DR   EnsemblGenomes-Gn; Sulku_R0023.
DR   EnsemblGenomes-Gn; Sulku_R0024.
DR   EnsemblGenomes-Gn; Sulku_R0025.
DR   EnsemblGenomes-Gn; Sulku_R0026.
DR   EnsemblGenomes-Gn; Sulku_R0027.
DR   EnsemblGenomes-Gn; Sulku_R0028.
DR   EnsemblGenomes-Gn; Sulku_R0029.
DR   EnsemblGenomes-Gn; Sulku_R0030.
DR   EnsemblGenomes-Gn; Sulku_R0031.
DR   EnsemblGenomes-Gn; Sulku_R0032.
DR   EnsemblGenomes-Gn; Sulku_R0033.
DR   EnsemblGenomes-Gn; Sulku_R0034.
DR   EnsemblGenomes-Gn; Sulku_R0035.
DR   EnsemblGenomes-Gn; Sulku_R0036.
DR   EnsemblGenomes-Gn; Sulku_R0037.
DR   EnsemblGenomes-Gn; Sulku_R0038.
DR   EnsemblGenomes-Gn; Sulku_R0039.
DR   EnsemblGenomes-Gn; Sulku_R0040.
DR   EnsemblGenomes-Gn; Sulku_R0041.
DR   EnsemblGenomes-Gn; Sulku_R0043.
DR   EnsemblGenomes-Gn; Sulku_R0044.
DR   EnsemblGenomes-Gn; Sulku_R0045.
DR   EnsemblGenomes-Gn; Sulku_R0046.
DR   EnsemblGenomes-Gn; Sulku_R0047.
DR   EnsemblGenomes-Gn; Sulku_R0048.
DR   EnsemblGenomes-Gn; Sulku_R0049.
DR   EnsemblGenomes-Gn; Sulku_R0050.
DR   EnsemblGenomes-Gn; Sulku_R0051.
DR   EnsemblGenomes-Gn; Sulku_R0052.
DR   EnsemblGenomes-Gn; Sulku_R0053.
DR   EnsemblGenomes-Gn; Sulku_R0054.
DR   EnsemblGenomes-Gn; Sulku_R0055.
DR   EnsemblGenomes-Gn; Sulku_R0056.
DR   EnsemblGenomes-Gn; Sulku_R0057.
DR   EnsemblGenomes-Gn; Sulku_R0058.
DR   EnsemblGenomes-Gn; Sulku_R0059.
DR   EnsemblGenomes-Gn; Sulku_R0060.
DR   EnsemblGenomes-Gn; Sulku_R0061.
DR   EnsemblGenomes-Tr; EBT00001788285.
DR   EnsemblGenomes-Tr; EBT00001788286.
DR   EnsemblGenomes-Tr; EBT00001788287.
DR   EnsemblGenomes-Tr; EBT00001788288.
DR   EnsemblGenomes-Tr; EBT00001788289.
DR   EnsemblGenomes-Tr; EBT00001788290.
DR   EnsemblGenomes-Tr; EBT00001788291.
DR   EnsemblGenomes-Tr; EBT00001788292.
DR   EnsemblGenomes-Tr; EBT00001788293.
DR   EnsemblGenomes-Tr; EBT00001788294.
DR   EnsemblGenomes-Tr; EBT00001788295.
DR   EnsemblGenomes-Tr; EBT00001788296.
DR   EnsemblGenomes-Tr; EBT00001788297.
DR   EnsemblGenomes-Tr; EBT00001788298.
DR   EnsemblGenomes-Tr; EBT00001788299.
DR   EnsemblGenomes-Tr; EBT00001788300.
DR   EnsemblGenomes-Tr; EBT00001788301.
DR   EnsemblGenomes-Tr; EBT00001788302.
DR   EnsemblGenomes-Tr; EBT00001788303.
DR   EnsemblGenomes-Tr; EBT00001788304.
DR   EnsemblGenomes-Tr; EBT00001788305.
DR   EnsemblGenomes-Tr; EBT00001788306.
DR   EnsemblGenomes-Tr; EBT00001788307.
DR   EnsemblGenomes-Tr; EBT00001788308.
DR   EnsemblGenomes-Tr; EBT00001788309.
DR   EnsemblGenomes-Tr; EBT00001788310.
DR   EnsemblGenomes-Tr; EBT00001788311.
DR   EnsemblGenomes-Tr; EBT00001788312.
DR   EnsemblGenomes-Tr; EBT00001788313.
DR   EnsemblGenomes-Tr; EBT00001788314.
DR   EnsemblGenomes-Tr; EBT00001788315.
DR   EnsemblGenomes-Tr; EBT00001788316.
DR   EnsemblGenomes-Tr; EBT00001788317.
DR   EnsemblGenomes-Tr; EBT00001788318.
DR   EnsemblGenomes-Tr; EBT00001788319.
DR   EnsemblGenomes-Tr; EBT00001788320.
DR   EnsemblGenomes-Tr; EBT00001788321.
DR   EnsemblGenomes-Tr; EBT00001788322.
DR   EnsemblGenomes-Tr; EBT00001788323.
DR   EnsemblGenomes-Tr; EBT00001788324.
DR   EnsemblGenomes-Tr; EBT00001788325.
DR   EnsemblGenomes-Tr; EBT00001788326.
DR   EnsemblGenomes-Tr; EBT00001788327.
DR   EnsemblGenomes-Tr; EBT00001788328.
DR   EnsemblGenomes-Tr; EBT00001788329.
DR   EnsemblGenomes-Tr; EBT00001788330.
DR   EnsemblGenomes-Tr; EBT00001788331.
DR   EnsemblGenomes-Tr; EBT00001788332.
DR   EnsemblGenomes-Tr; EBT00001788333.
DR   EnsemblGenomes-Tr; EBT00001788334.
DR   EnsemblGenomes-Tr; EBT00001788335.
DR   EnsemblGenomes-Tr; EBT00001788336.
DR   EnsemblGenomes-Tr; EBT00001788337.
DR   EnsemblGenomes-Tr; EBT00001788338.
DR   EnsemblGenomes-Tr; EBT00001788339.
DR   EnsemblGenomes-Tr; EBT00001788340.
DR   EnsemblGenomes-Tr; EBT00001788341.
DR   EnsemblGenomes-Tr; EBT00001788342.
DR   EnsemblGenomes-Tr; EBT00001788343.
DR   EnsemblGenomes-Tr; EBT00001788344.
DR   EnsemblGenomes-Tr; EBT00001788345.
DR   EnsemblGenomes-Tr; EBT00001788346.
DR   EnsemblGenomes-Tr; EBT00001788347.
DR   EnsemblGenomes-Tr; EBT00001788348.
DR   EnsemblGenomes-Tr; EBT00001788349.
DR   EnsemblGenomes-Tr; Sulku_R0001-1.
DR   EnsemblGenomes-Tr; Sulku_R0002-1.
DR   EnsemblGenomes-Tr; Sulku_R0003-1.
DR   EnsemblGenomes-Tr; Sulku_R0004-1.
DR   EnsemblGenomes-Tr; Sulku_R0005-1.
DR   EnsemblGenomes-Tr; Sulku_R0006-1.
DR   EnsemblGenomes-Tr; Sulku_R0007-1.
DR   EnsemblGenomes-Tr; Sulku_R0008-1.
DR   EnsemblGenomes-Tr; Sulku_R0009-1.
DR   EnsemblGenomes-Tr; Sulku_R0010-1.
DR   EnsemblGenomes-Tr; Sulku_R0011-1.
DR   EnsemblGenomes-Tr; Sulku_R0012-1.
DR   EnsemblGenomes-Tr; Sulku_R0013-1.
DR   EnsemblGenomes-Tr; Sulku_R0014-1.
DR   EnsemblGenomes-Tr; Sulku_R0015-1.
DR   EnsemblGenomes-Tr; Sulku_R0016-1.
DR   EnsemblGenomes-Tr; Sulku_R0017-1.
DR   EnsemblGenomes-Tr; Sulku_R0018-1.
DR   EnsemblGenomes-Tr; Sulku_R0019-1.
DR   EnsemblGenomes-Tr; Sulku_R0020-1.
DR   EnsemblGenomes-Tr; Sulku_R0021-1.
DR   EnsemblGenomes-Tr; Sulku_R0022-1.
DR   EnsemblGenomes-Tr; Sulku_R0023-1.
DR   EnsemblGenomes-Tr; Sulku_R0024-1.
DR   EnsemblGenomes-Tr; Sulku_R0025-1.
DR   EnsemblGenomes-Tr; Sulku_R0026-1.
DR   EnsemblGenomes-Tr; Sulku_R0027-1.
DR   EnsemblGenomes-Tr; Sulku_R0028-1.
DR   EnsemblGenomes-Tr; Sulku_R0029-1.
DR   EnsemblGenomes-Tr; Sulku_R0030-1.
DR   EnsemblGenomes-Tr; Sulku_R0031-1.
DR   EnsemblGenomes-Tr; Sulku_R0032-1.
DR   EnsemblGenomes-Tr; Sulku_R0033-1.
DR   EnsemblGenomes-Tr; Sulku_R0034-1.
DR   EnsemblGenomes-Tr; Sulku_R0035-1.
DR   EnsemblGenomes-Tr; Sulku_R0036-1.
DR   EnsemblGenomes-Tr; Sulku_R0037-1.
DR   EnsemblGenomes-Tr; Sulku_R0038-1.
DR   EnsemblGenomes-Tr; Sulku_R0039-1.
DR   EnsemblGenomes-Tr; Sulku_R0040-1.
DR   EnsemblGenomes-Tr; Sulku_R0041-1.
DR   EnsemblGenomes-Tr; Sulku_R0043-1.
DR   EnsemblGenomes-Tr; Sulku_R0044-1.
DR   EnsemblGenomes-Tr; Sulku_R0045-1.
DR   EnsemblGenomes-Tr; Sulku_R0046-1.
DR   EnsemblGenomes-Tr; Sulku_R0047-1.
DR   EnsemblGenomes-Tr; Sulku_R0048-1.
DR   EnsemblGenomes-Tr; Sulku_R0049-1.
DR   EnsemblGenomes-Tr; Sulku_R0050-1.
DR   EnsemblGenomes-Tr; Sulku_R0051-1.
DR   EnsemblGenomes-Tr; Sulku_R0052-1.
DR   EnsemblGenomes-Tr; Sulku_R0053-1.
DR   EnsemblGenomes-Tr; Sulku_R0054-1.
DR   EnsemblGenomes-Tr; Sulku_R0055-1.
DR   EnsemblGenomes-Tr; Sulku_R0056-1.
DR   EnsemblGenomes-Tr; Sulku_R0057-1.
DR   EnsemblGenomes-Tr; Sulku_R0058-1.
DR   EnsemblGenomes-Tr; Sulku_R0059-1.
DR   EnsemblGenomes-Tr; Sulku_R0060-1.
DR   EnsemblGenomes-Tr; Sulku_R0061-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP002355.
DR   SILVA-SSU; CP002355.
DR   StrainInfo; 382844; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4087653
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Sulfuricurvum kujiense YK-1, DSM 16994
CC   collection_date     :: Missing
CC   lat_lon             :: 40.190524 141.775583
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Japan
CC   environment         :: Missing
CC   num_replicons       :: 5
CC   ref_biomaterial     :: DSM 16994, ATCC BAA-921
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemolithoautotroph
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: 15545474
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi05071
CC   Type Strain         :: Yes
CC   Funding Program     :: DOE-GEBA 2009
CC   Isolation Site      :: Drain water from an underground crude-oil
CC                          storage cavity; Japan, Kuji, Iwate
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 25C
CC   pH                  :: 7.0
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2574824
FT                   /organism="Sulfuricurvum kujiense DSM 16994"
FT                   /strain="DSM 16994"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Kuki, Iwate"
FT                   /lat_lon="40.19 N 141.78 E"
FT                   /isolation_source="drain water from underground crude oil
FT                   storage cavity"
FT                   /db_xref="taxon:709032"
FT                   /type_material="type strain of Sulfuricurvum kujiense"
FT   gene            70..1398
FT                   /locus_tag="Sulku_0001"
FT   CDS_pept        70..1398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; InterProIPR001957: IPR020591: IPR013317:
FT                   IPR013159: IPR 003593; KEGG: tdn:Suden_0001 chromosomal
FT                   replication initiation protein; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32669"
FT                   /db_xref="GOA:E4TW53"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW53"
FT                   /protein_id="ADR32669.1"
FT                   /translation="MNSIGKQVLNALKGEINEIDYQRYIKQLTYDEAESKSNIAVFRAP
FT                   NTLIANWVRTKFADKIAHLFEIKTNVKPTVSILIQSTSVQSSVQNTVAVPNIERPGGSL
FT                   LNPSFTFQNFVVGDSNNFAFIAAKNVSEKPGVVYNPLFIYGGVGLGKTHLMQSVGNVML
FT                   SQGKTVIYTSVEQFLNDFTRHLSNRTMDRFKDKYRKCDLLLIDDIQFLSNKNQIQEEFF
FT                   HTFDALRNENKQIIITSDKPPKKIGGLEERLKSRFESGLVADIQPPELETKIEIIKKKC
FT                   EINRVKLDREVINYVATIIENNTREIEGILSKLNAYSQLMGVDITIEFARNVLKEQMAE
FT                   KRSNITTDLIMDTVAKELNIKPSEIRSKSRNSNIVYARRIAIYLSRTLTPNSMPQLAQY
FT                   FGMKDHTAVSHTMKKIQELMKNDEDFRVKIEELSNKVSVATPE"
FT   gene            1593..2660
FT                   /locus_tag="Sulku_0002"
FT   CDS_pept        1593..2660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tdn:Suden_0002
FT                   DNA polymerase III subunit beta; PFAM: DNA polymerase III
FT                   beta chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32670"
FT                   /db_xref="GOA:E4TW54"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW54"
FT                   /protein_id="ADR32670.1"
FT                   /translation="MKITVDKSVLENILLHLQPFLEKKDTSQITSHILLSTDGRTLYAK
FT                   ATDYEIGLIIQTNSVNVEEPGSLTANGKKLLDIIRILKDEEIELTLDKDTLHIRQKRSN
FT                   FKLPTYKSSEFPAFPTTDGKPNIAINSHLLIESLKKITPAADTNNPKFELNGALIDIKN
FT                   NQINFVSTDTRRLALVHIDSQNDHELSIIVPKKAIIEIQKLFADNIEIFYDNTHLVIKS
FT                   EDSLFYTKLINGKFPDYSRIIPKEAQRTIVLPKSVIVTAIKQITTISNDLKLTFQSDSI
FT                   LFESLSDDNIEAKTTVEIENGFESPFILAINSRYILDFLSQVNATEFTLEANESNQPFV
FT                   LKDQNFKTIVMPIVI"
FT   gene            2894..5209
FT                   /locus_tag="Sulku_0003"
FT   CDS_pept        2894..5209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR018522: IPR011557: IPR001241: IPR000565: IPR
FT                   003594: IPR013506: IPR006171: IPR002288; KEGG:
FT                   tdn:Suden_0003 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; SPTR: DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: Toprim domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; DNA gyrase
FT                   B; DNA gyrase B subunit, carboxyl terminus; TIGRFAM: DNA
FT                   gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32671"
FT                   /db_xref="GOA:E4TW55"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW55"
FT                   /protein_id="ADR32671.1"
FT                   /translation="MENYGASNIKVLKGLEAVRKRPGMYIGDTGHRGLHHLIYEVVDNS
FT                   IDEAMAGHCDTITVTLTKNGTAIVSDNGRGIPTDMHPTEGISAATVVLTVLHAGGKFDK
FT                   DTYKVSGGLHGVGVSVVNALSSDLKMTIHREGQSFEQNFKCGIPQEPLAITGTTRKRGT
FT                   TIEFFPDPSIFTETIIFDYDYLAKRFRELAYLNPRITIIFKDERNGASNTYHFEGGISQ
FT                   FVTDVNKKTVVASPFAFSEKIEDIEMDIAIMYNDSYDDKTFTFVNNINTPNGGTHEAGF
FT                   RAGLTRVISNYNKQNGNAKEKDVPLTGEDVSEGLICVVSVRVPEPQFEGQTKGKLGNTY
FT                   VRPLVQKVTYEKLTKYFEENPLQAKAIVQKALMAARGREAAKKARELTRRKDAMTVGTL
FT                   PGKLADCQSKDPAISELYLVEGDSAGGSAKQGRDRVFQAILPLKGKILNVEKARLDKIL
FT                   KSEEITNMITALGCGIGEEFNEEKLRYHKIIIMTDADVDGSHIQTLLLTFFFRYLPKIV
FT                   ENGYLYLAQPPLYRYKKGKKEIYFKDDRVMNAFLIENGIEALEAENLNVGVNDLVSFFK
FT                   MVDHYRSTLDALERRYALVELIRYFIENPDLISLPLTEMYTKVEAFLTAQGNNILSKSV
FT                   SDEDMHLFVQTKEGLEELHINDELFASPHFAEANYIFQKIQDWNLPLEGDLLELLTQIT
FT                   DYAKKGSYIQRYKGLGEMNPEQLWETTMTPENRVLLRITIEDAETAGESFNLFMGDDVE
FT                   PRRNYIETHAKDVKHLDI"
FT   gene            5216..6619
FT                   /locus_tag="Sulku_0004"
FT   CDS_pept        5216..6619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0004"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160; KEGG: nis:NIS_0004 hypothetical protein; PFAM:
FT                   EAL domain protein; GGDEF domain containing protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; SPTR:
FT                   Diguanylate cyclase/phosphodiesterase, putative; PFAM: EAL
FT                   domain; GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32672"
FT                   /db_xref="GOA:E4TW56"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW56"
FT                   /protein_id="ADR32672.1"
FT                   /translation="MTYTEQKEREHRFALALRMGLPIFFLSSVTLFALFSQTYTSLASL
FT                   IVLSISLLGIMIYFIFYLIYQSAHETITDPTTYAFTSEYFFKLGSKALLKNTQTVMMIS
FT                   VENLWSINERYGIKNGDKALQNTVKKLDRFFRDKGYDKLPIGRYKGGDFLAFLPGEKEQ
FT                   YRVLIELFLSKYENHIDNEIEIRVGIVMVDSRLSNNMELLTSRLYELHNDRLTAEKEEF
FT                   YSINELEHEILEALEHKRISIGFWPVCCDDDMFDTSVKLIDSEGRLIHQSRYIPVLNRL
FT                   NKMRFLESDVLEKIGALCNEKNQNIVLTISPVTLRNPHFFEHALTLFERYPKARNKITL
FT                   LFEEREYCHQLERFSQQIAHYRKAGYKIALDRLGGYQTTLLYLKELEIDIVRFDSLYSR
FT                   NIKKAGYQNIIQGLNLSAHLCGAKTWMSMIEDSNSDQLCQSLKINYRQGNYLGKILTLD
FT                   DITKKETNI"
FT   sig_peptide     5216..5344
FT                   /locus_tag="Sulku_0004"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            6616..7005
FT                   /locus_tag="Sulku_0005"
FT   CDS_pept        6616..7005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0005"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="COGs: COG0780 Enzyme related to GTP cyclohydrolase
FT                   I; InterPro IPR016856: IPR020602; KEGG: tdn:Suden_0004
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase; PRIAM: PreQ(1) synthase; SPTR:
FT                   NADPH-dependent 7-cyano-7-deazaguanine reductase; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I; TIGRFAM: 7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32673"
FT                   /db_xref="GOA:E4TW57"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW57"
FT                   /protein_id="ADR32673.1"
FT                   /translation="MKYGEQIVENFDVEKDFEIWPNQHERDYVIKVTLPEFTCLCPRSG
FT                   YPDFATIYVEYTPDKWVAELKAIKLYINSFRNRHISHENSANEIYSVFEQKIAPKRLKV
FT                   VADYYPRGNVHTVVEIDSEKMVKEK"
FT   gene            complement(7049..7834)
FT                   /locus_tag="Sulku_0006"
FT   CDS_pept        complement(7049..7834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0006"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /EC_number="7.3.2.1"
FT                   /note="COGs: COG1117 ABC-type phosphate transport system
FT                   ATPase component; InterProIPR017871: IPR005670: IPR003439:
FT                   IPR015850: IPR 003593; KEGG: tdn:Suden_1887 phosphate ABC
FT                   transporter permease; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Phosphate ABC transporter, ATP-binding
FT                   protein; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter; TIGRFAM: phosphate ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32674"
FT                   /db_xref="GOA:E4TW58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW58"
FT                   /protein_id="ADR32674.1"
FT                   /translation="MASIIDIKEECALHVRNFEFTYKGASSPSLKKVSMPIAKNAVTAL
FT                   IGPSGCGKTTLLRAFNRMHDLYPGNTYNGEIEFEGRNILNPKEDLIFLRTKIGMIFQKP
FT                   TAFPMSIFDNVAYGMRLQGIKNKTELEGRVEKALQDAALWKEVSDRLKNDANGLSGGQQ
FT                   QRLCIARAIAVEPEVLLFDEPTSALDPISTQGIEKLVIELKERVSIIIVTHNMQQAARV
FT                   SDYTGFMYLGELIELGHTEELFVTPKEKLTQEYITGKFG"
FT   gene            complement(7838..8680)
FT                   /locus_tag="Sulku_0007"
FT   CDS_pept        complement(7838..8680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0007"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="COGs: COG0581 ABC-type phosphate transport system
FT                   permease component; InterPro IPR005672: IPR000515; KEGG:
FT                   tdn:Suden_1886 phosphate ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Phosphate ABC transporter, permease
FT                   protein PstA; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstA; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component; TIGRFAM:
FT                   phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32675"
FT                   /db_xref="GOA:E4TW59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW59"
FT                   /protein_id="ADR32675.1"
FT                   /translation="MTSTQKRIIINRIALTFSTLSAIIALAFLFWILGVLVMKGVNALN
FT                   WNIFIYEGSPPGYAESGLRHALIGQLILVGLATLIGVPLGIMAGTYLSEYGKNSKLAHT
FT                   IRDISDIMMSAPSIVIGAFVYAVVVMPMGHFSAWAGAIALAIIMIPVILRTTDDMLQLV
FT                   PGTLREAAFALGAPKYKVIIDVVYRGAKAGILTGVLLGIARVGGETAPLLFTSFNDNFF
FT                   TTDLNEAMPSLTVTMFNYAISPYDDWQQLGWAAAFILSMFILGLNIMGRLILLMGKRK"
FT   sig_peptide     complement(8552..8680)
FT                   /locus_tag="Sulku_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(8677..9528)
FT                   /locus_tag="Sulku_0008"
FT   CDS_pept        complement(8677..9528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0008"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="COGs: COG0573 ABC-type phosphate transport system
FT                   permease component; InterPro IPR011864: IPR000515; KEGG:
FT                   tdn:Suden_1885 phosphate ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Phosphate ABC transporter, permease
FT                   protein PstC; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstC; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component; TIGRFAM:
FT                   phosphate ABC transporter, permease protein PstC; phosphate
FT                   ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32676"
FT                   /db_xref="GOA:E4TW60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW60"
FT                   /protein_id="ADR32676.1"
FT                   /translation="MIDKIFLNMTRTSALLILFIVAWIFVVLFNHSTEAMQTFGFDFIT
FT                   KDEWAPNLDKFGAYAAIFGSVASTFLAMLLAIPVAIGVAIFLSEIAHDKIKGFFGVSVE
FT                   LLAAIPSVIYGMWGLFFFVPILRDIFGGMGIGLLAAGIVLAIMILPFMAAVTRDAMNTT
FT                   PDILKESAYALGGTQWDVIKDVIIPYAKAGIIGSLILALGRAIGETMAVTFVMGNVHHT
FT                   PSSIMDPTTSIPVTLANEFTEADSSLYFSSLFGLALTLLIMSFVVIAIAKFYFLRKVRK
FT                   GQ"
FT   sig_peptide     complement(9424..9528)
FT                   /locus_tag="Sulku_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(9652..11040)
FT                   /locus_tag="Sulku_0009"
FT   CDS_pept        complement(9652..11040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0009"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro IPR006675: IPR002646: IPR006674; KEGG:
FT                   ant:Arnit_0649 polynucleotide adenylyltransferase region;
FT                   PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SPTR:
FT                   Polynucleotide adenylyltransferase region; TIGRFAM: metal
FT                   dependent phophohydrolase; PFAM: HD domain; Poly A
FT                   polymerase head domain; TIGRFAM: uncharacterized domain
FT                   HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32677"
FT                   /db_xref="GOA:E4TW61"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW61"
FT                   /protein_id="ADR32677.1"
FT                   /translation="MIPLFPPLVRLVEHLSHHGIKPIFVGGFVRDFFTGHTTSDLDIEL
FT                   YGVTSLETLEALLRPFGKLGLYGKSFGVLKLNYEGYSIDFSPPRTESKSGFGHKGFELE
FT                   WFSDLDFSAAARRRDFTINAIGYDPLTQTLLDPFGGVEDLKAKRLRCVDPETFIDDPLR
FT                   VLRAVQFTARFELTCDKNLLALCRQMIANGALNELPKERIFEEFKKLLLQSNRPSIGMA
FT                   LLRDMGALGFFTPLDRLEETPQEKDSHPEGSVWVHTLMALDSMASLRCGEWRDDIILML
FT                   AVLLHDIGKPDTTLYADGILNAPKHAEIGAEMAQDWLERVTEDKTLISRILPLIRYHGW
FT                   PRKLYRSNALDSDILRLSTYVCIRDLILVAKADFFGRAFVGNIPEHFEAGEWLYERASA
FT                   LGVLVEPPVPLLMGRDLIALGMPPSEAFKSILNDAYDAQLNQLFFTRDQALEWLNIYLE
FT                   RGKL"
FT   gene            complement(11037..12449)
FT                   /locus_tag="Sulku_0010"
FT   CDS_pept        complement(11037..12449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0010"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358: IPR005467: IPR003661: IPR003594; KEGG:
FT                   tdn:Suden_1558 histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SPTR: Histidine kinase; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32678"
FT                   /db_xref="GOA:E4TW62"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW62"
FT                   /protein_id="ADR32678.1"
FT                   /translation="MLRIHQLFFLNVLGLFVAALFVASLISYFTLKSMIINDSEERLIE
FT                   NINLLEPLLTSTNDFDRFVAQAAGKTFLRVTVIDENGNVMAESDADKTTMENHIGRVEV
FT                   MHAMTEPYGTAIRYSKTVKTDFIYVAHKIVTPERTFYIRLAMSLEGVMKHFYVLWIQLV
FT                   GGFGILVVIALLIAYNISKKARYDILQITRYLDEVSAKNYRAVLKPEYFREFLQISILL
FT                   KNLVKKLHNRDKQKRKHTAKLRLINKQQNDILSAISHEFKNPIAAIMGYAETLHDDLNI
FT                   DPKIREKFLDKILSNTQRVTLMLDRLALSVKLENNDLSIKPSSFNISDICHDSISILQA
FT                   KYPARSITYHGTAKTVFADKTMIELIITNLIDNALKYSDEEVTVTLTDNTLSVSDKGIG
FT                   IAQSELDKITSKFYRVQKNRWDNSMGLGLSIVSYILKLHDSELRIESILGIGSTFSFSL
FT                   ANLVEKKGPSKK"
FT   gene            complement(12443..13117)
FT                   /locus_tag="Sulku_0011"
FT   CDS_pept        complement(12443..13117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0011"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_1559
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32679"
FT                   /db_xref="GOA:E4TW63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW63"
FT                   /protein_id="ADR32679.1"
FT                   /translation="MNALILIVEDEQDILELMEYHLTKEGFETIGFLNTKHVNNALEEE
FT                   NVDLILMDRNLPGAEGSEFVESLRKRGMQTPVIFVSAKNKDEDIEQGFERGGDDYIAKP
FT                   FSMKELILRVKAVLRRTKKLSNEGNLSYRDISLNLAARTVFIESNPIELTKLEFDLLHA
FT                   LIVNENVVLERDYLLENVWGGDEVYQDRTVNVAINRLKEKIDPDKSKEYIKTVRGVGYT
FT                   LC"
FT   gene            complement(13251..13922)
FT                   /locus_tag="Sulku_0012"
FT   CDS_pept        complement(13251..13922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0012"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR008170; KEGG: tdn:Suden_1888 phosphate uptake
FT                   regulator-like; PFAM: PhoU family protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: PhoU domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32680"
FT                   /db_xref="GOA:E4TW64"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW64"
FT                   /protein_id="ADR32680.1"
FT                   /translation="MLPRYENKLNEIRGMISVMLSQIIQSSEETLKAFETDNAELYEIS
FT                   RTYIKNIQVDANKIDNEIIKTFALFGPEADELRLLVAYLKMTNEIDRIGDGLKKYSKRL
FT                   HDHCMGGCDMSVLTNAIVQLHKTTINALQYISECLNNIDSCDADDTYRKVMVEESKNDD
FT                   LFSLMEKELLNLIIDANELAVEYVRVLGTLRKLERIGDRTVNIASLMLYAQKGGELNLH
FT                   N"
FT   sig_peptide     complement(13824..13922)
FT                   /locus_tag="Sulku_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            14068..15069
FT                   /locus_tag="Sulku_0013"
FT   CDS_pept        14068..15069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0013"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="COGs: COG0226 ABC-type phosphate transport system
FT                   periplasmic component; InterPro IPR005673: IPR006059; KEGG:
FT                   tdn:Suden_1883 periplasmic phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; SPTR:
FT                   Phosphate ABC transporter, phosphate-binding protein PstS;
FT                   TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32681"
FT                   /db_xref="GOA:E4TW65"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW65"
FT                   /protein_id="ADR32681.1"
FT                   /translation="MLTNVIKGLVIAGVAATSMIAADKINGAGATFPAPVYYDWAYNYQ
FT                   KATKTRVNYQAIGSGGGIKQISERIVDFGATDAPLTQKELDKAKLTQFPAVIGSIVVAH
FT                   NLPGVADEKLKLKNSVVADIFAGKITMWNDPAITADNAGIKLPAEKIIVAHRSDGSGTT
FT                   YVFTDFLSDSSQNWKSKFGIGKAIGWATGVGGKGNEGVTNLIKQTPYSIGYIENAYKEK
FT                   NNLSAATLQTASGKWVTATKANFMAAVKQASWKKSEGFYGSLVSQKGDTAYPIVAATYI
FT                   LLPKEKAEMNDQVIKFFDYAFKNGDKAAEKLGYIPLPVETTNLVREYWAETK"
FT   sig_peptide     14068..14148
FT                   /locus_tag="Sulku_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            15410..16777
FT                   /locus_tag="Sulku_0014"
FT   CDS_pept        15410..16777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1882 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32682"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW66"
FT                   /protein_id="ADR32682.1"
FT                   /translation="MKKVALSALAAVVISGVASADALTLYSDPKTGQVYTTPGEGRVEM
FT                   GDFVSAKEVDMQMRDLESKGSEYQDKMSKYVNVKSKAKTLEFSGTHYFGLTSASPSTTV
FT                   SDADGSHTSKYAGTSTGFELRRNYVQVKAYFNDKDYFRVTMDTTKELASSTSYANIYAK
FT                   YAYLYLDKVLPYTGVEIGIAHRPWIDYEEHNAWHYRSFNKVVLEEKGTATETGVDLVNS
FT                   ADLGVNFKTQTDAFSSEIGIFNGEGYHADKAAANQENDSKLSLEWRLTGHILGSGTKVG
FT                   KNDRTKDTYANISTYGLISKNHKDDDVDLQGVDSPNEYDRSIYGIHAVYNQPEFLIAAQ
FT                   YFTAKDDKRTQNIATGFDTKDYKGWSVNAEYRPFQDWTVIGRYDNYSIESELNGVDVND
FT                   IEGDKIIAGLAYKYNKNVSFIASAKFADEKDKKVAAKSSDTGESKDVYMLTTEVKW"
FT   sig_peptide     15410..15469
FT                   /locus_tag="Sulku_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(16875..18140)
FT                   /locus_tag="Sulku_0015"
FT   CDS_pept        complement(16875..18140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2284 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32683"
FT                   /db_xref="GOA:E4TW67"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW67"
FT                   /protein_id="ADR32683.1"
FT                   /translation="MYNGLSLDQAPPISAVMRFFLTVPLFGILLSLSIFFHPEAVLTPA
FT                   HPISLAVIHMMFLGVITMAMIGALFQMQSVLGGRPIPAASGNALIIHVFLTVGILSLSG
FT                   AFAFNASVMFIVAAVFLASSILYTANLILPLLFGGVTHDTLRGMRLALISLSLTALFGI
FT                   VMASSYANSSFSTMHDAIRTSHYSLGLIGWIGTLIVAVAFQVIEMFYVTIPYNGWCKRN
FT                   AFRIIAASLFLKVVWLFFAFPYVWIFDLTLGALFTGFIITTLKRLQLRKRRVSDVSILF
FT                   WTTGIALLYIAIMAYGVYEWGNYKPLLSISLIAFILFSLSIILGMMGKIVPFLVWFHLS
FT                   SNGIMDAPIMSNIIPQSRAKTLFSLFLLTTFSLLGGIFVLELFVVGAIAASAMFALLLF
FT                   NLINALRVYRFSMIHGLRFEQI"
FT   gene            complement(18133..18375)
FT                   /locus_tag="Sulku_0016"
FT   CDS_pept        complement(18133..18375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2283 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32684"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW68"
FT                   /protein_id="ADR32684.1"
FT                   /translation="MILLDIREYDHPVPLEMAVNAFKKLSGDEIVHMIHRREPIPLFEI
FT                   IVKNDGRYLSVMEREDLWHIYFTRSSAVKLEHEHV"
FT   gene            complement(18372..18806)
FT                   /locus_tag="Sulku_0017"
FT   CDS_pept        complement(18372..18806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0017"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: tdn:Suden_0493 hemerythrin
FT                   HHE cation binding region; PFAM: Hemerythrin HHE cation
FT                   binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding region; PFAM: Hemerythrin HHE cation binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32685"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW69"
FT                   /protein_id="ADR32685.1"
FT                   /translation="MILEFMRDDHRACDHYYTEAENALSEKKVDDAVRLFDEFYRATNH
FT                   HFDMEERELFITFEKRTGMTGGPTQMMRYEHQQLRSLLESMKSALNEKRYNDFFGIGES
FT                   MMIMLQQHNMKEEQMLYPMIDRALGSDSEHMIQILKDMGQ"
FT   gene            complement(18880..21708)
FT                   /locus_tag="Sulku_0018"
FT   CDS_pept        complement(18880..21708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0018"
FT                   /product="protein of unknown function DUF490"
FT                   /note="COGs: COG2911 conserved hypothetical protein;
FT                   InterPro IPR007452; KEGG: tdn:Suden_1135 hypothetical
FT                   protein; PFAM: protein of unknown function DUF490; SPTR:
FT                   Putative uncharacterized protein; PFAM: Family of unknown
FT                   function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32686"
FT                   /db_xref="GOA:E4TW70"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW70"
FT                   /protein_id="ADR32686.1"
FT                   /translation="MKRFWSLPWRKWFKHLFVTAHFLLYSSLLAASALLYIAFRPDGLE
FT                   IVNTYFLKPLGIRYTHAEGSLLDGFTLHNLRTDNARAKTFVLKYNLVKILEGEHTIDSV
FT                   QIDGLRLQLDDFKSDGTSIWPFPTFKLRDVTVTNLQLISSYSVELDLHGKNGTYDGDVI
FT                   NFSSLNATFKSRYASGAISGTVHQNSIRGMADIYPNSAELAPYSGRFTTLPRSLRIEIK
FT                   ELSNEKAILRTTIAALQSKQDPAVQAKAISLDFRYIYENDYLDIDALYTLIRGSDSMKT
FT                   KHHLRYALEGKTTTEFDGIITSNHPLPSNTLHGAFSDDTNGLSGTLTLDGSTLALASKD
FT                   YERFSWKLRSTHKNLRFIPSLPGALRSGSFELNGEGSYLLSSDSLKGTVDASHEDALFR
FT                   GIFSSRNGYRVLDGNLTLPGDAPLWKNWAHKPPEHLSISLNNEANATRLNLSGDALSFS
FT                   AVMQREKLKGSGNYLGTFFNVSGLLAPTQTRIDIDTFTPSVFATASELRPIELHKGEYY
FT                   DAEMRTKTRITLSDTLSIQSDIEIPWYAAVLDSQRAYGGTDGRVRLAYRDGNITVENYR
FT                   LEIANHPITTDKTSHLHINSAGGVTIDEFWIFDTLFLSGTVNSDLSAALRLHSDRFSYQ
FT                   GPERLAHASADMTFVRDAQANQTLSGVVNILDATITYLPFQEFKVMDDDIIIVQDVRPP
FT                   SSAKLSMNLRVTAAQPIRFKTKELDLRLDPDLTLWKEPTGPVQILGMITIPSGTAVSAG
FT                   KSFDIKHSEIYFGGDVPLNPYLNITIGHEVDYNKILIYVTHTLDSPIFLFSSDPVMSQN
FT                   DIMSYLLFGGPANTVSGGDSSTSTVRADATNFMLGAGLKGLINGATKLQIDTMNILTTA
FT                   EGGMGFEVGARLNKDLRVLYKNDTVSSVLIQYSLNRWLRLDADIHELGQGINAIYIKDF
FT                   RDFLPHNKPAKK"
FT   sig_peptide     complement(21610..21708)
FT                   /locus_tag="Sulku_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(21705..23399)
FT                   /locus_tag="Sulku_0019"
FT   CDS_pept        complement(21705..23399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0019"
FT                   /product="surface antigen (D15)"
FT                   /note="COGs: COG0729 Outer membrane protein; InterPro
FT                   IPR010827: IPR000184; KEGG: tdn:Suden_1136 surface antigen
FT                   (D15); PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat-containing protein; SPTR: Surface
FT                   antigen (D15); PFAM: Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32687"
FT                   /db_xref="GOA:E4TW71"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW71"
FT                   /protein_id="ADR32687.1"
FT                   /translation="MRYGIVIALFCTALMSTPLPITFSGNEKISSDKLFGVLGLRKPYG
FT                   IEVWEDQPSIEPIAISQSVSALSSFYKSKGFYHARVTSETNENGVLFKIQENDPILVGT
FT                   VQINSPLDIKSAVSLHTDELFDQEEFSESKSLIKKRYGEAGYCNAQFNTKAWVDIETNR
FT                   AYLLFEATPGEACTFGKVSVESTSNIDGNLTASMLRFNEGDPYSVEAIKLSYEALYAQE
FT                   GISRVIINDNERNGSVVPISLNIEEAERPIRFTAGFGYSSDQGFAAQTGLKHRNFFGDL
FT                   KTLGLDFRYSQIKQEAAGSFGLPLQNRGLLGVDVGYKNEIFDGYKTESTYQKLTAKYQD
FT                   TPASAMMGFLFDQVKTYDSKDIATFPDNKLSLISPIGELNYDTRDKPLEPTKGYWLNAN
FT                   FMGSLYTPQLSDASYFKTLLSAAYITSIDEHVFGAKLKWGTLHVYDGAVPSSYRFYAGG
FT                   MNSNRAYTYRDLGPKNFDGDPIGFSSLTEGAFEYRFPIYQEFRGVLFTDVTFASQNTVP
FT                   DYAKDGYLGVGAGFRYVTPIGPVAIDFGFDPEDTSQYAIHFRIGELF"
FT   sig_peptide     complement(23307..23399)
FT                   /locus_tag="Sulku_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(23424..23927)
FT                   /locus_tag="Sulku_0020"
FT   CDS_pept        complement(23424..23927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0020"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="COGs: COG0406 Fructose-2 6-bisphosphatase; InterPro
FT                   IPR013078; KEGG: fnu:FN0911 alpha-ribazole-5'-phosphate
FT                   phosphatase; PFAM: Phosphoglycerate mutase; SPTR:
FT                   Alpha-ribazole-5'-phosphate phosphatase; PFAM:
FT                   Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32688"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW72"
FT                   /protein_id="ADR32688.1"
FT                   /translation="MSLTLLRHAALSTEFHGRYIGHTDLPIDTELFAPIILPQMYDAVY
FT                   SSDLSRCTQTLKQLGYGDFQTDERLREVRFKEQFEGKNFTEIEGMEVYNPRFLESQEQW
FT                   HDFVCDESSTEFRGRLTSFLDELPFEKNILVCAHGGTIAEILSLLNAPIKRLAYLEYTI
FT                   VTVK"
FT   gene            complement(23918..24664)
FT                   /locus_tag="Sulku_0021"
FT   CDS_pept        complement(23918..24664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0021"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="COGs: COG0368 Cobalamin-5-phosphate synthase;
FT                   InterPro IPR003805; KEGG: ant:Arnit_1836
FT                   cobalamin-5-phosphate synthase CobS; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; SPTR:
FT                   Cobalamin-5-phosphate synthase CobS; PFAM:
FT                   Cobalamin-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32689"
FT                   /db_xref="GOA:E4TW73"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW73"
FT                   /protein_id="ADR32689.1"
FT                   /translation="MNKIILGVKFALSYFTLLPIRFNADDDLSHPRVLKSMLLSLPFVG
FT                   VLLASLSIGVFSVLESLGWLGAIIAAVIYMVLYGFIHTEAVIDVADAVHAAHSGKDPYE
FT                   IIKDPTVGAMGVLYGVSFTLLKIAALSTLLMHHLFLPFIAIALISRLSLLVLIRTYEFR
FT                   SSFVTRLHENLRVVPLILLILLCGALGFYLLSVNFLPLFVAGVLTALLLSFLTKRSLGF
FT                   INGDVLGMSLEGSELVLIITALLTCR"
FT   sig_peptide     complement(24593..24664)
FT                   /locus_tag="Sulku_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(24657..25079)
FT                   /locus_tag="Sulku_0022"
FT   CDS_pept        complement(24657..25079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1851 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32690"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW74"
FT                   /protein_id="ADR32690.1"
FT                   /translation="MSYKQWFDAHAAKHAAIMEKLTRLSDDEVIEYFRFENMVKNEPDF
FT                   CPLYAENKKCHDTEELNCYLCACPNFRFSDAGFAVEERKILFSTCSIESPDGDRYVSES
FT                   AIHQNCAGCIVPHRESYIKKVFDRDWLKIMKEVPSE"
FT   gene            complement(25069..26409)
FT                   /locus_tag="Sulku_0023"
FT   CDS_pept        complement(25069..26409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0023"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR004459: IPR017929: IPR011698; KEGG: ant:Arnit_1837
FT                   cobyric acid synthase CobQ; PFAM: CobB/CobQ domain protein
FT                   glutamine amidotransferase; SPTR: Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32691"
FT                   /db_xref="GOA:E4TW75"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW75"
FT                   /protein_id="ADR32691.1"
FT                   /translation="MRSISIFGTSSDAGKSTLTFVIGRLLQERGINVGVFKAQNVSNNS
FT                   RVCDDGSEIAVAQYFQAEVLGIPTSYHLNPVLLKSGHGNSASLIVKGRVVEDKEVREYY
FT                   RDLDQLKPAVNECFEYLSERYECLVCEGAGSPVELNLMDKDLSNIYIAQKYNTKIILVA
FT                   DIERGGVFASIWGVYNLLPEALRKNVIGVIINKFRGDRSLFDEGVTIIEERFGIPVLGV
FT                   LPYLPLNLGFEDSQSLKNFIQNKPHPAQKIGIIAYPTMSNYNDFEPLIADESIFVEFIT
FT                   SNVALESFDCVILPGSKRVIEDLRWLKKTGLFDAIQKREKEILGICGGYQMMFTEIIDE
FT                   ECVETPEPSREEALGFIDDAIVFQKEKVLTKGEYSIFGKTVRGFEIHHGVSGKYPLWYE
FT                   KGHIKGTFVHGLFEDEAFEEYKQKTVGDFIATMRDEIDMERILEHVL"
FT   gene            complement(26406..27269)
FT                   /locus_tag="Sulku_0024"
FT   CDS_pept        complement(26406..27269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0024"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: ant:Arnit_1844
FT                   cobalamin biosynthesis protein CobD; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR: Cobalamin biosynthesis
FT                   protein CobD; TIGRFAM: cobalamin biosynthesis protein CobD;
FT                   PFAM: CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis
FT                   protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32692"
FT                   /db_xref="GOA:E4TW76"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW76"
FT                   /protein_id="ADR32692.1"
FT                   /translation="MFFGVALIAYITDRLFGEFPFIRHPIVLMGDFITAFQKRFYRDSI
FT                   LRGFWLVFWLLAAVLAIVTPITLIGNPWILGIIASTGIAGKMLYESVNNVLSDPSSIRY
FT                   LVSRDTQNLSESEINKAAIETYAENLSDGVIAPLFYLLVFGLVGLFLYKAVNTLDSMVG
FT                   YRNERYEKFGKVSARLDDLLNYLPSRITAVIILTFFGKLSALKKTWHYGAQHESPNAGY
FT                   PIAAMALSLYVSLGGPTSYFGTIKNKPYFGEGKREITDGDVRSALALQWKLDTLVILLL
FT                   AAGVYA"
FT   sig_peptide     complement(27219..27269)
FT                   /locus_tag="Sulku_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(27254..28261)
FT                   /locus_tag="Sulku_0025"
FT   CDS_pept        complement(27254..28261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0025"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839; KEGG: ant:Arnit_1843 aminotransferase class I
FT                   and II; PFAM: aminotransferase class I and II; SPTR:
FT                   Aminotransferase class I and II; PFAM: Aminotransferase
FT                   class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32693"
FT                   /db_xref="GOA:E4TW77"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW77"
FT                   /protein_id="ADR32693.1"
FT                   /translation="MTTYGHGGDVNSFAAHCGCEVSEVCDLSSNINFITPSVDFSGVLL
FT                   NAYPSYGELTEALARHYRVKCDEMELFNGGSSAIFSLMRFFDHPTCTIYSPAYLEYKKA
FT                   ATLYGKKIALIDRFESMDAEVEENSLVVFVNPSTPDGQYYGIETLMKRWMARDCTILID
FT                   ESFLEFCGGESATRYLQTYDKLYVLKSQTKFYGCAGVRVGIVLSSCENIAALKTKEPLW
FT                   KISALDGHFLITALADEPFRVRSHALNAEAKTYLKTILDNSPLFEEVFESDANFFLVRL
FT                   ASISAKAFQEKLLPYRIMVRDCSNFDFLDERTVRIAVKELEALKRFEGALCSLE"
FT   gene            complement(28258..28749)
FT                   /locus_tag="Sulku_0026"
FT   CDS_pept        complement(28258..28749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0026"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /note="COGs: COG2087 Adenosyl cobinamide kinase/adenosyl
FT                   cobinamide phosphate guanylyltransferase; InterPro
FT                   IPR003203; KEGG: ant:Arnit_1838 cobalbumin biosynthesis
FT                   protein; PFAM: cobalbumin biosynthesis protein; SPTR:
FT                   Cobalbumin biosynthesis protein; PFAM: Cobinamide kinase /
FT                   cobinamide phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32694"
FT                   /db_xref="GOA:E4TW78"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW78"
FT                   /protein_id="ADR32694.1"
FT                   /translation="MKILYFGGQKSGKSSLAEAKTLAIATDKPYYLATYDHTFGDEEMG
FT                   ARIDKHRISRGEEFITLEESRDLSRVIEPHHTYLVDCISMWILNRLDENEEVLVAEIEA
FT                   LGAIDANIVFVLNDVTSGVIPSDPISRRYVDLSGIIGQRLARLCDEVVEVKLGLERRLK
FT                   "
FT   gene            complement(28746..29807)
FT                   /locus_tag="Sulku_0027"
FT   CDS_pept        complement(28746..29807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0027"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR002805: IPR003200; KEGG: ant:Arnit_1840
FT                   hypothetical protein; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Phosphoribosyltransferase; TIGRFAM:
FT                   conserved hypothetical protein TIGR00303"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32695"
FT                   /db_xref="GOA:E4TW79"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW79"
FT                   /protein_id="ADR32695.1"
FT                   /translation="MIKTITGNKDFIESLRGKRASFLLCMSNTKTANIEGITQAGIPGM
FT                   LHLTPTLDAEFIAIGEVRSLGSIAETPKGVPTPALLTRAVHLLHPFREIEMLELGLEIS
FT                   PKLEHFKLHSFGIAPSDSISDGANIPAEEVFEKGIQFAQNLTIQSDYIILGESVPAGTT
FT                   TALATALALGYDAQDKFSSSFKNAPSGIKQSVVDQALSRIGENDDLFSILSKVGDNMLI
FT                   FNAGLILGLQNRDIRIVLAGGTQMACALLVVNRILQMMEGELDTSRIALCTTKWVAEDT
FT                   QSDIKALLEMNDFALNAYYADFDFSLTDHPALKLYDEGEAKEGVGAGGALMYGLLNGLS
FT                   KEAITRKVESFLG"
FT   sig_peptide     complement(29712..29807)
FT                   /locus_tag="Sulku_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(29804..30568)
FT                   /locus_tag="Sulku_0028"
FT   CDS_pept        complement(29804..30568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0028"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG:
FT                   ant:Arnit_1841 aminoglycoside phosphotransferase; PFAM:
FT                   aminoglycoside phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32696"
FT                   /db_xref="GOA:E4TW80"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW80"
FT                   /protein_id="ADR32696.1"
FT                   /translation="MGVKRVITLSDLPASLGVQTLASSTDGVMDSVYFLDDDRVVKIFE
FT                   TASEEAVAEELKLLIHCGSLHVSRAEGGVFRVQNKPALIYRRCRGESLKDAGIDEIRQI
FT                   GAFLRDFHHLTAGRRSTNERLFEKSRLARMIRETHTDIFDTLLKKNDLTLRDEGIIHGD
FT                   LFLDNALFLEGRLSCVIDFTQACNGDFLFDLAVTDLSWCDSDEKTEALLKSYGATLTLD
FT                   EFRPYREYATLFYCVNRYLNGGNYQELLEKLV"
FT   gene            complement(30559..31182)
FT                   /locus_tag="Sulku_0029"
FT   CDS_pept        complement(30559..31182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0029"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR012825:
FT                   IPR000415; KEGG: ant:Arnit_1842 cob(II)yrinic acid
FT                   a,c-diamide reductase; PFAM: nitroreductase; SPTR:
FT                   Cob(II)yrinic acid a,c-diamide reductase; TIGRFAM:
FT                   cob(II)yrinic acid a,c-diamide reductase; PFAM:
FT                   Nitroreductase family; TIGRFAM: cob(II)yrinic acid
FT                   a,c-diamide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32697"
FT                   /db_xref="GOA:E4TW81"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW81"
FT                   /protein_id="ADR32697.1"
FT                   /translation="MKYTLRDAELLQTIFSSRRDVRGNRFVDAPIDDEVLRKILEAAIS
FT                   APSVGFSQPWKFVIVQDHAKREEIYEEFVRENTKASKLFEGNLLYDTLKLEGIKESAIN
FT                   IAVLYKKPTKTVLGQTTQKKMGEYSVVCAIQNLWLMARAYNIGVGWVSILRAKKVKKIL
FT                   GIGNEYKLIGYLTLGHVNEFLDEPELLKLGWENKKTIDEVVEWV"
FT   gene            complement(31179..32138)
FT                   /locus_tag="Sulku_0030"
FT   CDS_pept        complement(31179..32138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0030"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   ant:Arnit_1846 transport system permease; PFAM: transport
FT                   system permease protein; SPTR: Transport system permease
FT                   protein; PFAM: FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32698"
FT                   /db_xref="GOA:E4TW82"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW82"
FT                   /protein_id="ADR32698.1"
FT                   /translation="MMKYVSFVLALAVLVIAPFFGEIAVDVQEIFNPESSSSMLFWEIR
FT                   FPRVIVAFCSGAILSLAGLVFQSIFRNPLTTPFTLGVASGATLGTALAIVFLGGLLFWQ
FT                   YALSFIGALLTVIVLFLLSRSLKSAQTLSLLLVGIALSFFYSAALMVLYYLSDFEQSYS
FT                   IVRFTMGSLNIVGFDTAYPIVIASLLFLFAIHWQRQPLRLLLTSLDFAFLKGLHVTRLV
FT                   MTLLLITSMAVAVCVSVVGPIGFVGLIVPHIIKLLYRSSSDTLIFPTFFYGGIFLVACD
FT                   LIARNLGAASDIPIGVVTSFLGGPFFIYLILHRHKGSR"
FT   sig_peptide     complement(32067..32138)
FT                   /locus_tag="Sulku_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(32122..32835)
FT                   /locus_tag="Sulku_0031"
FT   CDS_pept        complement(32122..32835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0031"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: ant:Arnit_1847 ABC
FT                   transporter-like protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32699"
FT                   /db_xref="GOA:E4TW83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW83"
FT                   /protein_id="ADR32699.1"
FT                   /translation="MLHVADLTCQILKNVSFALEEGKNLTILGNNGSGKTTLARALCHL
FT                   IPSESVFWEGKKIGDIAHHLRSQTINYVPTSLEIYDEYLSVTDYLDLNFFESSNPQMRE
FT                   EILGVMEIEHLRDSPCQRLSSGESSLLLIAGAILHRAAYTILDEPTANLDQAKKVKIYR
FT                   LLKSGSYFQNKIIITHDLNLAYKLGYDILYLEEGEVRFFGSCSDFFDPTQLEGCFGSAV
FT                   QNIGGNFVVNYDEVR"
FT   gene            complement(32819..33646)
FT                   /locus_tag="Sulku_0032"
FT   CDS_pept        complement(32819..33646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0032"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   ant:Arnit_1848 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Periplasmic binding
FT                   protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32700"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW84"
FT                   /protein_id="ADR32700.1"
FT                   /translation="MLLKLWALLIVGMNLYGTERIIALSPAINETLYALGAGDQIIANT
FT                   EYCNYPVEAKNKPKVGGYFSPSLEKILSLNPTMVILQENNAPLAAKIQKMGIKTLIIKI
FT                   DTYPSIRRSIFTIGAVVHKEKRAEAIVSELDQKLRALRGIIRNQKILMVFGHNTDLSKS
FT                   IYVSGQNLYFDDLIRSSGNTNALQSRRKGQPVLNLENIIALNPDVIILLAPNTKERGLT
FT                   KEALIAPWRSLPINAAKREKIYVEDQPYSSNPSQRLGLFLDDMRGYLIDAARR"
FT   sig_peptide     complement(33578..33646)
FT                   /locus_tag="Sulku_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(33637..33981)
FT                   /locus_tag="Sulku_0033"
FT   CDS_pept        complement(33637..33981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abi:Aboo_1244 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32701"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW85"
FT                   /protein_id="ADR32701.1"
FT                   /translation="MKLIVLSVFLALHCWGENLTVTLHYGDAKPDKVIETAYSRGMSAL
FT                   DVLKRISRVETSKTGQYRFVRSIDGVRSQIGKFGWFYLIDGESVNTTAENFILNDAKTM
FT                   TWIYKVEACY"
FT   sig_peptide     complement(33934..33981)
FT                   /locus_tag="Sulku_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(33981..35828)
FT                   /locus_tag="Sulku_0034"
FT   CDS_pept        complement(33981..35828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0034"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910: IPR000531; KEGG: sdl:Sdel_1459
FT                   TonB-dependent receptor; PFAM: TonB-dependent receptor
FT                   plug; TonB-dependent receptor; SPTR: TonB-dependent
FT                   receptor; PFAM: TonB dependent receptor; TonB-dependent
FT                   Receptor Plug Domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32702"
FT                   /db_xref="GOA:E4TW86"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW86"
FT                   /protein_id="ADR32702.1"
FT                   /translation="MYKQTISFVAAATLAASSLGADELSFHPIVVTATKTEQSLNTITS
FT                   NVEIITAEEIEEQHYTSLAEALNSLSGISITSNGGVGTTQEVFVRGMDTNKVLVLINGI
FT                   RYQDPSSTSGANFAHLLISDIEQIELIKGAQSGVWGADASAGVINIITKSAEAGTHTGA
FT                   NVEYGSFATTKWGGFLSHKTDKYDFKISFDRLMSSSFTAQAPKGDNIDRYEKDPYANTT
FT                   LNLNAHYNPTSEDTFGISYTDINALGSYDSYHSPNSVEHSDVRTRLYGVTYDKAYHNHT
FT                   LSTKANLSKFRRDELDTGYGVKVFNGQTREAELRDHFRYGENDFIVAGLSKKWDQIDFI
FT                   QADSTTGAKSVSSKAVFVTNSNTFGDLILTESLRRDDYSSFHAKTTGKMGAKYTLSEDM
FT                   YVGGNYGTSYTAPNLIQMFNPWGASNDTLSPENTKSYDLTLGYKSITLTYFENRVKDLI
FT                   EWYDPTPLNWFNNDPYYKNLNGISTFKGYEVTFRHTLLDAFVLNADYTHLARFVDKDGK
FT                   DLKRRPKREAKVSVNYYGIEDLSMGINAHYVGTRYDQADQQGEQTGRYTLFNFVLNYNL
FT                   TDSIQLYGKIDNLTDKYYQSVDGYASSPRGYYAGMKVIF"
FT   sig_peptide     complement(35766..35828)
FT                   /locus_tag="Sulku_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(35771..36031)
FT                   /locus_tag="Sulku_0035"
FT   CDS_pept        complement(35771..36031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0832 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32703"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW87"
FT                   /protein_id="ADR32703.1"
FT                   /translation="MRSPRGFGKTYFSLVAIQAYASEVRLLQIIHQIIWICPTHPIHTY
FT                   STVSPPKSVLLLSIITTITQGHLCTNKPFPSLPRQHWLPLL"
FT   sig_peptide     complement(35969..36031)
FT                   /locus_tag="Sulku_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(36087..37664)
FT                   /locus_tag="Sulku_0036"
FT   CDS_pept        complement(36087..37664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0036"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089: IPR003660: IPR004010; KEGG:
FT                   nis:NIS_1120 hypothetical protein; PFAM: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein;
FT                   Cache domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Cache domain; HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32704"
FT                   /db_xref="GOA:E4TW88"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW88"
FT                   /protein_id="ADR32704.1"
FT                   /translation="MNIFNTIKSKFIVNLVAAVGAILVSVIVAYFIAVGSIKEIMISDL
FT                   NTVADVLEKNVNYIANIEPKAYEETEFKEEIKKIKIGKSGYVYFINAEGVMTIHPKPED
FT                   EGKNKSGHDYVDHIRADKAGGIYEYVSATTGQDKIAAYRYIPAWDMWVIPGINKADYFE
FT                   ELRAGFFKWFLLLGTILTAMLIAINYVSGTSILHPIEELDKVSSDLAHGNGDLTKRLPI
FT                   LNKNDEIGIASLYLNQFITKIQSTINDTKQITSSAVDSTSTLNSAAANLSAQSEKTNTI
FT                   AQNTNKTASEIEVTLEQSVNMAKATLENSRLTETELSHVRDIATAITSEVHKTTQMSSE
FT                   LGERFAQLSSDAASVSGVLSIISDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRK
FT                   LAERTQKSLTEINSTISIVIQSISDSSDMMHSNSQNISRLAERSEEIDLKIDAASSALR
FT                   SNVDASHQSVQQSENMAQKIHEIIHKVSEMSSLSQSNQEEIKQISNIAVELYNAATNLN
FT                   TQLGQFKS"
FT   sig_peptide     complement(37560..37664)
FT                   /locus_tag="Sulku_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            37733..39061
FT                   /locus_tag="Sulku_0037"
FT   CDS_pept        37733..39061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0037"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616: IPR008532; KEGG:
FT                   tdn:Suden_0123 hypothetical protein; PFAM:
FT                   Fibronectin-binding A domain protein; protein of unknown
FT                   function DUF814; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF814);
FT                   Fibronectin-binding protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32705"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW89"
FT                   /protein_id="ADR32705.1"
FT                   /translation="MRFSYLKQIVAYMQQEFSYVVAAYRVNDTTLKLVFNRENSWNFEM
FT                   QRGNSAITIGEIPNRGKMYQAPFDILIAKRLNRSTIQSITLHNNDKIIRITTTTSGSYK
FT                   SETTILQLEFTGKHTNVILLDKEGIVLEALRHIDEDVSARSVRVGQKLGEIPSPPFEPK
FT                   EYPLENVRDYLIEEFRRRNSDKLNQLKHEKKALLQKRLGQLHKHLDALEEEGVLIQDAQ
FT                   ASQNAGHLILANLDVVKPYGKKAELINFDGTPVELELPSGCTTAAGCAESFFKRSKKAK
FT                   QKAQGLHQERSNLEAKIRHLELFIQTVEEATSPEEITLLFPPKAMGSKVKSSDSIAEFW
FT                   IEGVKVSLGKSEKGNIELLRNAKARDIWMHLKDRPSAHVIISTDKQQLPEKLLEAAAKL
FT                   CVDFSVFEKGRYLVDYTPRREVKMGEGANVLYTDYKTLNIEKG"
FT   gene            39073..39381
FT                   /locus_tag="Sulku_0038"
FT   CDS_pept        39073..39381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0124 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32706"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW90"
FT                   /protein_id="ADR32706.1"
FT                   /translation="MADIGPIGGAIYVNQQMASVASEKNAVLNRFELQALAAASASQEA
FT                   KKEIEEVRPTEENQGVDPDREHTKEQAEQEERRSEHNEKNEENEKPLKPLHLLDIKV"
FT   gene            39475..40233
FT                   /locus_tag="Sulku_0039"
FT   CDS_pept        39475..40233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0039"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="COGs: COG0575 CDP-diglyceride synthetase; InterPro
FT                   IPR000374; KEGG: tdn:Suden_0125 phosphatidate
FT                   cytidylyltransferase; PFAM: phosphatidate
FT                   cytidylyltransferase; SPTR: Phosphatidate
FT                   cytidylyltransferase; PFAM: Cytidylyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32707"
FT                   /db_xref="GOA:E4TW91"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW91"
FT                   /protein_id="ADR32707.1"
FT                   /translation="MQTAKNSTQERIVTAVFLVIGVLVVGLINNFWLMWTVMGIIYLLA
FT                   FHEATRLFGINNSSLYAYAAILWLAAALYPYGEDLFVIAGLIFAAAVAYTQNIPPKNFL
FT                   PFIYPTAGMLFMLSMYQDYGMGAMLWLLVVVASTDIGAYVVGRSIGKTPFSVSSPSKTR
FT                   EGVYGGIAVATAAGFFIGVTIVGIPQAIIISMAAAIGAVFGDLFESYLKRKAGVKDSGS
FT                   ILPGHGGVLDRIDGYLFASIIMLVLLRGIV"
FT   gene            40230..41306
FT                   /locus_tag="Sulku_0040"
FT   CDS_pept        40230..41306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0040"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="COGs: COG0743 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; InterPro IPR003821: IPR013512: IPR013644;
FT                   KEGG: tdn:Suden_0126 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain-containing protein; PRIAM:
FT                   1-deoxy-D-xylulose-5-phosphate reductoisomerase; SPTR:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; TIGRFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase;
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal;
FT                   TIGRFAM: 1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32708"
FT                   /db_xref="GOA:E4TW92"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW92"
FT                   /protein_id="ADR32708.1"
FT                   /translation="MILLGSTGSIGVNALKIADQFNLSVDTLVAGRNITLLNDQIKRHN
FT                   PKRVVVMRQEDTHLVNHSNVRFGESAILDAIEESSSGHVVNALVGFAGFAPTLKALECG
FT                   KRVALANKESLVVGGAFVNTSNIVPIDSEHFGLWYLNQTGRSISRMMITASGGAFRDWP
FT                   LEKLSSATLQDALNHPNWSMGQKITIDSASMVNKLFELLEARWLFGEGEYDALIETKSL
FT                   IHALIDYTDGSTTAHFAHADMRLPIAYALMGKVETPIVNRIDLAQIGSLEFRPIDAARY
FT                   PIWEIKNDLLKNPARGVIVNAANEAAIERFISGEIRFVDISTMILNAYNRFSGMPESIE
FT                   AVFSLDEEIRRYVKGLSC"
FT   gene            41300..41830
FT                   /locus_tag="Sulku_0041"
FT   CDS_pept        41300..41830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0041"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="COGs: COG3545 esterase of the alpha/beta hydrolase
FT                   fold; InterPro IPR010662; KEGG: tdn:Suden_0144 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1234; SPTR:
FT                   Putative uncharacterized protein; PFAM: Alpha/Beta
FT                   hydrolase family of unknown function (DUF1234)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32709"
FT                   /db_xref="GOA:E4TW93"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW93"
FT                   /protein_id="ADR32709.1"
FT                   /translation="MLKVLILHGWGGSDDPHWQAWLAGEIAKDYGTVSFPLLDNPHFPS
FT                   KNRWMKQIKSLLNDFRPDIVICHSLANIAWFHLCNEGEISPVKRLLLVAPPHLTCEIET
FT                   LKTFFPLEAPKALFAEEVLLVTSTDDPYMSTQEAAELQKALGVEMKVIENGGHINTASG
FT                   YGEWPWVKEWVLQ"
FT   gene            41827..42804
FT                   /locus_tag="Sulku_0042"
FT   CDS_pept        41827..42804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0042"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR017860: IPR017861:
FT                   IPR000905; KEGG: tdn:Suden_0131 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; PFAM: peptidase M22
FT                   glycoprotease; PRIAM: O-sialoglycoprotein endopeptidase;
FT                   SPTR: Probable O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; manually
FT                   curated; PFAM: Glycoprotease family; TIGRFAM: putative
FT                   glycoprotease GCP; metallohydrolase, glycoprotease/Kae1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32710"
FT                   /db_xref="GOA:E4TW94"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW94"
FT                   /protein_id="ADR32710.1"
FT                   /translation="MILSIESSCDDSSIAITEIATKKLIYHKKISQELEHSKYGGVVPE
FT                   LASRLHAQALPAILAECEPWFSQLKAIAVTNEPGLGVTLIEGVTMAKALSIALNIPILP
FT                   INHLKGHIYSLFIEKEAVLPITVLLVSGGHTQLIEVKSYTEMETVATTMDDSYGESFDK
FT                   VAKMMSLGYPGGPLIEKLSLSGDSSRFAFTVPLWQSPLIAFSYSGLKNQVRLAVEANDE
FT                   SAYPDIAAAFQKTATDHLIQKLKKYFKSRPPVRFAIVGGASANLYLRERVKDVLHPYKA
FT                   ELLLSELKYCSDNAAMIGRAAVESFRNNFVVDYKKIAINPRCKL"
FT   gene            42898..43401
FT                   /locus_tag="Sulku_0043"
FT   CDS_pept        42898..43401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0043"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /note="COGs: COG2077 Peroxiredoxin; InterPro IPR018219:
FT                   IPR017936: IPR013740; KEGG: tdn:Suden_0132 thiol
FT                   peroxidase; PFAM: Redoxin domain protein; SPTR: Thiol
FT                   peroxidase (Atypical 2-Cys peroxiredoxin); PFAM: Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32711"
FT                   /db_xref="GOA:E4TW95"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW95"
FT                   /protein_id="ADR32711.1"
FT                   /translation="MATTMLKGNVVNLAGNTVNVGDKAPAVTVVNSNGLADKVVGGASG
FT                   KKQLIVVVPSLDTAVCATETRNFNKRASEIEGVDLTVVSMDLPFAAGRFCSTEGIENLV
FT                   VASDFRNKDFANAYGVLIADGALAGVTCRAIFAVNEEGTVIYKEIVPEITAEPEYEAAL
FT                   AAVK"
FT   gene            complement(43460..44074)
FT                   /locus_tag="Sulku_0044"
FT   CDS_pept        complement(43460..44074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1999 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32712"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW96"
FT                   /protein_id="ADR32712.1"
FT                   /translation="MKKYSLFLSLLLLSHLIARENPFFASDEAKKQKVTSNISDARPQM
FT                   GTLSYTFPDQARVLKEITFTVQNLDGSIEEKKLQIDQSIDWHRALIISQGGSSPHLTAK
FT                   NSSSAANFGFIQLYSKGKSLTIKSSDPLIRHFALSNPNSIVLDFKHEASFKSDQKTLNA
FT                   APYLNVSVGNHGKFARATITLDGHYAYTLSKENGLITIICK"
FT   sig_peptide     complement(44000..44074)
FT                   /locus_tag="Sulku_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(44088..44375)
FT                   /locus_tag="Sulku_0045"
FT   CDS_pept        complement(44088..44375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_2000 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32713"
FT                   /db_xref="GOA:E4TW97"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW97"
FT                   /protein_id="ADR32713.1"
FT                   /translation="MHQESQQHLFHEEKESLTERYFGLQTYKFFLAAGVVLSVGIYMGF
FT                   IFFGDNSLSVLLDLEEYQDYLSGDIERLKAENAALQKQYFELKELDADSQ"
FT   gene            complement(44375..45643)
FT                   /locus_tag="Sulku_0046"
FT   CDS_pept        complement(44375..45643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0046"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COGs: COG0148 Enolase; InterPro IPR020809:
FT                   IPR000941: IPR020811: IPR020810; KEGG: tdn:Suden_2001
FT                   phosphopyruvate hydratase; PFAM: Enolase-like; PRIAM:
FT                   Phosphopyruvate hydratase; SPTR: Enolase; TIGRFAM: enolase;
FT                   PFAM: Enolase, N-terminal domain; Enolase, C-terminal TIM
FT                   barrel domain; TIGRFAM: phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32714"
FT                   /db_xref="GOA:E4TW98"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW98"
FT                   /protein_id="ADR32714.1"
FT                   /translation="MIFIDEVSAIEVMDSRGNPTVKATVQLSDGTRESAVVPSGASTGK
FT                   REALELRDGDARYMGKGVLKAVENVNSQIADAIMGLSPFNQAMVDAAMKELDGTENYGN
FT                   LGANAVLGVSMAVARAAAKSLGIPLYRYLGGANAMVLPVPMLNIINGGSHADNSVDFQE
FT                   YMIMPIGFDDFSEGLRASSEVYHNLKTILKNRGANTALGDEGGFAPDLSSNEEPIQVIM
FT                   EAIAKAGYKAGEQIAIALDVAASELVTEGGYRLDSENRTVTSAQLVDYYVDLCSKYPIV
FT                   SIEDGLSEDDWDGWKLLTEKLGNKVQLVGDDLFVTNASILAEGIEKGIANAILIKPNQI
FT                   GSVSETMLTVRLAQRNGYKCVMSHRSGESEDAFIADFAVALNCGEIKTGSTARGERTAK
FT                   YNRLLEIETEVMYGEYLGSSLFN"
FT   gene            complement(45640..46680)
FT                   /locus_tag="Sulku_0047"
FT   CDS_pept        complement(45640..46680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0047"
FT                   /product="RecA protein"
FT                   /note="COGs: COG0468 RecA/RadA recombinase;
FT                   InterProIPR020584: IPR013765: IPR001553: IPR020588: IPR
FT                   020587: IPR003593; KEGG: tdn:Suden_2002 recombinase A;
FT                   PFAM: RecA domain protein; SMART: AAA ATPase; SPTR: Protein
FT                   recA; TIGRFAM: recA protein; PFAM: recA bacterial DNA
FT                   recombination protein; TIGRFAM: protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32715"
FT                   /db_xref="GOA:E4TW99"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW99"
FT                   /protein_id="ADR32715.1"
FT                   /translation="MMDPQKLKSLELAMKQIDKTFGKGTLMRLGDKEIEPINSISTGSI
FT                   GLDLALGIGGVPEGRVIEIYGPESSGKTTLSLQITAECQKNGGVCAFIDAEHALDIGYA
FT                   KNLGVDVENLLVSQPDYGEQALDIVETIVRSGAVDLIVIDSVAALTPKVEIEGEMNDQQ
FT                   VGVQARLMSKALRKLTGIMHKMNCTIIFINQIRMKIGTMGYGSPETTTGGNALKFYASV
FT                   RIDVRKIATLKQGESQIGNRVKAKVIKNKVAPPFRQAEFDIMFGEGISKEGELVDYGVK
FT                   LDIIDKSGAWFSFEDVKLGQGRENVKQKFKDEPELARKVEEKIKSAMGVSGIIAMDESD
FT                   ISEVDE"
FT   gene            46854..47717
FT                   /locus_tag="Sulku_0048"
FT   CDS_pept        46854..47717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0048"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2107 periplasmic solute-binding protein;
FT                   KEGG: tdn:Suden_2004 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Putative periplasminc
FT                   binding protein (DUF178)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32716"
FT                   /db_xref="GOA:E4TWA0"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA0"
FT                   /protein_id="ADR32716.1"
FT                   /translation="MKKMVIAHSPDADDIFMYYAIKFGWVGKENTVFENIALDIETLNT
FT                   EALKGTYDITAISFGLYPHIRSDYALLRTAVSFGQGYGPKLIRKKETVLKKRFKVALSG
FT                   KYTTNALLFRIVYPDAKIIYMNFLEIEQAVLDGVVDAGVLIHESILGYDESLEVERELW
FT                   DVWCELSGGDLPLPLGGMAIRRSLPLTSAIEYESVLTKAVQIARDHKETLSKMLMERNL
FT                   VRIDAPTLEKYLELYANDESITLNETQYKAIELLFDLGYKHGFFDAKIDPRDFMLPLEY
FT                   NELRYS"
FT   gene            47719..47988
FT                   /locus_tag="Sulku_0049"
FT   CDS_pept        47719..47988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0049"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="COGs: COG1987 Flagellar biosynthesis pathway
FT                   component FliQ; InterPro IPR006305: IPR002191; KEGG:
FT                   tdn:Suden_2005 flagellar biosynthesis protein FliQ; PFAM:
FT                   export protein FliQ family 3; SPTR: Flagellar biosynthesis
FT                   protein FliQ; TIGRFAM: flagellar biosynthetic protein FliQ;
FT                   PFAM: Bacterial export proteins, family 3; TIGRFAM:
FT                   flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32717"
FT                   /db_xref="GOA:E4TWA1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA1"
FT                   /protein_id="ADR32717.1"
FT                   /translation="MVQSELIGLGIETFKIALILSLPALLVGMFLGLAVSIFQATTQIN
FT                   EMTLSFIPKIIGIVVVIILTMPWMMNEMQDFTIRMFNLIPTFMQ"
FT   sig_peptide     47719..47838
FT                   /locus_tag="Sulku_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            48100..48888
FT                   /locus_tag="Sulku_0050"
FT   CDS_pept        48100..48888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0050"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="COGs: COG0812 UDP-N-acetylmuramate dehydrogenase;
FT                   InterPro IPR003170: IPR011601; KEGG: tdn:Suden_2006
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   domain-containing protein; SPTR:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal
FT                   domain; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32718"
FT                   /db_xref="GOA:E4TWA2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA2"
FT                   /protein_id="ADR32718.1"
FT                   /translation="MLNTKTIDFSKFSSIRIGPIVEVALIENDVVPEGHMIVGSANNVL
FT                   ISPTPPPLMILSKEYDFIRLEDDGLHIGAATPGGRVVSFCKKNDIAHFEYLSKLPGTLG
FT                   GMLKMNAGLKEYEIFNHLIAIRTMSGWKQKNEIEFGYRKTSIHEVVFEAVFEVHPGYSN
FT                   ERYEMFSQMRSNQPNDPSAGSCFKNPPGDYAGRLIEAVGLKGVRQGSMAFSEVHANFLV
FT                   NTGGGTYSDALTLIHEAQKRIKEQFDIDLQCEIVLIDQKI"
FT   gene            48978..49640
FT                   /locus_tag="Sulku_0051"
FT   CDS_pept        48978..49640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0071 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Resolvase, N
FT                   terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32719"
FT                   /db_xref="GOA:E4TWA3"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA3"
FT                   /protein_id="ADR32719.1"
FT                   /translation="MTVSYIRPDKDFDGVYEQLKLINGYADQKGIAINEEMVDQTSQNK
FT                   RLSERHEVVRFFRSLDGDTLIIYDTWTLSSCIEDVVQMFSCLLKNNNTLHFVKPGVIID
FT                   RKSDTMVVLGLIDQLRQILQDDAKKGIGRPRGSKSSSKFDIHLEQIIDLLKKRRSVSEI
FT                   ARVLDVSRSSLKDYIESRELKEVVNGVIGIGNDEDAEATVIGTIRCPIDESQKRENI"
FT   gene            49637..51085
FT                   /locus_tag="Sulku_0052"
FT   CDS_pept        49637..51085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0052"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro IPR017900:
FT                   IPR014116: IPR017896; KEGG: tdn:Suden_2030 4Fe-4S
FT                   ferredoxin, iron-sulfur binding; SPTR: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding; TIGRFAM: cytochrome c oxidase
FT                   accessory protein CcoG; PFAM: Ubp3 associated protein Bre5;
FT                   TIGRFAM: cytochrome c oxidase accessory protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32720"
FT                   /db_xref="GOA:E4TWA4"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA4"
FT                   /protein_id="ADR32720.1"
FT                   /translation="MSNETTPTGKEYLSGWTPWRIKRYWFYGLVTIISLVIPWITINGN
FT                   HLFLLSFDKLKLHLMFVQFDMQELYLMPFLLMILFIGIFGITVLGGRVFCGWICPQTIF
FT                   RVVYRDLIETKLLGLRKRIKNKQQEPDYSKPENKLKRLVAILLWTGLAFIAASDLMWYF
FT                   VPPEDFLAYIQNPAEHTVLIGSILGIVAFLVYDVIFLKENFCVYVCPYSRIQSVLYDDD
FT                   TVMAIYNPNRGGDIYNEHKEKIFTKQNDLLSVNPKAECTTCESCVTVCPTHIDIRKGLQ
FT                   LECINCLECVDACTEVMGKLGKPSLVEWSSEKETLFMKGKTQYFRPKILGYITVLVVVS
FT                   IILAMMGSKKEYMLLNINKENRLYSIHNDDGKVKVENAYTFLLQNTLNEDHDYYFDVVA
FT                   PAGMEGKIKIEEPEEAFTVKPGVVKKKVVVLYTDEILVNDERKDTVIPITINAYAVDAK
FT                   DKVAVTRQSTFTFPRADLLKEEED"
FT   gene            51150..52370
FT                   /locus_tag="Sulku_0053"
FT   CDS_pept        51150..52370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0053"
FT                   /product="HI0933 family protein"
FT                   /note="COGs: COG2081 flavoprotein; InterPro IPR004792:
FT                   IPR013027; KEGG: tdn:Suden_0754 HI0933-like protein; PFAM:
FT                   HI0933 family protein; SPTR: HI0933-like protein; PFAM:
FT                   HI0933-like protein; TIGRFAM: flavoprotein, HI0933 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32721"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA5"
FT                   /protein_id="ADR32721.1"
FT                   /translation="MKTVAIIGGGASGLMAGLFAARAGANVTLYEQNNGVGKKILASGN
FT                   GRCNIINTTSSADDFAGTDPHFVTYALKQLNFTYFEKLCLSMGLVLDIKEDGRCYPLSN
FT                   EAKSVLIALKSAASDAGVHIRTDNSVSDISKKDAQFIVETPTDKKYFDAVLIATGSEAA
FT                   PQLGASADGYRFAEKFGHEIVPTYPSLVQLHLNSKHHHKMAGVKTTAEVTLIIDGKSKE
FT                   KIQGDILFAAYGISGLAILDISQKASYALLNKQRVSISLNLLPRYDRQSLINIVEKLFA
FT                   SVPKHDVHTALCGLMPAKIATYLLDDAGIALSAPVSALNPKEIKKLSHLIGEWKFEVNG
FT                   THGFKHAEVSGGGVSTAQINNKTMESKLVEGLYFAGEVLDIVGKRGGYNFNFAWASGMI
FT                   AGKEMAK"
FT   sig_peptide     51150..51224
FT                   /locus_tag="Sulku_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(52516..54318)
FT                   /locus_tag="Sulku_0054"
FT   CDS_pept        complement(52516..54318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0054"
FT                   /product="GTP-binding protein TypA"
FT                   /note="COGs: COG1217 membrane GTPase involved in stress
FT                   response; InterProIPR005829: IPR000795: IPR005225:
FT                   IPR006298: IPR 004161: IPR000640; KEGG: tdn:Suden_0006
FT                   GTP-binding protein TypA; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain-containing protein; SPTR:
FT                   GTP-binding protein TypA; TIGRFAM: GTP-binding protein
FT                   TypA; small GTP-binding protein; PFAM: Elongation factor Tu
FT                   domain 2; Elongation factor G C-terminus; Elongation factor
FT                   Tu GTP binding domain; TIGRFAM: GTP-binding protein
FT                   TypA/BipA; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32722"
FT                   /db_xref="GOA:E4TWA6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA6"
FT                   /protein_id="ADR32722.1"
FT                   /translation="MQKIRNIAVIAHVDHGKTTLVDGLLKQSGTFGTHEQVNERAMDSN
FT                   ALEKERGITILSKNTAIRYGDHKINIIDTPGHADFGGEVERVLKMVDGALILVDAYEGV
FT                   MPQTKFVVKKMLGLGIKPIVVINKIDKPSADPERVVDEVFDLFVAMDATEDQLDFPIIY
FT                   AAARDGIAKMDMADPDGDFTCMFNTILEKVPEPTGDAANPTQLQVFTLDYDNYVGKIGI
FT                   ARIFNGKIAKGDNILLAKADGEMVKGKISKLIGFLGLNRMEIQEAEAGDIVAVAGIETV
FT                   DVGDTICDPQNPMPLDPMHIEEPTLTVVFSVNDSPLAGQEGKHVTANKIRERLDAEMNT
FT                   NVAMRYETVGEGKFIVSGRGELQITILAENMRREGFEFGIGRPEVIVKEIEGVKCEPFE
FT                   HLVVDLPADFAGTIIERLGRRKAEMKAMVPMGEGFTRVEFEIPARGLIGFRGQFLTDTK
FT                   GEGVMNHSFLEFRPYTGNVESRQYGALISTEDGVALAYSLFNLQDRGVLFTAPQTKVYK
FT                   GMIIGEHSRSNDLDVNPIKGKAQSNVRSSGADEAIKLVPPRDMNLERALEWIEDDELLE
FT                   VTPLNIRIRKRWLDPTDRKRYGKK"
FT   gene            54496..55902
FT                   /locus_tag="Sulku_0055"
FT   CDS_pept        54496..55902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0055"
FT                   /product="Flagellar hook-length control protein-like,
FT                   C-terminal domain"
FT                   /note="InterPro IPR021136; KEGG: tdn:Suden_0029 flagellar
FT                   hook-length control protein; PFAM: Flagellar hook-length
FT                   control protein-like, C-terminal domain; SPTR: Flagellar
FT                   hook-length control protein; PFAM: Flagellar hook-length
FT                   control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32723"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA7"
FT                   /protein_id="ADR32723.1"
FT                   /translation="MIVQSKENKSQGSLVDLLGGNTKNSSAAKSNDLFSKLLASIGIQG
FT                   KGDENKIVKTNDFKAVIDPKNKSAAIPTSTTELKASQMKELQTLLSGKEGKEATLVSTE
FT                   LLENMTNDQMRTLINRAKDYLKNEISAKSPEYQADPKSLPKTLGALVKLAEKLGLEPQS
FT                   ISLATIVNEPEEKASFSNELLSKPLFEAKAIAALPATVMEESAPIEAITQLLSELKNKE
FT                   QKNTKPLSTETSVQEKSDKAETQPLTTLLQAMDKKEEKTASTSVSEKVDPIKIASTPTA
FT                   ATNKTDALIALLKESNDAKEIKSESIKVEGESSKSLHVPKADSLEVKAKEAQQSMRHFA
FT                   SDLKEAVQEYKPPFTRLTMKLNPEKLGEVEVTLVQRGNNVHVNIQSNNANSVAFLAHNA
FT                   TELKAQLASQGIQNATMNFMSGGDSQNQQAGQQQQQGQQQRFRAYESFEELNLNEEQIS
FT                   ALEIIIPHYA"
FT   gene            55918..56592
FT                   /locus_tag="Sulku_0056"
FT   CDS_pept        55918..56592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0056"
FT                   /product="flagellar hook capping protein"
FT                   /note="COGs: COG1843 Flagellar hook capping protein;
FT                   InterPro IPR005648; KEGG: tdn:Suden_0030 flagellar hook
FT                   capping protein; PFAM: flagellar hook capping protein;
FT                   SPTR: Flagellar hook capping protein; PFAM: Flagellar hook
FT                   capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32724"
FT                   /db_xref="GOA:E4TWA8"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA8"
FT                   /protein_id="ADR32724.1"
FT                   /translation="MAINAYGAYTTDAAYTGATTAATNEDKSSLGKDDFLKLLLLELKY
FT                   QDPTSPMDSEKILSQTSQLATLESTENTNKALETLAASLTSSMQYSGISAIGKMADTGS
FT                   NAIVKEKDTSATFEIYFPEKVASGKVNILDSAGKVLRSIEIAETAAGTAQYKWDGKDNG
FT                   GTLLEEGIYYVESTYTKTDGTSATARVGRYPIESIKFEGGTTYAKLGSSYVDFSTIKEI
FT                   TN"
FT   gene            56601..57938
FT                   /locus_tag="Sulku_0057"
FT   CDS_pept        56601..57938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0057"
FT                   /product="flagellar hook-basal body protein"
FT                   /note="COGs: COG1749 Flagellar hook protein FlgE;
FT                   InterProIPR000276: IPR018268: IPR019776: IPR020013: IPR
FT                   001444: IPR010930; KEGG: tdn:Suden_0031 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein; SPTR: Conserved
FT                   domain protein; TIGRFAM: flagellar hook-basal body protein;
FT                   PFAM: Flagella basal body rod protein; Domain of unknown
FT                   function (DUF1078); TIGRFAM: flagellar hook-basal body
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32725"
FT                   /db_xref="GOA:E4TWA9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA9"
FT                   /protein_id="ADR32725.1"
FT                   /translation="MTQGYYTGISGIQANQYGLDVIADNLANTNTVGFRGSSTEFASLF
FT                   SEKLVSSGSAPTYDEIGAGTRLQATTMNTQNGSLLNTDRFNDLAINGNGWFGVVSGQDR
FT                   YFTRAGNFVLDEYQKTDGAANSSVGRLTTTEGMYVTGTMLNNFAYDSQYNYSAKSDVTD
FT                   TGAFKITASLNTVPLTDANEQGPIELPTRLAYPTEPTTSTKFYGNLGTDVAERTMSANA
FT                   ISPSNDQNRIKLVFTQSAVQPDQGVSWDVVATASSNDGTVLYDTQYGTAVFNEGGGLES
FT                   FSLPTINNDGAPVSVDLGSAFGGVISSAGPTISASSQSDGISGGTLNKYSINSDGIIVA
FT                   DFSNGKQSTIGRIAVYHFQNDQGLTRSGSTLFSQSDNSGNPMFWTDANGEAVTGTTISS
FT                   GHLENSNVRMEVGLTDMIVMQRAYQANAKTVTTVDEMIQKALSMRK"
FT   gene            57992..60268
FT                   /locus_tag="Sulku_0058"
FT   CDS_pept        57992..60268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0058"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="COGs: COG1749 Flagellar hook protein FlgE;
FT                   InterProIPR012835: IPR020013: IPR001444: IPR010810: IPR
FT                   011491: IPR010930; KEGG: tdn:Suden_0032 flagellar hook
FT                   protein FlgE; PFAM: flagellar basal body FlaE domain
FT                   protein; flagellar basal body rod protein; flagellin hook
FT                   IN repeat protein; protein of unknown function DUF1078
FT                   domain protein; SPTR: Flagellar hook FlgE; TIGRFAM:
FT                   flagellar hook protein FlgE; flagellar hook-basal body
FT                   protein; PFAM: Flagellin hook IN motif; Flagella basal body
FT                   rod protein; Domain of unknown function (DUF1078);
FT                   Flagellar basal body protein FlaE; TIGRFAM: flagellar hook
FT                   protein FlgE, epsilon proteobacterial; flagellar hook-basal
FT                   body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32726"
FT                   /db_xref="GOA:E4TWB0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR012835"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB0"
FT                   /protein_id="ADR32726.1"
FT                   /translation="MLRSLFAGVTGLQAHQIAMDVESNNIANVNTIGYKYSRANFSDLL
FT                   AQTSQIATAPQGDIGGKNAVQVGLGTTISSVTRIMTQGSIQNTDKNTDVAIQGDGFFIV
FT                   SSDAGSTYKYSRSGDFKFDAAGNFVDNNGFVVQGWVRDEATGKVDSTAPISNINIPPGL
FT                   TTPANATADVVLKANLDSGETVETFNATNSMDSYNLEYASNYAVWQAAGFVPAVGGALP
FT                   APPNAATQALWYSAYTTRNANTNSAENMNVMFNEQGQSLTMQPNQGVWVSYKDSVTTIP
FT                   MVSAAGAFTFTLNGTTISGTTSGVTLADDAATVQQAINAQTANTGVSATVVGSNLVLTN
FT                   DNSRDSDGSATKNIVITGSNAGALALGFTNQSVITAYKYTYTTNAADATPLINSYAVPT
FT                   TSVPPADSNFTTTEQLRLLMETHAQYVSGSDPAGTVAPAGVNFATGIKIIINDRGQFEV
FT                   SNLSDGDANQENLKLQVTGYSDPAANVTKNERFTALMQSINGTVVEGSTGIRLSQSMNA
FT                   ATHSASIDVYDSLGSKHTLKMDFRKTSVDVVSGSTWSMKLSVPEPGEINTIAPINEFNG
FT                   QVRFGPDGALSSYTPTNITYTANNGSSPNQTINIKLGTANAFDGVTSFDATSGTSGISQ
FT                   DGFPGGDLVGIRIDQSGTLVGSFSNGRSFGLAQMGMAKFTNNEGLVSDGGNVYLQSANS
FT                   GDPIIGTAATAGRGFMQSSSLEASNVDLSKSLTQLIIIQRGYQANGKTITTSDTLLETL
FT                   LGIKR"
FT   sig_peptide     57992..58072
FT                   /locus_tag="Sulku_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            60578..61084
FT                   /locus_tag="Sulku_0059"
FT   CDS_pept        60578..61084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0059"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tdn:Suden_1918 RDD
FT                   protein; PFAM: RDD domain containing protein; SPTR: RDD
FT                   protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32727"
FT                   /db_xref="GOA:E4TWB1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB1"
FT                   /protein_id="ADR32727.1"
FT                   /translation="MRWRTLKQTNKIKTPVKPKIDYAPFWSRAAGFATDIFMIGLPISL
FT                   ITMMMFGYDQMHTAGGLDVLVHDPKAQTNPPNPIASLLQIALFLITYVWFWHKSGQTPG
FT                   KKLARIRVVDAKTMDNASYWKLSLRFIGYFFSFITLVGFFIGLLRKDKRALHDLISGTA
FT                   VIRVP"
FT   gene            61044..62192
FT                   /locus_tag="Sulku_0060"
FT   CDS_pept        61044..62192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0060"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: tdn:Suden_0045 putative
FT                   MFS metabolite transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Putative MFS metabolite
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32728"
FT                   /db_xref="GOA:E4TWB2"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB2"
FT                   /protein_id="ADR32728.1"
FT                   /translation="MISSAAPPLYASPNVAVLIASFYFFYFALIGVHIIFVPKILSEVG
FT                   YSPMEIGIIFASAPLVRFAIPFLFLKGLRLSRKTFFTALALMGLSAAGFYGALEHFWPL
FT                   LIVNIFFGIGIALILPYIEVIALEQIGRERYGRIRLFGSLGFIAVSLVLVRFLSTPYIG
FT                   IGFLIAMALITLIFGAIIGKHPHSDSSSDCGSGDELCLFSIRNHIPLWIGFFLMQVSFG
FT                   PFYNFFTIYTTAHGISLDTTVWLWSFGVIAEILMFYFQGPLLRGNLERLLQLTALITAL
FT                   RWTIVALFPDSTPLLFASQSLHAFSFALFHTTAITLLFELYSARRLSQQFFFGISYGLG
FT                   GFIGAIGAGALYQYTPSLLFIGGAIGALGAALAFRLDKKLRF"
FT   gene            complement(62199..63020)
FT                   /locus_tag="Sulku_0061"
FT   CDS_pept        complement(62199..63020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0061"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="COGs: COG0668 Small-conductance mechanosensitive
FT                   channel; InterPro IPR006686: IPR006685; KEGG:
FT                   cff:CFF8240_0390 MscS mechanosensitive ion channel; PFAM:
FT                   MscS Mechanosensitive ion channel; SPTR: MscS
FT                   Mechanosensitive ion channel; PFAM: Mechanosensitive ion
FT                   channel; Conserved TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32729"
FT                   /db_xref="GOA:E4TWB3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB3"
FT                   /protein_id="ADR32729.1"
FT                   /translation="MLQKMEYYTERALEYATDYGVKILGALAIFFIGRWIIRKIIVLMR
FT                   KAMEKSRVDETLISFSANALYVALMIALIVAAASNIGINTTSFVAVFGAAGLAIGLALK
FT                   DTLANVGAAVLIIFFRPFKVGDFIEVSGVMGTVKAINLFSTTLTTADNRSIIIPNGALI
FT                   AGNIINYTGNEKRRIDMVFDIDYKDDLKLAKEVIMNVLISNPKVLADPAPVVAVGALAQ
FT                   NSVQIFARPWVAVEHYWDGMFEMTEAVKLEFDKNGISIPFPQMVTHVKQED"
FT   gene            complement(63033..63653)
FT                   /locus_tag="Sulku_0062"
FT   CDS_pept        complement(63033..63653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0062"
FT                   /product="nitroreductase"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro IPR000415;
FT                   KEGG: sun:SUN_0921 NAD(P)H-flavin oxidoreductase; PFAM:
FT                   nitroreductase; SPTR: NAD(P)H-flavin oxidoreductase; PFAM:
FT                   Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32730"
FT                   /db_xref="GOA:E4TWB4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB4"
FT                   /protein_id="ADR32730.1"
FT                   /translation="MSEFTEAMAFRHACKKFDIEKQIPQEEFDALLEVARMSPSSFGME
FT                   PWRLIVVRKPALRKALKSACWNQNQITECSELVVFTTDNDTVRSGTPYVRKMFERRGLP
FT                   QDAVDTYMGVYKNYLEPIECDEVLLENWTAKQCYIAMSNMMTYAATLKIDSCPIEGFDK
FT                   ESVEAILDLEYGHSVAVICAFGYRVNPQSEQKRLELKQIVQYR"
FT   gene            complement(63725..64087)
FT                   /locus_tag="Sulku_0063"
FT   CDS_pept        complement(63725..64087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0063"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000209; KEGG: tdn:Suden_0048
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF309)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32731"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB5"
FT                   /protein_id="ADR32731.1"
FT                   /translation="MATEPTGITESCEAFVLSISEGRYYDAHEDLEPLWYPRRFEDNNE
FT                   VRLWKGFINAAVSFELAKRGRKEASAKAWQTYLKYFSLLENLVTPHKELYVKIAKLLEK
FT                   KHGMLCASAALSRTQR"
FT   gene            complement(64063..64371)
FT                   /locus_tag="Sulku_0064"
FT   CDS_pept        complement(64063..64371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0049 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32732"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB6"
FT                   /protein_id="ADR32732.1"
FT                   /translation="MVDLSVDEWTQEEFLHNKQALESQGIKVLLIDTILSPIDGIETTL
FT                   YAPPLLKNEPEGSVFVFYCDTGKSSKERLKEFRAKFPNHVCISLRGGRGYWRRNLRV"
FT   gene            64454..67276
FT                   /locus_tag="Sulku_0065"
FT   CDS_pept        64454..67276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0065"
FT                   /product="helicase domain protein"
FT                   /note="COGs: COG1204 Superfamily II helicase; InterPro
FT                   IPR014021: IPR001650: IPR014001; KEGG: tdn:Suden_1967
FT                   helicase-like; PFAM: helicase domain protein; SMART:
FT                   helicase domain protein; DEAD-like helicase; SPTR:
FT                   Helicase-like protein; PFAM: Helicase conserved C-terminal
FT                   domain; Mitochondrial degradasome RNA helicase subunit C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32733"
FT                   /db_xref="GOA:E4TWB7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041082"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB7"
FT                   /protein_id="ADR32733.1"
FT                   /translation="MAKKKKKMIKLNQSIRHFFGDEGFDEGIERVPTDVLVALAHTLGV
FT                   FNGTTDKTGLIKTFRRIWSEGESDNREMIVSFFKHEGKIYPNPKPKEKPHEREEKINEM
FT                   LEGFDITPEERRALHASFIDIRTRKITPEKIASKLEHIRYTRKREQLEKALEGKFNFDD
FT                   SLEYYASITYHIDTEIFTKIHILKTAPLNEKRLHEESIEVLVPEITELKTALTTQKQEQ
FT                   TNLFLSSLNLSDHRYLTKEQIIASLKSAPPSTQTYGTLSVEILRDVLARHLHTPLTSVT
FT                   NDDLIVEIDKQLHLPHRIEPLEYTLSLHLDIHELSRQIWNEEELTITTMVEEQSIQEER
FT                   IFLQELEHLVEECRTRSKLLEIDDESLYEIVYELLLPYLTLTPHISSKTSRRVLFAYDQ
FT                   RIAGELLKRQRQALLARTVRDFKNLFPLARSLRRRLIFHTGPTNSGKTYTAFQQLKKAG
FT                   TGYYLAPLRLLALEGYENLREQGVSASLITGEEQLLDEDATHISSTIEMLSFESEVDCC
FT                   VIDEVQMIDDRDRGWAWANAIIGAPAKTVIMTGSPNAKEAIIALAEYLGEPLEIIEFER
FT                   KNPLELLKSPTPITAIEPKTAVIAFTRSNALRLKQQLSKTYRTSVIYGNLSPEVRREEA
FT                   RRFREGETDILVATDAISMGLNLPIKTLLFSKADKFDGQNQRNLTATEVRQISGRAGRY
FT                   GLSEKGYVGALTADVLKTISSLFTKAIEPIVLPFNVMANFDHIMLVSNILEEKSLSNIV
FT                   DFFVRNMKFEGPFRAANLESMQEASAIVDRYDLDMRTKYTLATAPLSTSSPLVMAAFER
FT                   YVRALEQKKPIAYIPPQRLGLHALSMEELQEAEDRIKEISLYLWLSYRLGEFFVDAEKA
FT                   RTFRGELNRFIENSLQQSHFVPRCKTCGKPLAPNAEFSICQSCFNNLNRSKAQQARSNP
FT                   AEKKYSSKRR"
FT   gene            complement(67262..68266)
FT                   /locus_tag="Sulku_0066"
FT   CDS_pept        complement(67262..68266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0066"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro IPR006674:
FT                   IPR003607; KEGG: ant:Arnit_2276 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: HD-GYP domain; PFAM: HD domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32734"
FT                   /db_xref="GOA:E4TWB8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB8"
FT                   /protein_id="ADR32734.1"
FT                   /translation="MDVRKVRIVRRHDERPNIMYVEIEKWLLDIGDVLEFDLFMAEGKL
FT                   TEKTLLLSKHIPINSDIKIEIDSRHAIYVRQSDLEAYNIFVDKIAQAVARNEHIPVIKK
FT                   AAIIYRQASVILDEMFENPEELENVPKTKKVVNTFVNTIFSDTHAIESMIKITAYDYYT
FT                   HTHSINVCIYSLSLGSYLELNSITLQELGMSALLHDLGKSRVDPKITNKKGRLTEDEFD
FT                   EMKHHPLYGHTIALKIGIRDNRILDGIRHHHEKLDGSGYPDGLMGNSITLFARIIAVCD
FT                   VFDALSTQRSYKERMSSYDTLLLMKKTMQHHLDMVLVDSFIKMQQHSDALTAL"
FT   gene            complement(68273..68896)
FT                   /locus_tag="Sulku_0067"
FT   CDS_pept        complement(68273..68896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0040 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32735"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB9"
FT                   /protein_id="ADR32735.1"
FT                   /translation="MKKMTIADAAEYFNVSKEAIHNRIRRGSLDCIVDNGVKYVAVESA
FT                   KSGTSTTVASDARYTQYIEQENERLREKVDVLEKETNRLRDQREQMLIDERIKVEQIYK
FT                   ERDAQLRSVLHVVATKFLAHASVDAVMEEAKGVDAINADVVEGNEEEWVSLKSFLKLKR
FT                   YSDKEKKKIKNRFEALRENDIRLTVREGKIFLNPSEYDYSDLLR"
FT   gene            complement(68893..69846)
FT                   /locus_tag="Sulku_0068"
FT   CDS_pept        complement(68893..69846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0068"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro IPR006674:
FT                   IPR003607; KEGG: ant:Arnit_2276 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: HD-GYP domain; PFAM: HD domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32736"
FT                   /db_xref="GOA:E4TWC0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWC0"
FT                   /protein_id="ADR32736.1"
FT                   /translation="MKQKKYKRIDKRLITEGSQIDFNLFLTNETKTHMTLFLQSDSAVD
FT                   GNAKVRLREIETLYISEEEEDRYKVFVDKQLQSIARNREISTEQKARLVYEKATEAIDS
FT                   MFKNPESLENVKNVQPVVNSFIEIILNDSSAVESLMKITAHDYYTHTHSINVSIYTLSL
FT                   GAFLGISGKELEVLGMAAVLHDLGKSKVDYEIINKNGKLTDEEFAQMKHHPSLGHEIAL
FT                   ALGITDERILTGIRHHHEKIEGGGYPDNLKGDQISQFARIIGTCDVFDALSTKRSYKDP
FT                   MTSFESLQLMKQQMVGHLDMDIVNSFIKMLHKQGKS"
FT   gene            complement(69856..70353)
FT                   /locus_tag="Sulku_0069"
FT   CDS_pept        complement(69856..70353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0069"
FT                   /product="protein of unknown function DUF520"
FT                   /note="COGs: COG1666 conserved hypothetical protein;
FT                   InterPro IPR007551; KEGG: tdn:Suden_0039 putative
FT                   nucleotide-binding protein; PFAM: protein of unknown
FT                   function DUF520; SPTR: UPF0234 protein Suden_0039; PFAM:
FT                   Protein of unknown function (DUF520)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32737"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWC1"
FT                   /protein_id="ADR32737.1"
FT                   /translation="MASEHSLDISAKIDLQAFKDAIAQAEKEVIGRYDFKGITYEINYR
FT                   EKEKQLILLASSDNKLDALKDIVIGKLIKRGLSSKALNELKTEDASGGARKATYKIVDT
FT                   IDAKEAKKIVAEIKNLKTKATAQIEGEHIRVKSKQIDELQKIMAAIKGMEWEAPLVFDN
FT                   FR"
FT   gene            complement(70408..71109)
FT                   /locus_tag="Sulku_0070"
FT   CDS_pept        complement(70408..71109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0070"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterProIPR006058:
FT                   IPR017900: IPR004489: IPR001041: IPR 017896; KEGG:
FT                   tdn:Suden_0038 succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur protein; PFAM: ferredoxin; SPTR: Fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; TIGRFAM:
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32738"
FT                   /db_xref="GOA:E4TWQ7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ7"
FT                   /protein_id="ADR32738.1"
FT                   /translation="MNISIKRSNNDEVQIYNVELENTTLLAVLNYIKTKIDPTLTYSHG
FT                   CRSGVCGSCAVRVNGREQLMCEYKPKDGDVIEPIRNTRVIRDLVVDTAFVERFNQAGEA
FT                   WIGSAREENISVEEMERIETQSDCILCTSCFSACPVYAVNPDFIGPFALTRVWRYVNDP
FT                   REGDSSAKIAAVQTNGIWDCTLCGECVPVCPQGIAPKQDISMLRTKSAMAGYSDPNMSF
FT                   GGGLDFGSPMF"
FT   gene            complement(71109..71264)
FT                   /locus_tag="Sulku_0071"
FT   CDS_pept        complement(71109..71264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pvx:PVX_081400 patched family protein; SPTR:
FT                   Patched family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32739"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ8"
FT                   /protein_id="ADR32739.1"
FT                   /translation="MRGFYTMNEDISVLGDDKTWNDEKESDWNGRCEDVSEEDDDEEDE
FT                   EREWCD"
FT   gene            complement(71243..72844)
FT                   /locus_tag="Sulku_0072"
FT   CDS_pept        complement(71243..72844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0072"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR013027:
FT                   IPR003953: IPR004112; KEGG: nis:NIS_0006 succinate
FT                   dehydrogenase/fumarate reductase, flavoprotein subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; PRIAM: L-aspartate oxidase;
FT                   SPTR: Succinate dehydrogenase flavoprotein subunit; PFAM:
FT                   domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32740"
FT                   /db_xref="GOA:E4TWQ9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ9"
FT                   /protein_id="ADR32740.1"
FT                   /translation="MSKVLIVGSGGAGLVSALSATESGAKVIVASKTLPTRSQTSMAQG
FT                   GMNAVFGSEDSIENHIADTLRSSAGLGEEGRIALMCEKAPEAVRWCNTIGLPFSRDEKG
FT                   EIARRTLGGASAPRACYAQDYTGLKLLHTLYDQCLKAGIEFRNDRFLLNLIVDQETNRA
FT                   LGATFLHIETGEVEEIRADAVILATGGYGALYGKHSTNSVQATGDGLAAAVRAGARLAD
FT                   MEFIQFHPTALKNSSILISESARGAGGYLVDSEGERFTDELAPRDVVARAIHDEMAKSG
FT                   AVYLDIRHLGEDFINHELPQERKLAQIYEGIDPVHELIPIKPSAHYSMGGIEVNEKCMT
FT                   SVSALFAVGECANHKTHGANRLGGNSLLELVVFGRECGKNAAEYGALHPAPVLENMQLA
FT                   KDTNFVRGVMYFTNQIDFYQKQEMLANIFYNNVGLVRDDMGLKAVLGAIRQMQKELPFM
FT                   GPRDKSKVCNTNLVEFIEFGNKIELAEIIVVSAISRVESRGAHYRLDAPERNDRMFGAH
FT                   TITWKEDGVLCADFIQ"
FT   sig_peptide     complement(72770..72844)
FT                   /locus_tag="Sulku_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(73010..73267)
FT                   /locus_tag="Sulku_0073"
FT   CDS_pept        complement(73010..73267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0073"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829; KEGG: mbr:MONBRDRAFT_34030
FT                   hypothetical protein; SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32741"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR0"
FT                   /protein_id="ADR32741.1"
FT                   /translation="MKKFFCVLLLVGFIGASANDALKAEVAAWLQGLDGGAQKAKYDSL
FT                   SPEKQAALDKFFEECRADVASGKSPKGTCKPLFLEKLKAL"
FT   sig_peptide     complement(73196..73267)
FT                   /locus_tag="Sulku_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            73396..74301
FT                   /locus_tag="Sulku_0074"
FT   CDS_pept        73396..74301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0074"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   tdn:Suden_0341 auxin efflux carrier; PFAM: Auxin Efflux
FT                   Carrier; SPTR: Auxin Efflux Carrier; PFAM: Membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32742"
FT                   /db_xref="GOA:E4TWR1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR1"
FT                   /protein_id="ADR32742.1"
FT                   /translation="MQTLFSILGIYLFIAVGFGAKWAFKEKIDDRTITLLSVYFLQIFL
FT                   TFWGLLKRPIDTELLFAPSLYLAITLLALLLMIPLAKMLFHNPKERSIATVAALIGNTG
FT                   NLGIPLGIALFGEMSVPFLTLINLVNVFVVYTIGVFYYSRGEFSVRDSLLNILKLPVLW
FT                   AAMIAIALNLVGYVPSPAVDKTLMMGAYASMTMQLVLFGIYLYGIKLGEINLRLTAWVN
FT                   GTKFILIPLIAFGVLHYVDMEPVVKGILFLELIVPLAVANVNLASLYHCSPRTVTVEVF
FT                   TTSVVFLGIALILPTLLRMF"
FT   sig_peptide     73396..73452
FT                   /locus_tag="Sulku_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74279..75208)
FT                   /locus_tag="Sulku_0075"
FT   CDS_pept        complement(74279..75208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0075"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR006140: IPR006139; KEGG:
FT                   tdn:Suden_0034 2-hydroxyacid dehydrogenase; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region;
FT                   SPTR: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD binding domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32743"
FT                   /db_xref="GOA:E4TWR2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR2"
FT                   /protein_id="ADR32743.1"
FT                   /translation="MKIVILDALTYSDTSLEGFESLGDVAVYQTTFSDETTERVCDAEV
FT                   IVTNKVVINDAVMESAPNLKLICVAATGTNNIDHEAAKRRGIAVKNVAGYSTDAVVQHT
FT                   FSMLFYLMGHSRYYDEYVKSGAWQREAVFAHIGPSFSELRGKTWGIIGLGEIGRGVARV
FT                   AQAFGANVCYYSTSGKNDNGEYEKTTLSRLIENSDVISIHAPLNASTENLISHSELLQM
FT                   KDGAVLLNLGRGGIVDEDALSVIIDVKPIFVGLDVLAKEPMKTSHPLLSVKHPERLYIT
FT                   PHIAWTSREARERLIASTIENIKTFVKA"
FT   gene            complement(75343..76506)
FT                   /locus_tag="Sulku_0076"
FT   CDS_pept        complement(75343..76506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0076"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="COGs: COG0027 Formate-dependent
FT                   phosphoribosylglycinamide formyltransferase (GAR
FT                   transformylase); InterPro IPR005862: IPR011761: IPR003135;
FT                   KEGG: tdn:Suden_0033 phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; SPTR:
FT                   Phosphoribosylglycinamide formyltransferase 2; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase 2; PFAM:
FT                   ATP-grasp domain; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32744"
FT                   /db_xref="GOA:E4TWR3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR3"
FT                   /protein_id="ADR32744.1"
FT                   /translation="MLFSAPLKNNSKKIMLLGSGELGKEVAIEAQRLGIEVIAVDRYNH
FT                   APAHLVANRSHVVNMQDKEAVLKLIRKEKPDYILPEIEAISIDALFAAEAEGFCVIPNA
FT                   EAVNKTMNRKNIRRFAAEDLGLKTSRYHFVSTYEDMCASAEDVGFPCVIKPVMSSSGHG
FT                   QSIARTREDLAASWEIAKEARGDASELIVEEFIRFDYEITLLTARNGVETVFCEPIGHI
FT                   QKDGDYIYSWQPMEMSKKALKRSQKIAKAITDGLGGKGLFGVELFVAGDEVYFSEVSPR
FT                   PHDTGMVTLITQSQSEFALHVRAVLGLPLGFTFYGDGASAAFKSVVESTEPVVDVADEV
FT                   FDDNSFVRVFGKPEAHVGRRMAVVLVFDKVNKAMKKAKKLIKKIKDA"
FT   gene            complement(76618..76830)
FT                   /locus_tag="Sulku_0077"
FT   CDS_pept        complement(76618..76830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0077"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="InterPro IPR018278: IPR001911; KEGG: tdn:Suden_0022
FT                   30S ribosomal protein S21; PFAM: ribosomal protein S21;
FT                   SPTR: 30S ribosomal protein S21; TIGRFAM: ribosomal protein
FT                   S21; PFAM: Ribosomal protein S21; TIGRFAM: ribosomal
FT                   protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32745"
FT                   /db_xref="GOA:E4TWR4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR4"
FT                   /protein_id="ADR32745.1"
FT                   /translation="MPGIILRQDDNFDAAYRRFKKQTDRNLIVTEARARRNHVTETEKR
FT                   KQFKISARKKMLKRLYMMRRYESRL"
FT   gene            76950..78614
FT                   /locus_tag="Sulku_0078"
FT   CDS_pept        76950..78614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0078"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: cco:CCC13826_1039 protease HtpX;
FT                   PFAM: chemotaxis sensory transducer; SMART: chemotaxis
FT                   sensory transducer; SPTR: Methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32746"
FT                   /db_xref="GOA:E4TWR5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR5"
FT                   /protein_id="ADR32746.1"
FT                   /translation="MHPRKTLMWLVFIGMMIPPVVWILLLAFSHLFSVDELISILFSIP
FT                   MALYMAVATSAMIFGFNHALIRIETLMKNPNRSEEAAAIVSKLPYWFLIGQLLYTSIGP
FT                   AVVLSGKSFISLERFGLAEAAVLPLLLLFIIPVFILFVIRLEEWVVSVPLSEKYPFVSF
FT                   GRKMVLAIFTTVLGNIILLVLLNTILLYSIPGLDLSTLLIKNSIVAVIGIVISAVNIAL
FT                   LVAQVTRPVKNLTDNLKTDLFNLTKSFSGFTRDETGSMMSCLNRFVGEIEHSISHAKEI
FT                   ASANLSSAQTLDTINTHIKSRVHESNSITQTTSDQAHSIQTIVNEGVENFTVTLENMNN
FT                   AVGLLHHGRQELSTLLDTISHSTELETELSSKLDQLNGEASQVQKILSVIGDIAEQTNL
FT                   LALNAAIEAARAGEHGRGFAVVSDEVRKLAERTQKSLTEINATINVIVQSIADATEQMH
FT                   LNAKAMQNLTMISQRVDKDINETVSAMENTNMLTKQSVTNSQTIANHINSMLVQMEKLG
FT                   TISSANDTSMRELSDIVSQIASSANALYTQLGQFKTH"
FT   sig_peptide     76950..77030
FT                   /locus_tag="Sulku_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            78643..80286
FT                   /locus_tag="Sulku_0079"
FT   CDS_pept        78643..80286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0079"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COGs: COG0358 DNA primase; InterProIPR006295:
FT                   IPR002694: IPR013264: IPR006171: IPR 006154; KEGG:
FT                   tdn:Suden_0023 DNA primase; PFAM: DNA primase catalytic
FT                   core domain; TOPRIM domain-containing protein; SMART:
FT                   Toprim sub domain-containing protein; SPTR: DNA primase;
FT                   TIGRFAM: DNA primase; PFAM: Toprim domain; DNA primase
FT                   catalytic core, N-terminal domain; CHC2 zinc finger;
FT                   DnaB-helicase binding domain of primase; TIGRFAM: DNA
FT                   primase, catalytic core"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32747"
FT                   /db_xref="GOA:E4TWR6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR031988"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR6"
FT                   /protein_id="ADR32747.1"
FT                   /translation="MITQDSIEALKARLDIVDIVGSYIELKRAGSSFKAPCPFHDEKSP
FT                   SFVVNPSRQSYHCFGCGVHGDSIKFVMEFEKLNYPEAIEKLAASTNFTLHYTDNAQQKK
FT                   RSTLLESLNDWYQKLLEQNRTAQEYLHERGIYASSIERFGIGYAPTSPETLRFLEQRKL
FT                   PTAEAIEQGAIGRGDDGRLFARFIERITFPIHSTSGAIVGFGGRTITGHQAKYVNSSQS
FT                   AIFNKSRLLYAYHLAREAIYRRREIIVTEGYLDVVMLHQAGFTHAVATLGTALTAEHLP
FT                   LLRKGEPKVYVAYDGDKAGRAAAFKAAKLLSTSGFDGGVILFEGGLDPADMIKSGQIEQ
FT                   LNALLHRPIPFIEFVITEMISAYDLQDPKAKETALHENIAFLKTLSPLLQEEYRPFIAS
FT                   KLGISPSLIQIGQKKNTVPQPINFSHHDIWELSFIKTLLERPHIADTLLDFIDASLLQY
FT                   HVQEFESALQGRNDDPRLSALMMDDRIRTFEGDEGLRAELITFLSAHYNRELKKVTTQN
FT                   TVSFDQKSYLIRQYRDKIERLKRGELVPLG"
FT   gene            80435..81406
FT                   /locus_tag="Sulku_0080"
FT   CDS_pept        80435..81406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0080"
FT                   /product="Queuosine synthesis"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR018317;
FT                   KEGG: tdn:Suden_0026 thiamine biosynthesis protein:ExsB;
FT                   PFAM: Queuosine synthesis-like; SPTR: Thiamine biosynthesis
FT                   protein:ExsB; PFAM: Thiamine biosynthesis protein (ThiI)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32748"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR7"
FT                   /protein_id="ADR32748.1"
FT                   /translation="MKAIALFSGGLDSTLAAKLIIDQGIEVIACNINTGFGSTKDRLAH
FT                   MKNMCEQIGAEFRSVDIRDEYIREVLFTPKYGYGKNFNPCIDCHAKMFEVAKRVMEEWG
FT                   ASFLISGEVLGQRPMSQNSESLQKVLNLSNCEGLLLRPLSAKALTPTIPETEGWVDREK
FT                   LENINGRNRERQMELAEQFGLKDYEAPGGGCLLTDENFSNKIRDFIAHDTFSVEDIPTL
FT                   KYGRQLRLPEGAKLIIGRNAEDNAVLEAIENSKFIHIRTELVGPHAMLSRTATDNDKTL
FT                   AAKLVLAYCKAGFEGEQTLMFGDEELTAVSDLSRNDAQKYFI"
FT   sig_peptide     80435..80482
FT                   /locus_tag="Sulku_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(81525..81788)
FT                   /locus_tag="Sulku_0081"
FT   CDS_pept        complement(81525..81788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0081"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="InterPro IPR017969: IPR006121; KEGG: bam:Bamb_4827
FT                   heavy metal translocating P-type ATPase; PFAM: Heavy metal
FT                   transport/detoxification protein; SPTR: Cation transport
FT                   ATPase; PFAM: Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32749"
FT                   /db_xref="GOA:E4TWR8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR8"
FT                   /protein_id="ADR32749.1"
FT                   /translation="MKKVLLTLCALVAVASADQLVNLKIDGMMCPACVKNVKGSLADVK
FT                   GVKESTVYLKEGKAEVKAADSTKADSLCDAVKKAGYGCTVTK"
FT   sig_peptide     complement(81738..81788)
FT                   /locus_tag="Sulku_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            81912..82601
FT                   /locus_tag="Sulku_0082"
FT   CDS_pept        81912..82601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0082"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2836 conserved hypothetical protein; KEGG:
FT                   sdl:Sdel_1922 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32750"
FT                   /db_xref="GOA:E4TWR9"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR9"
FT                   /protein_id="ADR32750.1"
FT                   /translation="MHGIEWWLIISIAFAGSFGHCIGMCGGFIVAYSSTKIDATMSRSA
FT                   QLIRHSAYNIGRVSSYVLLGMIFGTIGSLFALSMEMHGALFIFAGIIMIVTALGMFGLS
FT                   KLIHVLERGFSSNPLFKTLFSRLIKSKSIGSFFALGVMNGFFPCGFVFFFAAKAAASAS
FT                   IIDGGLIMAAFGLATVPTLLALGQSVSFFKEIAFRQTMNRIAALAILIYGLYSVYYGLA
FT                   YFFNLPI"
FT   sig_peptide     81912..81968
FT                   /locus_tag="Sulku_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(82615..83406)
FT                   /locus_tag="Sulku_0083"
FT   CDS_pept        complement(82615..83406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0083"
FT                   /product="putative signal transduction protein"
FT                   /note="COGs: COG1639 signal transduction protein; InterPro
FT                   IPR013976; KEGG: sdl:Sdel_0866 metal-dependent hydrolase
FT                   HDOD; PFAM: Metal-dependent hydrolase HDOD; SPTR:
FT                   Thiamine-phosphate kinase; PFAM: HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32751"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS0"
FT                   /protein_id="ADR32751.1"
FT                   /translation="MLEEIKSLPPLPISVVRIQEICMSNDTDIDELSRVIEHDPMLSAN
FT                   ILKSVNSPLYGMSKEISSVHQAVMLFGISMIRGFAAASAIKKSIIIDLSSYSVTIDDLT
FT                   KVSALQTALAREWYRNVDKSMLPLLQSSAFLMELGKLVASLKIISSGNLADFISDIAEG
FT                   KSVEETERKYLESSSYEIAAIMFEHWNFEPALIDALREITDPSTQNPYSRALRAITQAV
FT                   NFQEIFSEQSLSAALATIEEFGLNKDAFEEAVLTVKAAQKE"
FT   gene            83545..83970
FT                   /locus_tag="Sulku_0084"
FT   CDS_pept        83545..83970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0027 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32752"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS1"
FT                   /protein_id="ADR32752.1"
FT                   /translation="MAGVMFSFYNFASLLDLNIGLSDRLDENRSESFTLLYCDFSNIPK
FT                   TLVESNLQSLLRTSDSIVHWEHYYFFVMPYTDRYGCGIVKKMIEEIFDRPIPSAAVCYP
FT                   VDGENPAELFEALHAEAKKLLNIDLDCLYSAENREVW"
FT   gene            complement(83975..84598)
FT                   /locus_tag="Sulku_0085"
FT   CDS_pept        complement(83975..84598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBN0060 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32753"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS2"
FT                   /protein_id="ADR32753.1"
FT                   /translation="MKKLALIMMFSVTSVVLNAEEYTIQTISTLKESSITPAFEKKVEK
FT                   TSLHATKKKEGECNIVTVGSYKSVKEAHVDLKKAKVIAKDAFIRPIARTTPKVCETHTA
FT                   TAKVPSKEKKGEKAVSSVQAITATKEEAIAAVHEAVTPSTVATADAHTGTIMPSQTTKE
FT                   IQTPNNSPVFVYDRNLARKSDIQEAIEYYKRSPYYSFKPVLSLR"
FT   sig_peptide     complement(84542..84598)
FT                   /locus_tag="Sulku_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            84706..84781
FT                   /locus_tag="Sulku_R0001"
FT   tRNA            84706..84781
FT                   /locus_tag="Sulku_R0001"
FT                   /product="tRNA-Ala"
FT   gene            84863..85387
FT                   /locus_tag="Sulku_0086"
FT   CDS_pept        84863..85387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0086"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: sun:SUN_1805 peptidyl-prolyl cis-trans
FT                   isomerase; SPTR: Peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32754"
FT                   /db_xref="GOA:E4TWS3"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS3"
FT                   /protein_id="ADR32754.1"
FT                   /translation="MKLSYALASLVLSSTLALAAPATLATVNGKAITSSDANAFMAKAI
FT                   PGMSFEKLDPKMKRQVVDQLINQMLVKDQVLKSGLQNTPAFKAQYAAIKDDLAVDMWMK
FT                   QQMNKITVTEKEAKAFYDANGDKMKQGDKKLSFEQVKKEILQFIKVEKFKAQMNKTTDA
FT                   LRSSAKVEVKL"
FT   sig_peptide     84863..84955
FT                   /locus_tag="Sulku_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            85403..86092
FT                   /locus_tag="Sulku_0087"
FT   CDS_pept        85403..86092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0087"
FT                   /product="TonB family protein"
FT                   /note="InterPro IPR006260: IPR003538; KEGG:
FT                   cco:CCC13826_0392 ATP-binding protein; SPTR: Protein TonB;
FT                   TIGRFAM: TonB family protein; PFAM: Gram-negative bacterial
FT                   tonB protein; TIGRFAM: TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32755"
FT                   /db_xref="GOA:E4TWS4"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS4"
FT                   /protein_id="ADR32755.1"
FT                   /translation="MRSANSFFISVGIHLSLAALMIGTLSAVRKNTPAAEEKMVLNLLT
FT                   QTPAPKFPEPVAKPQPPVQPKVPLPAVKPPEARPVPQPKKTVTEQSKPFMNTPVQTAPL
FT                   APNVSSVPPARVTEQPIQPQAIKAVPPAQKQQERYEEENLGRIRSILMERLTYPKNALR
FT                   LKQEGEATVTFTFEPDREVSQISITKSSGFDLLDEAAKNLIISSASEFPKPSKTVRISV
FT                   PIAYKLR"
FT   sig_peptide     85403..85507
FT                   /locus_tag="Sulku_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(86096..86491)
FT                   /locus_tag="Sulku_0088"
FT   CDS_pept        complement(86096..86491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0041 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32756"
FT                   /db_xref="GOA:E4TWS5"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS5"
FT                   /protein_id="ADR32756.1"
FT                   /translation="MITANLVLTMIGLLFLLIGLVALYVWIGKSKTHAVLTPTTIETFE
FT                   SLSEIIKNRSSSSRELHHAVDMILKRFGSINAHTINQYQYLLEALCVHPHTDSKLILRF
FT                   EKTLRTNNPDYSNVIEKSLASGLAKRG"
FT   sig_peptide     complement(86390..86491)
FT                   /locus_tag="Sulku_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            86637..87887
FT                   /locus_tag="Sulku_0089"
FT   CDS_pept        86637..87887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0089"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3174 membrane protein; KEGG: sun:SUN_2184
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: MgtC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32757"
FT                   /db_xref="GOA:E4TWS6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS6"
FT                   /protein_id="ADR32757.1"
FT                   /translation="MDSLFIQNSILSLVLGFLIGLQREMHTIYLHKAKDFGGARTFSMI
FT                   AFFGYLSAWFSAFIPYFFLIAAGLSGLLLIAAYIVNSLSASEKGTTTEFTALVTFVIGA
FT                   MLHFTLPLLAAFITMIVLFVLNLKEKIQEYEKTITKQDLSAAILFMLMTFVILPILPDR
FT                   AIDPMGLINLYRIWIMVVLVAGISFFGYIAIRILGSTHGISAAGLFGGLVSSTAVAMSM
FT                   ARRVHENGFLAKNLAMGIALASSVMLLRAGIEIWVINPALVQTFIIPIAIGTLAGYGYI
FT                   AMLYFTSKRENISQNIEFKNPFDLKEALVMGLVFGATLALISLSNRYIGDMGVYAVALV
FT                   SGIADVDAIILSLSSLAKNGLNPSTAHHAILIAIISNTFAKAALVLFFGKIGLFRLVIT
FT                   YYLISIGAFALTALLMY"
FT   sig_peptide     86637..86684
FT                   /locus_tag="Sulku_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            87996..88925
FT                   /locus_tag="Sulku_0090"
FT   CDS_pept        87996..88925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0927 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32758"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS7"
FT                   /protein_id="ADR32758.1"
FT                   /translation="MKVATHSLSLGAVSLHYRGEEEKLSLASSVQTFQKIEDGMGTAED
FT                   PLAEVDPKLRIMALLLEALTGQKISLTAFHSNSNVSDTANTASVSRENSPILEYQYHKE
FT                   ELNSMNFSAEGKVLLEDGSMKTFSLSIKWEQSFSESLRLRIQDGKILTDPLVISLDGTQ
FT                   PLSSNAFAFNLNGESEQSLPYLTGRAGYLAYDADQDGKITSGSELFGPKSGKGFMELSA
FT                   YDEDKNGWIDGNDSFFKQLRVWTITEGSESLLSLEEVGIGAISLQTTNVDFTLKRDIDD
FT                   PIAHYKKASVAVGENGEAYGIFEIDVAV"
FT   gene            complement(88955..89575)
FT                   /locus_tag="Sulku_0091"
FT   CDS_pept        complement(88955..89575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0091"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: cli:Clim_0637
FT                   phosphoesterase PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR:
FT                   Phosphoesterase PA-phosphatase related; PFAM: PAP2
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32759"
FT                   /db_xref="GOA:E4TWS8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS8"
FT                   /protein_id="ADR32759.1"
FT                   /translation="MSENTSMIRTSLIVFLCAAFSFFYIDQVLALYFHNFHNSWVIAIF
FT                   NYITKLGDSLYSLALLSILFLLYRRQKPLFSQKMLYLFATVVLSGLIVDVIKIIVSRLR
FT                   PNMLFEHDMYGFVWFKLGYEFNSLPSGHSATAFALSIGLSLLFPRYKYLYILIGLLVVM
FT                   SRVILTCHYLSDILLGSLFGWLTALIIYRKYFTRSLIQCPAMS"
FT   sig_peptide     complement(89486..89575)
FT                   /locus_tag="Sulku_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            89927..91456
FT                   /locus_tag="Sulku_0092"
FT   CDS_pept        89927..91456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0092"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: aeh:Mlg_2451 periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein; SPTR:
FT                   Diguanylate cyclase; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain; Bacterial extracellular solute-binding
FT                   proteins, family 3; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32760"
FT                   /db_xref="GOA:E4TWS9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS9"
FT                   /protein_id="ADR32760.1"
FT                   /translation="MHLIFILLIATNLFSANSLTFGVFAYHSPSKIIKEYQPVVDHLSK
FT                   ELNTTITLKILSQQDLEKQVSQDKIDIIATNPTHFLALHAKGHVTGAMVTEVKKYDKFL
FT                   TPYLGGVIITRSDRHDIRTLQDLKGKVIAIPGKKFLGGFQTQNYEFEKLGINLNKYSVL
FT                   HKESNHNEVVKSVINGKADAGFVRTGIIEEMNIDKQLDKSKLFIINERHYHYFPLKIST
FT                   ELYPEWAIATSMHLPVPTVQKIVLALYSYKAKSNGRGVIEGFTIPADYANIDSLARVLR
FT                   LPPYEKAPHFTFVDVWDKYKFWIILLTISSTTIFILLIIVYRINRKLNQTSAELFDLAT
FT                   HDPLTGLFNRRGMMERLKFLLAELGRNKKNGALIYLDLDNFKPLNDSYGHAIGDELLIQ
FT                   VSKRIGMTVRAIDTIARMGGDEFLVILSHMEPTKVYEDAKQIAEKLRTVLNEPFSISIN
FT                   EELEIKHSISASIGMVIFDEHHKADTIIIHADAAMYEAKEQGRNRVVVGKC"
FT   sig_peptide     89927..90001
FT                   /locus_tag="Sulku_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            92050..93462
FT                   /locus_tag="Sulku_0093"
FT   CDS_pept        92050..93462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_0995 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32761"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT0"
FT                   /protein_id="ADR32761.1"
FT                   /translation="MNTSINAPLGTEQEELNGVASIEVYNFPTASGIDSAYYFIESNAD
FT                   YKEFFHYSIFSVVESAKESNGGYVPKDSLTITISDIAFIYLGKDQGFYFFADRAGAFRV
FT                   GFKDPDTNQGVHDIRVQLQGIGIYALGLRFLADYINGTILKEISKPNYYITRADLNIFC
FT                   QYDLGNIIEPEHIVTRKRKFERIIGKKKGYETLYIGKPPARLRVYNKALEIDHTSMKTH
FT                   FLKSYLEPLGINVLEPFWNFEFECHRDFLKQYKINTLDDLLGNAEMLFHKMMEQIRLVD
FT                   TATITLKDIEANRLYKAPTHPLWNYLDQAYTFNAIDQKKIPLERIVYAPKELNANDFIE
FT                   EFRLLTQKYAEHSVIVNYEELRDVLHESRLWLTKKAQKVIKPFVPIELQTDQRKYLLTR
FT                   NHTAVAILPKSLEYISDTELITLESLLIKALHQELSYQDQDISLIVKHTQAVNEEKERR
FT                   RAGQKELELWQV"
FT   gene            93450..93887
FT                   /locus_tag="Sulku_0094"
FT   CDS_pept        93450..93887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_1996 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32762"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT1"
FT                   /protein_id="ADR32762.1"
FT                   /translation="MASIELITKEDFDELKALIIGAVRPLMTVEEAGEYLRLSPHTIRH
FT                   KIADQTFILGVHYSDKAGKILFAKERLDTWLWEESKESNNVSIQKKQSGVDRLIRQWSE
FT                   SQEIHGTGVDCKQRQKGRKRPHSPIKNGDNDGAGNTQKRAS"
FT   gene            93892..94785
FT                   /locus_tag="Sulku_0095"
FT   CDS_pept        93892..94785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0095"
FT                   /product="integrase family protein"
FT                   /note="InterPro IPR002104; KEGG: sdl:Sdel_1112 integrase
FT                   family protein; PFAM: integrase family protein; SPTR:
FT                   Integrase family protein; manually curated; PFAM: Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32763"
FT                   /db_xref="GOA:E4TWT2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT2"
FT                   /protein_id="ADR32763.1"
FT                   /translation="MSYYADLFMDSKRQTTVPRTHERYLSIIKHSILPVFGDSPIRELK
FT                   VSNVEKWRNDLLKRFTAKTVKEYQIVLRGIFQKALHDEEIGKNPIDALDSLKVKKPHVV
FT                   PFMPYEVKLILDTAQGWFKNYLALGFMTGMRVGEIVALKWENVNLKKREIYVCASRIEG
FT                   VEGTTKTQSSIRYIPIIDTLVPFLEAQKKLSGDKEYVFVNQYGEVFYDYKTIGANQWKS
FT                   ILKECKLDHRRMYEMRHTCATNLLMSGQYSVNEIASILGHTTPQMLFERYTRNISAERK
FT                   PFNKTIDIYGVAGMAL"
FT   gene            complement(94837..94924)
FT                   /locus_tag="Sulku_R0002"
FT   tRNA            complement(94837..94924)
FT                   /locus_tag="Sulku_R0002"
FT                   /product="tRNA-Ser"
FT   gene            95155..96255
FT                   /locus_tag="Sulku_0096"
FT   CDS_pept        95155..96255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0096"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="COGs: COG0232 dGTP triphosphohydrolase; InterPro
FT                   IPR006261: IPR006674: IPR003607; KEGG: tdn:Suden_0021
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR:
FT                   Deoxyguanosinetriphosphate triphosphohydrolase; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM: HD
FT                   domain; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32764"
FT                   /db_xref="GOA:E4TWT3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT3"
FT                   /protein_id="ADR32764.1"
FT                   /translation="MLPNQRFHPISDDFRSPYARDRDRIIHSGSFRRLEYKTQVFLNSQ
FT                   GDFFRTRLTHSIEVSQIARSIASHLGLEESLAESIALSHDLGHTPFGHIGGDTLDECLK
FT                   ERGFVSGFEHNFQSFRVVTKLEQRYKAFLGLNLTYATLEGIIKHSYPYNKTFLPNAIRE
FT                   VFALDTHPSIEAMVVDRADEIAYISHDIDDGVASGLITFETLKSSELIQTILQKVYAEG
FT                   IHEDEDEMFRYRFSSHLINHLVYSLLEYSHDKVDNSRVLASAIPATEEIPIGFEPELET
FT                   QIKKLKKILFQELYQHKQIMRKMFSGKQAIIGLFNALMEEPKMLPHYYLEQCERRNKHR
FT                   IISDYIASMSDRYAMKLYNELYGREG"
FT   gene            complement(96282..96725)
FT                   /locus_tag="Sulku_0097"
FT   CDS_pept        complement(96282..96725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0097"
FT                   /product="cytochrome c"
FT                   /note="KEGG: ant:Arnit_1440 cytochrome c; SPTR: Cytochrome
FT                   c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32765"
FT                   /db_xref="GOA:E4TWT4"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT4"
FT                   /protein_id="ADR32765.1"
FT                   /translation="MNFKTVSVAVIAAVVAIQFIPYGKDHTNPPIVSEPQWDSPRTKEL
FT                   FNRACADCHSNETAYPWYSNIAPVSWLIAHDIDEGREHFNVSMWGAQKKNEGEDAAKEV
FT                   REGEMPIWFYTIPHPEAKLSSSEKQELISGLEKTFGKEEEEEK"
FT   sig_peptide     complement(96651..96725)
FT                   /locus_tag="Sulku_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(96807..97802)
FT                   /locus_tag="Sulku_0098"
FT   CDS_pept        complement(96807..97802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0098"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro IPR004733: IPR000728: IPR010918; KEGG:
FT                   tdn:Suden_2050 phosphoribosylaminoimidazole synthetase;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein, N-terminal domain; AIR synthase
FT                   related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32766"
FT                   /db_xref="GOA:E4TWT5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT5"
FT                   /protein_id="ADR32766.1"
FT                   /translation="MSQISYKDAGVDIDAGNSFVENIKPLVKSTAIPGVLGGIGSFAGA
FT                   FELPSGYREPVMLAATDGVGTKLKLAIDSGIHNTVGIDLVAMCVNDLICNFGTPSFFLD
FT                   YYATGKLDVTAATAVVSGIAEGCRQAECALIGGETAEMPGMYHSDDYDLAGFAVGIGEK
FT                   SELDRSDKVQAGDILIALPSSGLHSNGFSLARKVLFEKMGMKFEDEFEGKPLIETLLTP
FT                   TRIYVKTFKALKNKIQALAHITGGGIVENFPRVLPEGLRAVITESSIRVLPIFELIGQH
FT                   VERAEMFRAFNMGVGMILVVKEADVADVLAATDGYVIGHLEEGKREAVLV"
FT   gene            complement(97947..98150)
FT                   /locus_tag="Sulku_0099"
FT   CDS_pept        complement(97947..98150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_1505 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32767"
FT                   /db_xref="GOA:E4TWT6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT6"
FT                   /protein_id="ADR32767.1"
FT                   /translation="MCAEKIQRFLMAIVLTVALFLFASNQILYGMIIQTLVIVMVIIWA
FT                   IFDFCPSLWVFKKVFGKCPQKD"
FT   sig_peptide     complement(98082..98150)
FT                   /locus_tag="Sulku_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            98312..98866
FT                   /locus_tag="Sulku_0100"
FT   CDS_pept        98312..98866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0100"
FT                   /product="Spermine synthase"
FT                   /note="COGs: COG0421 Spermidine synthase; InterPro
FT                   IPR001045; KEGG: tdn:Suden_2048 spermidine synthase-like;
FT                   PFAM: Spermine synthase; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32768"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT7"
FT                   /protein_id="ADR32768.1"
FT                   /translation="MKTFIYPEMMTHVAMCTHKNPRSVMIISNQSDLIKVEMGRYREVD
FT                   TEYLDANNLLTALRDRADKESDVLLLDTLSDDSAVFAHVNRILKDDALMVLKHPDLDDV
FT                   SANTKLMQILGNYFKIIMPYHLEDGSTLLLCSKEYHPTADLILQRSDLLEGHHYYNCDI
FT                   HIAAFAMPQYIRKNYLGIIRN"
FT   gene            98866..99471
FT                   /locus_tag="Sulku_0101"
FT   CDS_pept        98866..99471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0101"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: tdn:Suden_2047 dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; PRIAM: Dephospho-CoA kinase; SPTR:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase; PFAM:
FT                   Dephospho-CoA kinase; TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32769"
FT                   /db_xref="GOA:E4TWT8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT8"
FT                   /protein_id="ADR32769.1"
FT                   /translation="MAFEYAIALTGGIATGKSTVASLLGLNGLRIIDADTIAHRILDEN
FT                   SAWVSERFGSEFVKNGKVDRPSLGKIVFADAQAKKELENFLHPKIRAAIEEESEKQDRL
FT                   KYPYLIDIPLFFETASYPIKNSVVVYTPKALQLERFMKRNGFSEEESLRRIESQMDIEE
FT                   KKKRATWVIDNSSNLKHLQCECEQFVESIKALYPAPKV"
FT   sig_peptide     98866..98967
FT                   /locus_tag="Sulku_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            99502..100251
FT                   /locus_tag="Sulku_0102"
FT   CDS_pept        99502..100251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0102"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COGs: COG0253 Diaminopimelate epimerase; InterPro
FT                   IPR018510: IPR001653; KEGG: tdn:Suden_2046 diaminopimelate
FT                   epimerase; PFAM: diaminopimelate epimerase; SPTR:
FT                   Diaminopimelate epimerase; TIGRFAM: diaminopimelate
FT                   epimerase; PFAM: Diaminopimelate epimerase; TIGRFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32770"
FT                   /db_xref="GOA:E4TWT9"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT9"
FT                   /protein_id="ADR32770.1"
FT                   /translation="MLQIAKYCASGNDFVIFHAFEKADRSQLARILCDRQNGIGADGLI
FT                   VLVPHESHDFEWEFYNADGSTASMCGNGSRACAHYAHRFGLAPSSMAFLTGAGVIKAHV
FT                   EGDMVQSDLTPPVIVNQEIVESGMKWWLIDTGVPHLITFDADIEHFNIDLARTLRHRYN
FT                   ANVNIASINLDGTLRVRTYERGVEDETLACGTGMAASFYRAVQERLVDENTKVFPKSGE
FT                   TLYLGFEEGVITFKGEVKGVFETTWRN"
FT   gene            complement(100517..101584)
FT                   /locus_tag="Sulku_0103"
FT   CDS_pept        complement(100517..101584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0103"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR000352: IPR004373: IPR005139; KEGG:
FT                   tdn:Suden_2045 peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; SPTR:
FT                   Peptide chain release factor 1; TIGRFAM: peptide chain
FT                   release factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM:
FT                   peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32771"
FT                   /db_xref="GOA:E4TWU0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU0"
FT                   /protein_id="ADR32771.1"
FT                   /translation="MLSDKLTPFINRYNELTELLSSPDIGNDIKRMTELSKEQSSIQAI
FT                   VNKATEYKKLLEDIEENKSLAFDAELGELAKEELRTLEPMVEPLEEEIKKLLIPADPND
FT                   KRNIYIELRAGTGGDEAAIFVGDLFNAYVRYADVKGWKIELMSSSPSDAGGYKEIIALI
FT                   KGEQVYSRLKYEAGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEVTINENDLKIDV
FT                   MRSSGSGGQSVNTTDSAVRITHLPTGIVVTNQDEKSQHKNKDKAMKILKARIYEMQMEE
FT                   AKVKEMSERKEQVGTGDRSGRIRTYNYPQNRISDHRINLTLYRLDEIMQGGLMDDIIEP
FT                   LIADAQAQIMERAGL"
FT   gene            complement(101652..101918)
FT                   /locus_tag="Sulku_0104"
FT   CDS_pept        complement(101652..101918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0104"
FT                   /product="SSU ribosomal protein S20P"
FT                   /note="COGs: COG0268 Ribosomal protein S20; InterPro
FT                   IPR002583; KEGG: tdn:Suden_2044 30S ribosomal protein S20;
FT                   PFAM: ribosomal protein S20; SPTR: 30S ribosomal protein
FT                   S20; TIGRFAM: ribosomal protein S20; PFAM: Ribosomal
FT                   protein S20; TIGRFAM: ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32772"
FT                   /db_xref="GOA:E4TWU1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU1"
FT                   /protein_id="ADR32772.1"
FT                   /translation="MANHKSALKRIRQTEKRTERNRFYRTRIKNIVKAVRAAVDAGNKE
FT                   EAQAALVIANANLHKYVSKGILKKETAARKVSRLHLAVNAIAA"
FT   gene            102045..103385
FT                   /locus_tag="Sulku_0105"
FT   CDS_pept        102045..103385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0105"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterProIPR016066:
FT                   IPR006352: IPR005841: IPR005844: IPR 005845: IPR005846:
FT                   IPR005843; KEGG: tdn:Suden_2039 phosphoglucosamine mutase;
FT                   PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphoglucosamine mutase; TIGRFAM: phosphoglucosamine
FT                   mutase; PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I; TIGRFAM: phosphoglucosamine
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32773"
FT                   /db_xref="GOA:E4TWU2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU2"
FT                   /protein_id="ADR32773.1"
FT                   /translation="MKLFGTDGVRGEAGSFLTAELAMRVAMAAGIYFSEHARTKKILLG
FT                   KDTRKSGYMIENAIVSGLTAVGYDVVQIGPMPTPAIAFLTLNMRCDAGIMISASHNPFE
FT                   DNGIKFFDAHGNKLSEEIEAQIEAIAHDKARLEEGQVTGKNIGSAKRIDDVIGRYIVQL
FT                   KNSFSRELTLQGLRIVLDTANGAGYKVGPTVLEELGAEVIVLHDKPNGFNINEGCGAMH
FT                   TKDLREAVKQYRADIGLALDGDADRLIVVDENGDEVDGDQILGSLGLFLNKNGQLKGGG
FT                   IVATVMSNQALEDTMNENGLKLFRSNVGDKYVLEVMRENGINFGGEQSGHIILHDYAKT
FT                   GDGLVSALQILALLLTSGQKASKVLRPFKLYPQKLVNIKVKTKKPLDQIEGLSEELAKI
FT                   ESAHMRHLIRYSGTENKLRILLEGKDAKVMEKSMEHLVSFFEKALNG"
FT   sig_peptide     102045..102128
FT                   /locus_tag="Sulku_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            103378..103821
FT                   /locus_tag="Sulku_0106"
FT   CDS_pept        103378..103821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0106"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="COGs: COG0597 Lipoprotein signal peptidase; InterPro
FT                   IPR001872; KEGG: tdn:Suden_2038 lipoprotein signal
FT                   peptidase; PFAM: peptidase A8 signal peptidase II; SPTR:
FT                   Lipoprotein signal peptidase; TIGRFAM: lipoprotein signal
FT                   peptidase; PFAM: Signal peptidase (SPase) II; TIGRFAM:
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32774"
FT                   /db_xref="GOA:E4TWU3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU3"
FT                   /protein_id="ADR32774.1"
FT                   /translation="MVRSIIVLVLVMSSVFLIDQAIKSIFLDGYRLYTSCIDLILVFNK
FT                   GVAFSMFAFLEGALKWIQLALLAGVIGYTLWLKKTCYLLPVGIMAGAGLSNVADRFMHG
FT                   GVVDYVYWHCGFNFAVFNAADVMIDIAVIALMILNFRPKLCKS"
FT   sig_peptide     103378..103449
FT                   /locus_tag="Sulku_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            103874..103949
FT                   /locus_tag="Sulku_R0003"
FT   tRNA            103874..103949
FT                   /locus_tag="Sulku_R0003"
FT                   /product="tRNA-Val"
FT   gene            104046..105854
FT                   /locus_tag="Sulku_0107"
FT   CDS_pept        104046..105854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0107"
FT                   /product="Ser-tRNA(Thr) hydrolase; threonyl-tRNA
FT                   synthetase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /note="COGs: COG0441 Threonyl-tRNA synthetase;
FT                   InterProIPR002320: IPR018158: IPR006195: IPR012947: IPR
FT                   002314: IPR004154; KEGG: tdn:Suden_0066 threonyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (G H P and S);
FT                   Threonyl/alanyl tRNA synthetase SAD; Anticodon-binding
FT                   domain protein; SPTR: Ser-tRNA(Thr) hydrolase /
FT                   threonyl-tRNA synthetase; TIGRFAM: threonyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; Threonyl and
FT                   Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32775"
FT                   /db_xref="GOA:E4TWU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU4"
FT                   /protein_id="ADR32775.1"
FT                   /translation="MDIIAIKHNDQIVDLQTAGALGITGEEIAYDNSPDALEVIRHSCA
FT                   HLMAEAIKALYTDAKFFVGPTVKEGFYYDFKVNETIGEDDLKTIEKKMLDIAKGKEKIE
FT                   RYEITKNEARAKFANDHLKQAVMDRIPSDTVTIYKQGEFEDLCRGPHLPSVGLLRYFKL
FT                   TKISGAYLGGDSKNEMLTRIYGIAFADKESLKAYLDQMAEAEKRDHRKIGAEMKLFTFR
FT                   EEVGAGFPIWLPAGARMRSRLEQLLFKAHRKRGYEPVRGPEMLRSDLWKVSGHYQNYGE
FT                   NMYFTHIDELEFGVKPMNCVGHIKVYEHDLHSYRDLPLKYFEYGVVHRHEMTGALHGLF
FT                   RVREFTQDDAHIFCTADQIEQQIIEVVDFVDKIMKTFEFNYKMMISTKPEKAVGDDAVW
FT                   EISTNALKTAMDKNNLSYEIDEGGGAFYGPKIDIKITDAIGREWQCGTIQLDFNLPARF
FT                   ELEYNGEENAKIQPVMIHRAILGSFERFVGILTEHYAGEFPMFIAPTQVAIVPIAPTHE
FT                   AYARELADKLIDMGADFEIFDKNESLNKRIRTAEKGRVPMIIVLGDEEVANKSIAVRDR
FT                   RSREQYNLSEEDFISLVKQKINEVHF"
FT   gene            105851..106381
FT                   /locus_tag="Sulku_0108"
FT   CDS_pept        105851..106381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0108"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="COGs: COG0290 Translation initiation factor 3
FT                   (IF-3); InterPro IPR019813: IPR001288: IPR019814:
FT                   IPR019815; KEGG: tdn:Suden_0067 translation initiation
FT                   factor IF-3; PFAM: Translation initiation factor 3-like;
FT                   SPTR: Translation initiation factor IF-3; TIGRFAM:
FT                   translation initiation factor IF-3; PFAM: Translation
FT                   initiation factor IF-3, C-terminal domain; Translation
FT                   initiation factor IF-3, N-terminal domain; TIGRFAM:
FT                   translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32776"
FT                   /db_xref="GOA:E4TWU5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU5"
FT                   /protein_id="ADR32776.1"
FT                   /translation="MIKKQDRVLMNEDIRVPEVRCVVDGGEALGIISINEAMNKANEMG
FT                   LDLVLISPDAKPPVAKIMDYGKFHYQEEKKKKEARKKQTKVEVKEIKLSVKIADNDVGY
FT                   KVKHAREFLEEGKHVHFRVFLRGREMAHPESAVAVLQRVWPMVEDIGTMYKAPQMEGRY
FT                   CNMMIHPKKDDKK"
FT   gene            106575..106769
FT                   /locus_tag="Sulku_0109"
FT   CDS_pept        106575..106769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0109"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="InterPro IPR018265: IPR001706: IPR021137; KEGG:
FT                   tdn:Suden_0206 50S ribosomal protein L35; PFAM: Ribosomal
FT                   protein L35; SPTR: 50S ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35; PFAM: Ribosomal protein L35;
FT                   TIGRFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32777"
FT                   /db_xref="GOA:E4TWU6"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU6"
FT                   /protein_id="ADR32777.1"
FT                   /translation="MPKMKSVKGAVKRFKVKKNGTIKRGSAFRSHILTKQDAGTRRKQN
FT                   APKVVANVDVKAIKKMIVG"
FT   gene            106863..107216
FT                   /locus_tag="Sulku_0110"
FT   CDS_pept        106863..107216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0110"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="COGs: COG0292 Ribosomal protein L20; InterPro
FT                   IPR005813; KEGG: ccv:CCV52592_0347 50S ribosomal protein
FT                   L20; PFAM: ribosomal protein L20; SPTR: 50S ribosomal
FT                   protein L20; TIGRFAM: ribosomal protein L20; PFAM:
FT                   Ribosomal protein L20; TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32778"
FT                   /db_xref="GOA:E4TWU7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU7"
FT                   /protein_id="ADR32778.1"
FT                   /translation="MPRVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLVY
FT                   AFRDRKQKKREFRKLWIIRINAACRLNGMSYSVFMNGLKRANIELDRKILADMAMNDAA
FT                   AFTALTTQAKAAL"
FT   gene            complement(107305..107547)
FT                   /locus_tag="Sulku_0111"
FT   CDS_pept        complement(107305..107547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvy:VVA1079 membrane-fusion protein; SPTR:
FT                   Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32779"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU8"
FT                   /protein_id="ADR32779.1"
FT                   /translation="MKKNLFFGLIAAALLLSGCADKQISINGMICPAGKTEDRIMADFQ
FT                   ECRYYDLKAAGEASKAPITVECQKCLESKGYKIEQ"
FT   sig_peptide     complement(107488..107547)
FT                   /locus_tag="Sulku_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(107544..108170)
FT                   /locus_tag="Sulku_0112"
FT   CDS_pept        complement(107544..108170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0112"
FT                   /product="thymidylate synthase (FAD)"
FT                   /EC_number="2.1.1.148"
FT                   /note="COGs: COG1351 alternative thymidylate synthase;
FT                   InterPro IPR003669; KEGG: sdl:Sdel_0001 thymidylate
FT                   synthase, flavin-dependent; PFAM: thymidylate synthase
FT                   complementing protein ThyX; PRIAM: Thymidylate synthase
FT                   (FAD); SPTR: Thymidylate synthase, flavin-dependent;
FT                   TIGRFAM: thymidylate synthase, flavin-dependent; PFAM:
FT                   Thymidylate synthase complementing protein; TIGRFAM:
FT                   thymidylate synthase, flavin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32780"
FT                   /db_xref="GOA:E4TWU9"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWU9"
FT                   /protein_id="ADR32780.1"
FT                   /translation="MKVTLQHHTPLVICSDAIRTCWQSFDKSDNGGEKDRELIDRVGNK
FT                   FKHASTLEHIVYNFYVEGISRALLQELARHRMASLSVKSTRYTLKELKDEEPFSIDHKE
FT                   RAAKYLVMTDVEMVDEMSIRALENLRAVLVAGISNDRAKYCLPESYKTELAWSINARSL
FT                   QNFISLRSDKAALWEIRDLAHAVYSALPEDHRYLFENSLKEEHTS"
FT   gene            complement(108348..110432)
FT                   /locus_tag="Sulku_0113"
FT   CDS_pept        complement(108348..110432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0113"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="COGs: COG0595 hydrolase of the
FT                   metallo-beta-lactamase superfamily; InterPro IPR001587:
FT                   IPR004613: IPR011108; KEGG: tdn:Suden_2089 hypothetical
FT                   protein; PFAM: RNA-metabolising metallo-beta-lactamase;
FT                   SPTR: Metallo-beta-lactamase family protein; PFAM:
FT                   Metallo-beta-lactamase superfamily; RNA-metabolising
FT                   metallo-beta-lactamase; TIGRFAM: conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32781"
FT                   /db_xref="GOA:E4TWV0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV0"
FT                   /protein_id="ADR32781.1"
FT                   /translation="MSEEQPGSQTQPQGENRQRRNNRRPFRSRNNNRPEGAEGNTTERP
FT                   NTEPREDSRPPRQDNRPPRQDNRPPRQDNRPPRTDRPEGSDANATDAEPARSGRDRGRG
FT                   GRRGSPSTPIDNNLRDFVVKNQDAHKNRLNPHYKLDLNNNDKVRITPLGGLGEIGGNIT
FT                   VIETENEAIIIDIGMSFPDEEMHGVDILVPDFTYLREIRKKIVAVIITHAHEDHIGGVP
FT                   YFFKEMQFPIYGTPLPLAMIGNKFDEHHMRDFRRYFNPIVKRIPYKIGNDFEIEWMHMT
FT                   HSIIDSSSLAITTKAGTIIHTGDFKIDHTPVDGYTADLHRLAHYGEKGVLCLLSDSTNS
FT                   YNKEWTPSELTVAPGFDRIFSKAEGRVIMSTFSSNIHRVYQAILTGIKYNRKVCVIGRS
FT                   MERNLEVCMQYDYIKLPKNIFIDAEEANRMSDKDVLIVTTGSQGEPSSALFRMAIGEHR
FT                   HIKIKPTDLIVLSARAIPGNEGSISGMLNYLQRAGARVANDRDIHVSGHASMEEQKLML
FT                   RLTNPKFFLPVHGEYNHIMKHKETAVTCGVPERNILLMSDGDSIEVNTKMMRKAKTVKT
FT                   GKTYIDNQNNHQIEDDIIIDRQKMASEGMVMLVAQVSAAESRLLSKPLVTSFGIVADRH
FT                   DKAFALEMEDVLEHFLINLKPGLIENPKALENDLRQVVRKHIYRKMKKYPLIVPHVFVM
FT                   "
FT   gene            complement(110507..111286)
FT                   /locus_tag="Sulku_0114"
FT   CDS_pept        complement(110507..111286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0114"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro IPR011530: IPR001737: IPR020598;
FT                   KEGG: tdn:Suden_2090 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like; SPTR:
FT                   Ribosomal RNA small subunit methyltransferase A; TIGRFAM:
FT                   dimethyladenosine transferase; PFAM: Ribosomal RNA adenine
FT                   dimethylase; TIGRFAM: dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32782"
FT                   /db_xref="GOA:E4TWV1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV1"
FT                   /protein_id="ADR32782.1"
FT                   /translation="MQKDRAAIAKKKFGQNFLKDEAVLAQIIQSMPDTPHRIAEIGPGL
FT                   GDLTKYLVDVKSVTAFEVDTDLCKHLTHQFADAIATNALTLRCGDVLEHWKSELLDEPY
FT                   DLVANLPYYIATNIILKALADPACRNLLVMIQREVAEKFSAAPGERAFGALSVIAQSVG
FT                   EAEIVLHVPPTAFEPAPKVDSCVLLISKRTNRNDEGFEDFLRTAFTQPRKTLHKNLSSR
FT                   YDGTVLSQAFETLELERSIRPHQLDTSDFHRLYTLIK"
FT   gene            111443..112204
FT                   /locus_tag="Sulku_0115"
FT   CDS_pept        111443..112204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0115"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="COGs: COG0107 Imidazoleglycerol-phosphate synthase;
FT                   InterPro IPR004651: IPR006062; KEGG: tdn:Suden_2091
FT                   imidazole glycerol phosphate synthase subunit HisF; PFAM:
FT                   histidine biosynthesis protein; SPTR: Imidazole glycerol
FT                   phosphate synthase subunit hisF; TIGRFAM: imidazoleglycerol
FT                   phosphate synthase, cyclase subunit; PFAM: Histidine
FT                   biosynthesis protein; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32783"
FT                   /db_xref="GOA:E4TWV2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV2"
FT                   /protein_id="ADR32783.1"
FT                   /translation="MDNFFAKRIIPCLDVKDGRVVKGVNFVGLKDAGDPVEVAKRYNEE
FT                   GADELTFLDITASHEERDTIVHIVEQVAKEVFIPLTVGGGIRKLDDIYRLLAVGCDKVS
FT                   VNSAAIKRPELIDEGAKRFGSQCIVVAIDVKRTGNQYNVYLNGGRVDTGINALEWAKEV
FT                   VDRGAGEILLTSMDADGTKAGFDLSITEQISRAVNVPVIASGGAGTMEHIKEAFEHGAD
FT                   AALAASIFHYKEIDIMDLKRYLSANGIPVRL"
FT   gene            112201..112737
FT                   /locus_tag="Sulku_0116"
FT   CDS_pept        112201..112737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_2092 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Phosphorylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32784"
FT                   /db_xref="GOA:E4TWV3"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV3"
FT                   /protein_id="ADR32784.1"
FT                   /translation="MILCAGNNETFDFATPIGVGLIDSAINLTRHALVHKPEFILFVGS
FT                   AGSYGEHKIHEIIESKTAANIELGFLDKSAYTPIDNVVSAQTETIKDVIVNSSNYITTS
FT                   EKAMEQMRGLGMGIENMEFFSVMRVAQIFGIPAGGVFCITNYCDTNAHRDFISNHGFAK
FT                   VLLREHLVNKGMIRG"
FT   gene            112730..113794
FT                   /locus_tag="Sulku_0117"
FT   CDS_pept        112730..113794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0117"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR004383: IPR007197; KEGG: tdn:Suden_2093 ribosomal RNA
FT                   large subunit methyltransferase N; PFAM: Radical SAM domain
FT                   protein; SPTR: Ribosomal RNA large subunit
FT                   methyltransferase N; TIGRFAM: radical SAM enzyme, Cfr
FT                   family; PFAM: Radical SAM superfamily; TIGRFAM: radical SAM
FT                   enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32785"
FT                   /db_xref="GOA:E4TWV4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV4"
FT                   /protein_id="ADR32785.1"
FT                   /translation="MGKLCILDYTKAELAGMVKPSFRAKQIWGWIYHQYATSFETMQNL
FT                   PKTMREELAQTYEIMPLKIARKECSTDGTIKYLFELSDGKTVETVWLKMKDESIDEEGN
FT                   IEHEARYTVCVSTQVGCKVGCSFCLTAKGGFTRDLTAGEIVAQVLAVKMDNNLAAHRRL
FT                   NIVYMGMGEPLDNLDNLAKAITILKDEEGLSISGKRQTVSTSGLSTKIDKLGEMDLGVH
FT                   IAISLHAVDDELRTELIPMNKAYNIASIIDAVKRFPIDTRKRVMFEYLVIKNKNDDLGS
FT                   AKKLVKLLHGIKAKVNLIYFNPYPGSDYQRPSREDMVAFQEYLIKHGVLCTIRDSKGLD
FT                   ISAACGQLKEKSLT"
FT   gene            complement(113964..114659)
FT                   /locus_tag="Sulku_0118"
FT   CDS_pept        complement(113964..114659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0118"
FT                   /product="Nucleoside-specific channel-forming protein, Tsx"
FT                   /note="COGs: COG3248 Nucleoside-binding outer membrane
FT                   protein; InterPro IPR018013; KEGG: afw:Anae109_0194
FT                   hypothetical protein; PFAM: Nucleoside-specific
FT                   channel-forming protein, Tsx-like; SPTR: Putative
FT                   uncharacterized protein; PFAM: Nucleoside-specific
FT                   channel-forming protein, Tsx"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32786"
FT                   /db_xref="GOA:E4TWV5"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV5"
FT                   /protein_id="ADR32786.1"
FT                   /translation="MKRLLFASLITAAQLSAFSATNLQYLYGKFEGPTFLDTQSGNKHT
FT                   ITAEHYRTWEYGDLFAFADYVYAPNGLRFSGDKNDLYGEISPRISFNKIAGIPVSDGFI
FT                   KEWYAAFQYNGSDTYHAWLYGFGTDMNVPGFSVFGLNLYRKVQNIGNETYQLSANYYAP
FT                   LGEKWHFEGFTDWTTCDFLSQNQLLFNLNSVFGIKEGKLEIGTEWHYYHENSYRNDNDV
FT                   FQAMLKYSW"
FT   sig_peptide     complement(114603..114659)
FT                   /locus_tag="Sulku_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(114637..115476)
FT                   /locus_tag="Sulku_0119"
FT   CDS_pept        complement(114637..115476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0119"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR010916: IPR016047; KEGG:
FT                   cju:C8J_1178 peptidase, M23/M37 family; PFAM: Peptidase
FT                   M23; SPTR: Peptidase; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32787"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV6"
FT                   /protein_id="ADR32787.1"
FT                   /translation="MRFLLILWLGFLALWGAEGFNGKSLIIPLPSPSGTVIMSDRNISV
FT                   LLHPADKTKGIAVIPIDYYTPAGDINLTWIAPGNESFFSIHIQEADYPTETLSVDPALV
FT                   TPPPEAMEQIAAEKAQAEAIYGHFTPIRYWNKAFVKPIDSNITSEYGSARTYNGSLKSY
FT                   HGGVDFRARTPIPIVAANDGIVVLVQERYYSGGTIIIDHGEGIYSCYFHLSRFDVNVGD
FT                   RIERGQPIALSGESGRITGPHLHFGMMVHGIQSDPLDLISQFNALISKDTDETLTLR"
FT   sig_peptide     complement(115429..115476)
FT                   /locus_tag="Sulku_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            115603..116502
FT                   /locus_tag="Sulku_0120"
FT   CDS_pept        115603..116502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0120"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: hna:Hneap_1817 putative lipoprotein; SPTR:
FT                   Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32788"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV7"
FT                   /protein_id="ADR32788.1"
FT                   /translation="MRKARVIGFILLFLIVGIAASVYYYNRPAESSRIHISTNPWIGFT
FT                   PFIYAQEKGWLESTPFRFLWLVDLTDNARLYERGFTQGFTATQYELLHFKNKNTIKPVF
FT                   LIDQSFGADAIVSNRTLEELQNTREKVDVYLEQGSLNDDFFEAFVTEKGLQKVTFQKID
FT                   TSQKNISTLTEMSHPIIIISYQPYLAGLIKKGFKVLVSTQSMQTFFVVDALFVDEKTIQ
FT                   GREKEFADLKKLFALGVERFKRDPHEYYETIKGYLEGQSYEEFMETTTQIKWLYQTHPN
FT                   EIITHLNAQQIKTDRLLP"
FT   sig_peptide     115603..115662
FT                   /locus_tag="Sulku_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            116499..118949
FT                   /locus_tag="Sulku_0121"
FT   CDS_pept        116499..118949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0121"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160: IPR003018; KEGG: hna:Hneap_1816 diguanylate
FT                   cyclase/phosphodiesterase with GAF sensor; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; SPTR: Diguanylate cyclase/phosphodiesterase with
FT                   GAF sensor; PFAM: EAL domain; GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32789"
FT                   /db_xref="GOA:E4TWV8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV8"
FT                   /protein_id="ADR32789.1"
FT                   /translation="MKLQRFNFLNLAVLFLLIGILSSSFYTIERNGMLNYLADGVNQSL
FT                   FRLEEDIQKTLQQDHLENVQALLDQGSAINSGIRILSVSLDGHTIAVSSSRSLIGKVIE
FT                   GEYLPLTQISEGLVENESLQYESEVTYFSGATKKRALLLVDLDKAYIFERLNNIAMFYA
FT                   LALFLGLGATALALLVGVRKLIIKPLERIAQRAQNQDIIAEKHLIEELSILDQTLCNSF
FT                   HSMQVQQEHLKEALDESLYLDGILRTVADINQLLITAKDVDELLMNSCLRLAEHPGYEL
FT                   CYIALKEGESLVVQAYSNDPTEYLHPKMKIPTEDLTDPTVRAMKEMSTVIIDHLEYENS
FT                   FGPWRFIAETGLYGSVISLPLISAIDALPLGVITLYTKYSEGFESKEVSMLEELAGDIG
FT                   FAIRSFTQREQLKYYLTTDSNTDLPNRFSLVEVLSRESMYGLAIINIDRFGDINEVYGV
FT                   SIGDAVLSQYGHWLRAKIASWKNIELFKLGSDEYALVATQCNDLKLFTDLLENLISTTQ
FT                   KEVFRVEGIEIVLTITVGVAKSTEQVLEHATAALKQAKRNRHSLEIFSSESKQEQENNI
FT                   AWYKRIKEAIEDSRIVPYFQPIVDNESGKIIKYEALIRLVDVDGSIVSPYQFLEIAKKT
FT                   KLYPELTKMMITKVVKLFKDSAFPVSLNLSTQDLTNHDLADFLEETIHENGVGQLMIFE
FT                   ILESEGIENYSSVSEFVDRFKAIGCRFAIDDFGSGYSNFDHLLKLNIDTLKIDGSLIKN
FT                   LPHNRNAQIFVKHICDFAHEMGIKVIAEFVANEAIFHQVKAIGIDASQGYYFYEPSPIV
FT                   VGGN"
FT   sig_peptide     116499..116570
FT                   /locus_tag="Sulku_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            118952..120172
FT                   /locus_tag="Sulku_0122"
FT   CDS_pept        118952..120172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0122"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="COGs: COG3434 signal transduction protein containing
FT                   EAL and modified HD-GYP domains; InterPro IPR014408:
FT                   IPR001633: IPR013976; KEGG: ddf:DEFDS_0835 signal
FT                   transduction response regulator; PFAM: EAL domain protein;
FT                   Metal-dependent hydrolase HDOD; SPTR: Diguanylate
FT                   phosphodiesterase, putative; PFAM: EAL domain; HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32790"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWV9"
FT                   /protein_id="ADR32790.1"
FT                   /translation="MGSSYIGRQPIVNERGALFAYDLFSSAQSASEHATETLVNDLQSS
FT                   FGIDKIIGKRLGFIRADHQFIFHELFGLLPKESIVYAVLEESVVDKELCDSLEKLRGQG
FT                   YRFALNDFAYTPENIEKFSPLFPYLEYVKIDIPRSPRIKREDVEQLKQQELTVIGAKIE
FT                   SHDIHAQCVAKGFSYFQGYFISKPKVLENPSFSLDQTAVIQLWNMLQSDADINALVKAF
FT                   ELNHMVSLKLIRFVNSAVFALRNPVSSVRHVLTLMGREPLARWIMLLMFSEAKESDQNN
FT                   IPLMLMVVNRTELMTQLLTLIKPNATESQQATAYFVGMLSLIHLLFNIPHREALKKLNV
FT                   TPEIERALFEGDGFYGELLTTVRSIEMLDTEGIDKFLEKHSLEREVLEPLIASAMEKVN
FT                   QFDEAMG"
FT   gene            120229..120444
FT                   /locus_tag="Sulku_0123"
FT   CDS_pept        120229..120444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB_G0285449 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32791"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW0"
FT                   /protein_id="ADR32791.1"
FT                   /translation="MVIVNSSLQSPSPMESTQVAKSALQTNKSLDDAIIEFNTQEVQKN
FT                   SSRFQENLSVMAAQMTGKGLNLDIRG"
FT   gene            120749..121865
FT                   /pseudo
FT                   /locus_tag="Sulku_0124"
FT   gene            121869..122678
FT                   /locus_tag="Sulku_0125"
FT   CDS_pept        121869..122678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: cja:CJA_2719 ABC transporter, permease protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32792"
FT                   /db_xref="GOA:E4TWW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW1"
FT                   /protein_id="ADR32792.1"
FT                   /translation="MRLINLNAGRFSPLLKILPFVILGLVYWIAADARHALNPEDKLLP
FT                   TFEAIGEAVKTMVMEPDELTEEPILYTDTVASLNRIAQGLGIATAVGLILGIVQGTLPL
FT                   FRSLLSPFSAAVSLIPPIAILPILLIIFGLEESAKVALIAIGVAPFLIRDTQQRSMELS
FT                   EELLIKVQTLGASTWQIILRVVLPHVMPRLLDALRLSLGAAWLFLITAEAIASSEGLGY
FT                   RIFLMRRYMEMDVILPYVAWITLLAFLMDWILAVIIRRAFPWYRKEK"
FT   sig_peptide     121869..121967
FT                   /locus_tag="Sulku_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            122678..123454
FT                   /locus_tag="Sulku_0126"
FT   CDS_pept        122678..123454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0126"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: wsu:WS1112 ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: ABC TRANSPORTER, ATP-BINDING PROTEIN;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32793"
FT                   /db_xref="GOA:E4TWW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW2"
FT                   /protein_id="ADR32793.1"
FT                   /translation="MSYLQIRNVWKTYDDNVILEKLNFTIEKGEFCTLIGPSGCGKSTF
FT                   LRMLLGKESPTRGTILLEGEPLSNEPGSDRGVVFQKYTLFPHLRALENVMLGLEMEHSA
FT                   FLGKAFGSARRRIKEEAMEMIKAVGLEQSAHKYPSELSGGMQQRLSIAQALVKKPKILL
FT                   LDEPFGALDPGSRSDMQELVHGLWQTYGLTAFMVTHDVKEAFELGTRLLVFDKVRNDPH
FT                   SPNAYGATVVNDIKLDKNKRKNKGEGHVDHDETIIA"
FT   gene            123432..124187
FT                   /locus_tag="Sulku_0127"
FT   CDS_pept        123432..124187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0127"
FT                   /product="urea carboxylase-associated protein 2"
FT                   /note="COGs: COG3665 conserved hypothetical protein;
FT                   InterPro IPR017792: IPR018959; KEGG: wsu:WS1113
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1989; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   urea carboxylase-associated protein 2; manually curated;
FT                   PFAM: Domain of unknown function (DUF1989); TIGRFAM: urea
FT                   carboxylase-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32794"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW3"
FT                   /protein_id="ADR32794.1"
FT                   /translation="MMKPLSPETILFDEVLPGGGRWSKIIRKGQVLRILNTEATSGLSA
FT                   LFYNVHERTERYNAADTVKIQYNAYLKQGKALYSDMGRILMSIIEDSCETHDTVCGYTM
FT                   AADVEKLCGLGNYQAKRNCYYKNDFDNFLVEVGKYGMGRRDIMPCLNLFADAKIGERGE
FT                   LIFREDTVPAGSFIELRAEMDVLVILSNTVHVLSTNETYDVKPVNLTVYQGDAVAEDDI
FT                   CVIDSERSERAFVNTRNYMKQFTQGGGNV"
FT   gene            124180..124821
FT                   /locus_tag="Sulku_0128"
FT   CDS_pept        124180..124821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0128"
FT                   /product="urea carboxylase-associated protein 1"
FT                   /note="COGs: COG3665 conserved hypothetical protein;
FT                   InterPro IPR017791: IPR018959; KEGG: wsu:WS1114
FT                   hypothetical protein; PFAM: Domain of unknown function
FT                   DUF1989; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   urea carboxylase-associated protein 1; PFAM: Domain of
FT                   unknown function (DUF1989); TIGRFAM: urea
FT                   carboxylase-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32795"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW4"
FT                   /protein_id="ADR32795.1"
FT                   /translation="MSEMITVDLTLNEPIYDETIPAGEPWYHVVKAGEVLRIVDLEGCQ
FT                   AVDTLFYNANDVTERYSAPQTIVRQKNIFVETGTELVSNLGNTMMKVISDTCGRHDTLG
FT                   GACSAESNTVRYALDKLDMHSCRDNYLLALGQMGMDKRDLVSNINFFMNVPVEADGTLA
FT                   IIDGISTPGSTIELIALMDTLVLISNCPQLNNPCNAFNPTPVRLSIYKPF"
FT   gene            124957..128556
FT                   /locus_tag="Sulku_0129"
FT   CDS_pept        124957..128556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0129"
FT                   /product="urea carboxylase"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005479: IPR014084: IPR003778:
FT                   IPR000089: IPR 011761: IPR011764: IPR005481: IPR005482:
FT                   IPR003833; KEGG: slt:Slit_0080 UreA carboxylase; PFAM:
FT                   Allophanate hydrolase subunit 2; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; biotin carboxylase
FT                   domain protein; Allophanate hydrolase subunit 1;
FT                   biotin/lipoyl attachment domain-containing protein; SMART:
FT                   Allophanate hydrolase subunit 2; Allophanate hydrolase
FT                   subunit 1; SPTR: Urea carboxylase; TIGRFAM: urea
FT                   carboxylase; urea amidolyase related protein; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Allophanate hydrolase
FT                   subunit 2; Allophanate hydrolase subunit 1;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   Biotin-requiring enzyme; TIGRFAM: urea carboxylase;
FT                   biotin-dependent carboxylase uncharacterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32796"
FT                   /db_xref="GOA:E4TWW5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW5"
FT                   /protein_id="ADR32796.1"
FT                   /translation="MFAKVLIANRGEIACRIIRTLKKMKIASVAVYSHADAGSLHVMMA
FT                   DEAICLGEPPAKESYLDVEKIIQAAKETGADAIHPGYGFLSENAAFSRRCAQEGIVFIG
FT                   PTPKHMEDFGLKHTARSMAKAQNVPLLPGTELLENVQEALRAAQEIGYPVMLKSTAGGG
FT                   GIGMQLCYGAEDLENGFESVGRLSKSNFSQGGIYLEKFVASARHIEVQIFGDGKGDVIA
FT                   LGERDCSLQRRNQKVIEETPAPGLSEEVRDALRSAAVNLARSASYKSAGTVEFVYDTTE
FT                   EKFYFLEVNTRLQVEHGVTEEIFGVDLVEWMILEAAGELGDVLKKSYTPSGHSIQVRVY
FT                   AEDPLKNFQPSSGVLSEVVFSENIRCETWIERGSAISPYYDPMIAKLIVHSSSRDEAIE
FT                   AMKSALSETTLYGIVTNIGYLKSVLDEEVFAKGEQTTKYLGTLNYSPAIVEVIKPGTHT
FT                   TVQSAPGRIGYWDIGVPPSGPMDSLSFRLGNRLLGNDEKAPGLEMTVTGSTLKFHFPTR
FT                   IVLTGAAMKAQLNGAEAAYWETIEISAGDILKMGIIEGAGARTYLLIDGGFDVPEYLGS
FT                   TATFTLGEFGGHAGRILQIGDQLSTHRSDEKKFQAVLDAALRPQMAKEWKIGVIYGPHG
FT                   APDFFKEEYIETFFATDWEVHYNSNRTGVRLIGPKPLWAREDGGEAGLHPSNLHDNAYA
FT                   IGTVDFTGDMPVILGPDGPSLGGFVCPVTIVGAELWKMGQLGPKDRVRFIPMTYDDAVK
FT                   MERDLEAKIAGLEGTLPSLPAPTVTNPVVAEIAANDRHDAVKIRLSGDHYILIEFGPME
FT                   LDLTLRFQVHELMRRLKADNDVRLIDLTPGIRSLQIHYESQTLSLTELLEKVKGELSRM
FT                   PATRDIIVPSRTVYLPLSWDDPSTKLAIEKYMQSVRDDAPWCPSNIEFIRRMNGLNGIE
FT                   DVQNILFEAEYLIMGLGDVYLGAPVAVPVDPRHRLVTTKYNPARTWTPENAVGIGGTYM
FT                   CVYGMEGPGGYQFVGRTVQMWNRYKSTTDFKLGKPWLLEFFDRIRFYPVSQNELAQMRK
FT                   DFINGTFSLRIEEGEFSLAEYLEFLETNRESIDAFKTIQQESFNAERQRWEASGISAYV
FT                   SETLETDDESDFAEIPEGCEAVSSFLSGNVWEISVKAGDTVREGDTLVIIEAMKSEVMI
FT                   ESPVAGEVVEVLCVQGDTVHTGHTLVIIKTEGV"
FT   gene            128556..128897
FT                   /locus_tag="Sulku_0130"
FT   CDS_pept        128556..128897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0130"
FT                   /product="small multidrug resistance protein"
FT                   /note="COGs: COG2076 Membrane transporter of cations and
FT                   cationic drugs; InterPro IPR000390; KEGG: cts:Ctha_1247
FT                   small multidrug resistance protein; PFAM: small multidrug
FT                   resistance protein; SPTR: Small multidrug resistance
FT                   protein; PFAM: Small Multidrug Resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32797"
FT                   /db_xref="GOA:E4TWW6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW6"
FT                   /protein_id="ADR32797.1"
FT                   /translation="MNSWILLALAILLEVAGTTSMKLSDGMQKIFPTVMIFIFYAMAFV
FT                   LMPFVMKKIEMSTVYAIWTGAGTVMVTVIGIAYFSESSNPIKLASIALIAFGVVGLHFA
FT                   ERSSQGGLG"
FT   sig_peptide     128556..128684
FT                   /locus_tag="Sulku_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            128894..130642
FT                   /locus_tag="Sulku_0131"
FT   CDS_pept        128894..130642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0131"
FT                   /product="allophanate hydrolase"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR013838: IPR014085: IPR000120; KEGG: tgr:Tgr7_3090
FT                   allophanate hydrolase; PFAM: Amidase; SPTR: Allophanate
FT                   hydrolase; TIGRFAM: allophanate hydrolase; PFAM: Amidase;
FT                   TIGRFAM: allophanate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32798"
FT                   /db_xref="GOA:E4TWW7"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW7"
FT                   /protein_id="ADR32798.1"
FT                   /translation="MRELKTIGDYLHQYRVEGRGVREVIQSCLDKSSMFDDKNIWIAKA
FT                   DTSFLEPYFLRLEGCDPASLPLYGVPFAVKDNIDIAGMNTTAGCAEFSYLPSEHAFVVK
FT                   QLIEAGAIPIGKTNLDQFASGLVGTRSPYGEGINLFNPDYVSGGSSSGSALAVTAGIVP
FT                   FSLGTDTAGSGRVPAAFGNIVGLKPTRGALSIRGVVPACKSLDCVAIFAQNCEDAGRVY
FT                   DLCGIVDDEDSFSRSKSCIIPFGGTFRFGVPREEQLEFFGNSAYESLFWESVKKLESLG
FT                   GIRCEIDFSPFIETAKLLYHGPWIAERYCGIKSFADTQSDAMLDVTRGIILSGAKPSAM
FT                   DAFEGFYRLSELKKISDRIMDSVDMIMTPTAGTIYRRDEIREQPLALNTNLGYYTNFMN
FT                   LLDLSACAVPAGFTSEGLPFGVTLAAPAWYEHSLLNVGAKLHAASGYESGLIEPHQPKT
FT                   VVLAVCGAHMSGLPLNHELTDRGARLVEKSSTAPQYRFFALENFTPPRPGLVQVNEGGG
FT                   TIEVELWEIPSEEFGSFFSGVPSPLALGSLILADGKVVKGFLCESYAVEGAKEITALGG
FT                   WRNYLQ"
FT   gene            complement(130823..132040)
FT                   /locus_tag="Sulku_0132"
FT   CDS_pept        complement(130823..132040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32799"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWW8"
FT                   /protein_id="ADR32799.1"
FT                   /translation="MRVTKISLLASLLLYTSSFAVDNIEVSGAGKFFYGTVDGSPDGTS
FT                   RPNLFNKEGAFAQFGIDMGIAADLGAGFKGKIAGTGLATANMGGNIVNAPWATGMMGSQ
FT                   VWLSEVYLNKNVLDKTAVTLGRQSLDTPFAFTELWNIAANTFDAVLVENTDLSDTTLIG
FT                   AYIDKGNGVNGFATVNPAIADSGKLKNPFKKFYEGAYVVGAKNKSFNGTELQAWFYELK
FT                   NTAKSYWIQGDTEFSGITLGAQAAVLNLDNTLDSSDNSKAYAAKIGYTAIENLTLSAAV
FT                   SQTDKDGSANFQIANLATGGSGGAQSKLYTEAWWNFGYVGKAGTTAYNVTALYTVPEIV
FT                   DLGFFYTDVDQRAANGDNDMREYTLTAAKSFGSLDTSLAYVYSKANDYNDAKYYNNIQV
FT                   YLTYKF"
FT   sig_peptide     complement(131957..132040)
FT                   /locus_tag="Sulku_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(132428..132512)
FT                   /locus_tag="Sulku_R0004"
FT   tRNA            complement(132428..132512)
FT                   /locus_tag="Sulku_R0004"
FT                   /product="tRNA-Leu"
FT   gene            complement(132531..132607)
FT                   /locus_tag="Sulku_R0005"
FT   tRNA            complement(132531..132607)
FT                   /locus_tag="Sulku_R0005"
FT                   /product="tRNA-Arg"
FT   gene            complement(132619..132695)
FT                   /locus_tag="Sulku_R0006"
FT   tRNA            complement(132619..132695)
FT                   /locus_tag="Sulku_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(132746..132822)
FT                   /locus_tag="Sulku_R0007"
FT   tRNA            complement(132746..132822)
FT                   /locus_tag="Sulku_R0007"
FT                   /product="tRNA-His"
FT   gene            complement(132871..132948)
FT                   /locus_tag="Sulku_R0008"
FT   tRNA            complement(132871..132948)
FT                   /locus_tag="Sulku_R0008"
FT                   /product="tRNA-Pro"
FT   gene            133180..134520
FT                   /locus_tag="Sulku_0133"
FT   CDS_pept        133180..134520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0133"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG1113 Gamma-aminobutyrate permease and
FT                   related permease; InterPro IPR002293: IPR004841; KEGG:
FT                   hth:HTH_0635 amino acid permease; PFAM: amino acid
FT                   permease-associated region; SPTR: Amino acid permease;
FT                   PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32800"
FT                   /db_xref="GOA:E4TXA3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA3"
FT                   /protein_id="ADR32800.1"
FT                   /translation="MSGTNGEFRRSLGLMDVTFIGVGAVIGAGIFVITGQAAATMAGPA
FT                   IVLSFLLGAVMIGITALIYAELSSAYPVAGSAYSFTFASLGEVFAWFVGWNLLLEYGVA
FT                   TAAVATGWSGYLRRFLENSMGLHIPQALSGAYNPSAGTYIDISAFGIILAIFVLLAIGI
FT                   KESAKVNTAIVFIKLGVLVTFVVVGLPHVDFHNLSNFFPFGWEGVWHGASLIIFAYLGF
FT                   DAISTVAEETKNPERNIPLGLILSLALSVVFFILVSFTLTAIVPYQELNVPDALAFALY
FT                   KVNEPFAANVIALGAVITITTVMIVMGLGFTRIFFALARDGLLPKTLSEIHPKFNTPYK
FT                   ATIIGGILLSIMAGLIPLKTLAELVNIGTLFAYLMVAVAIIVLRRQNSIQPVFKIPAFK
FT                   ILMPLNFILIIFMMAGLPFETWLRFIGWSVIGMLIYAYYSTKRSKAE"
FT   sig_peptide     133180..133290
FT                   /locus_tag="Sulku_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            134520..135743
FT                   /locus_tag="Sulku_0134"
FT   CDS_pept        134520..135743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0134"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: gur:Gura_1640 major
FT                   facilitator transporter; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32801"
FT                   /db_xref="GOA:E4TXA4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA4"
FT                   /protein_id="ADR32801.1"
FT                   /translation="MAISVWRQVLTLPVIVIAMGYFVDIYDLILFGVVRVESLSELGLD
FT                   KEGITLWGSYILNAQMAGMLIGGILWGILGDKKGRLSVLFASIILYSVANLLNAFVTNV
FT                   EQYTILRFIAGIGLAGELGAGVTLVAEILPKELRGYGVMTIAAFGVLGVVAAKGVAGYF
FT                   EWRNAYIIGGVLGFMLLALRFRVRESAMFEHNLSDDIKRGQFFALFTHKKLFTKYIKAI
FT                   VIGMPLWYVVGILVMFSPEFATALSIQGEVTAGSALMYTYIGLSVGDLASGYLSQQMRS
FT                   RKKAYTIFMALSLLSVIYYFTLQGASADAFYIAVFLLGVFCGYWALFITMAAEQFGTNI
FT                   RATVATTVPNFVRGSVVPITSSFMLLKESMGVLGAAATVGSVVFVIALVALYYTRETFH
FT                   EDLDYIEA"
FT   sig_peptide     134520..134579
FT                   /locus_tag="Sulku_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(135992..136768)
FT                   /locus_tag="Sulku_0135"
FT   CDS_pept        complement(135992..136768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0135"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="COGs: COG2022 Uncharacterized protein of thiazole
FT                   biosynthesis; InterPro IPR008867; KEGG: tdn:Suden_0217
FT                   thiazole synthase; PFAM: thiazole biosynthesis family
FT                   protein; SPTR: Thiazole synthase; PFAM: Thiazole
FT                   biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32802"
FT                   /db_xref="GOA:E4TXA5"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA5"
FT                   /protein_id="ADR32802.1"
FT                   /translation="MHTLQIGKYTLGSRLIVGSGKYDSFETTKAATLASGSELITVAVR
FT                   RLNITNPNEPNLRDTFAGTNVKFLPNSAGCTTAEEAITLFRLTREATGIDLIKLEVIGD
FT                   TQKTLYPDVLETIKACEVLAKDGFTIMAYTSDDPIMARRLEDAGAHAIMPLAAPIGSGL
FT                   GVQNKYNIVFVREAVKVPIIVDAGIGCASDAALAMELGADGVLTNTAIAQAQNPILMAE
FT                   AMKNAVIAGRLSYLAGRIPKRPYATASSPVDGMIQF"
FT   gene            complement(136783..137337)
FT                   /locus_tag="Sulku_0136"
FT   CDS_pept        complement(136783..137337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0136"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; InterPro
FT                   IPR004607: IPR002376; KEGG: nis:NIS_0171
FT                   phosphoribosylglycinamide formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: Phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: Formyl transferase; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase,
FT                   formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32803"
FT                   /db_xref="GOA:E4TXA6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA6"
FT                   /protein_id="ADR32803.1"
FT                   /translation="MKKIVALFSGEGTNLANLITKIHLKHAAIVCAITNNPEAGGIAKA
FT                   RSAGIPVEILDHRDFESRELYDEALVSLIQEYNPDLVVLCGFMRILTPVFTSQIRSINL
FT                   HPALLPAFKGARAIERSFESDEKVCGVSVHWVTDELDGGEIILQKSFTKNPNDNLEEFT
FT                   AKIRAIEHEVLPLSILKVLHD"
FT   gene            complement(137334..138725)
FT                   /locus_tag="Sulku_0137"
FT   CDS_pept        complement(137334..138725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0137"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro IPR017953:
FT                   IPR004443: IPR000631; KEGG: nis:NIS_0170 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0031;
FT                   YjeF-family domain-containing protein; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: carbohydrate kinase, YjeF
FT                   related protein; PFAM: Carbohydrate kinase; YjeF-related
FT                   protein N-terminus; TIGRFAM: yjeF N-terminal region; yjeF
FT                   C-terminal region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32804"
FT                   /db_xref="GOA:E4TXA7"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA7"
FT                   /protein_id="ADR32804.1"
FT                   /translation="MQNLYLDVSPLDQRGVTKFALSEEVMMEHAAMAMAHLIRARFNAN
FT                   SSVLIVCGSGNNGADGLALARLLEGDFHISLHIPFGASSPLAHLQRDRVEALGLKHAPI
FT                   EGDYDVIVDALFGSGLNRPLGPTAIEALILMNGMSGLKIACDVPSGLYAEGTFDTNVFY
FT                   ADITVTMGAYKRSLFSDGAKEVCGEIIVADLGVHKKRYETPSPWKLLESQDLSLPNRIR
FT                   ASSHKGSYGHLAVVCGEKAGASVIAGSAALRFGTGLVSLISNENVTIPYELMQSHSIPS
FT                   TATAIALGMGLGVEFCDDELSSLLDNTLPLVLDADIFYHPMFSKLLKRTSLVLTPHPKE
FT                   FTQILRLTGIADIDVSALQSNRFTYVEKFCSAYPNTVLVLKGSNVIIGQGEEFYINPLG
FT                   TVALAKGGSGDVLSGLIGALLAQGNTPLEAAIQGSLAHTLAAQKFDKNNYALTPFDLIE
FT                   RITCL"
FT   gene            138770..139738
FT                   /locus_tag="Sulku_0138"
FT   CDS_pept        138770..139738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0138"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro IPR004800: IPR000644:
FT                   IPR001347; KEGG: nis:NIS_0063 arabinose-5-phosphate
FT                   isomerase; PFAM: sugar isomerase (SIS); CBS domain
FT                   containing protein; PRIAM: Arabinose-5-phosphate isomerase;
FT                   SMART: CBS domain containing protein; SPTR:
FT                   Arabinose-5-phosphate isomerase; TIGRFAM: KpsF/GutQ family
FT                   protein; PFAM: CBS domain; SIS domain; TIGRFAM: KpsF/GutQ
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32805"
FT                   /db_xref="GOA:E4TXA8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA8"
FT                   /protein_id="ADR32805.1"
FT                   /translation="MNNDYIAIAKNTLEIEAQALREGSERLGEEIARAVEIILSCKGKL
FT                   VITGVGKSGLIGAKIAATFASTGTPSFFLHPTEALHGDLGMIGREDAVLAISYSGESPE
FT                   LSSILPHIKRFDIPLIGMTRNAASTLGRYSDEVININVEHEACPLDIAPTSSTTLTLAM
FT                   GDALAVCLMKARNFQKEDFASFHPGGALGKRLFVKVSDLMRTENLPIVNENTPLKEAIL
FT                   ILSEGRLGTVMLTNNEGKLSGLLSDGDIRRALMSESFSLDASAKAYATKKPLVIDDASM
FT                   LASDALVLIETKKIQLLVVTDRAGVIQGALHLHTLVEAGIS"
FT   gene            139735..140682
FT                   /locus_tag="Sulku_0139"
FT   CDS_pept        139735..140682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0139"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthase; InterPro
FT                   IPR018496: IPR000748: IPR002942: IPR006145; KEGG:
FT                   tdn:Suden_0212 pseudouridine synthase, Rsu; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   SMART: RNA-binding S4 domain protein; SPTR: Pseudouridine
FT                   synthase; PFAM: RNA pseudouridylate synthase; S4 domain;
FT                   TIGRFAM: pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32806"
FT                   /db_xref="GOA:E4TXA9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXA9"
FT                   /protein_id="ADR32806.1"
FT                   /translation="MMRLNKFIAHYSTYSRREADQAILDGYVRIDGEIETNPATQVDER
FT                   HANVMISGNKITPTDQFTVIVYNKPRGELVTKKDPQGRKTIYDSLAKQYRHYIPIGRLD
FT                   FASEGLLLLTDASRVATALMTSKMERVYKIKIKGPVTEAMKVAMGEGLELEDASAGAHE
FT                   HAEAGPMSFAPFYAYQVQKDQGDYSVLKVAIGEGQNRELRRFFAHFGAEVVDLKRLSFG
FT                   GIDLNNLPTGKVRFLERSEYASLREFLDALEKAEKQKQKSEKKAPRAEGKSEFKPAKTF
FT                   TKEKSKAKPKSSNEPFGTNKYKPEKKFAKGEHKK"
FT   gene            140679..141077
FT                   /locus_tag="Sulku_0140"
FT   CDS_pept        140679..141077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0140"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="COGs: COG0432 conserved hypothetical protein;
FT                   InterPro IPR001602; KEGG: nis:NIS_0065 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0047; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family UPF0047; TIGRFAM: secondary
FT                   thiamine-phosphate synthase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32807"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB0"
FT                   /protein_id="ADR32807.1"
FT                   /translation="MKTLKFPTSHKTQLMDISAEVREAVIMSGIKEGICVVFTPHTTGS
FT                   IFLFENADQNLRRDLLSALSKVIPSDAQYAHVGSNAAAHLKSSRMGASVSIPVHEGRPM
FT                   FGKWQGVFFGEFDGPRQEREVIIKVIAG"
FT   gene            141080..142258
FT                   /locus_tag="Sulku_0141"
FT   CDS_pept        141080..142258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0141"
FT                   /product="Recombination protein MgsA"
FT                   /note="COGs: COG2256 ATPase related to the helicase subunit
FT                   of the Holliday junction resolvase; InterPro IPR003959:
FT                   IPR003593; KEGG: tdn:Suden_0211 recombination factor
FT                   protein RarA; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase; SPTR: AAA ATPase; PFAM: MgsA AAA+ ATPase
FT                   C terminal; ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32808"
FT                   /db_xref="GOA:E4TXB1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB1"
FT                   /protein_id="ADR32808.1"
FT                   /translation="MADLTYLLRPKKFDDVVGQPHLCSPDSPLRSLCENGNLTHSFFYG
FT                   PPGCGKTTLARIIAEVMGLPFYEFNATSLKIEQLRKIFDQYENSLTKPLIFIDEVHRLA
FT                   KNQQEVLLPVMEKNSVLVIGASTENPYFSLTAAMRSRSLLFELYSITHEALDDLLVRTA
FT                   IEMDEEAREYLIASSGGDARAMLKLLEVSCALNKPITLGLLKSLRPAAQSLGSSEAGVH
FT                   YDLASALIKSIRGSDPDAAIYYLARLIEGGEPPEFIARRLVILSSEDVGNANPQALTLT
FT                   TSAMMSVKQIGYPEARIILAQAVIYLCASPKSNTAYNAINSAQQAVKNGVILDIPTHLR
FT                   QQHKGYLYPHDFGGWVDQQYLSKPLKFVEFKNSGYEAKMGEWIQKVWNRSKV"
FT   gene            complement(142387..145887)
FT                   /locus_tag="Sulku_0142"
FT   CDS_pept        complement(142387..145887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0142"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="COGs: COG1410 Methionine synthase I
FT                   cobalamin-binding domain; InterProIPR011822: IPR003726:
FT                   IPR000489: IPR004223: IPR 006158: IPR003759; KEGG:
FT                   sun:SUN_1818 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase; PFAM: homocysteine S-methyltransferase;
FT                   dihydropteroate synthase DHPS; Methionine synthase
FT                   B12-binding module cap domain protein; cobalamin
FT                   B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region; SPTR:
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: Pterin binding enzyme;
FT                   Vitamin B12 dependent methionine synthase, activation
FT                   domain; B12 binding domain; Homocysteine
FT                   S-methyltransferase; TIGRFAM:
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   methylmalonyl-CoA mutase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32809"
FT                   /db_xref="GOA:E4TXB2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB2"
FT                   /protein_id="ADR32809.1"
FT                   /translation="MSVKNTLLETISRRPLIIDGAMGTQLQERADKIPESAWEGLEGCN
FT                   ELLNVTCPEVMSDIFHAYLTAGADLITTNTFGAFSWVLDEYGIGHRAYELSRAGAAVCK
FT                   AECDKFSTSDHPRYVLGSIGPGTKLPSLGHIHYDEMYEGYLECCLGLIDGGCDIFLLET
FT                   CQDPLQIKAALHACEAANKERTTALPIMVSVTIELAGSMLIGTDAATIATIMEPFDIIS
FT                   LGFNCGTGPEQYAKHVRTLSEVWGKPISVHANAGLPQNRGGYSYYPMGPDEFANLQRDF
FT                   LNYDGVSFLGGCCGTTPQHIRALVDKVSRVAPKKPSGETKPSIASLFNTVELIQTPAPL
FT                   LIGERSNSTGSKAFRELIIASDYEGTLSVGQAQVRDGAHCLDVNVEFAGRDGAVDMSHV
FT                   MRLYNQKIPLPLMPDATRVNTMEEALKCIGGKPIINSVNLEDGEERLDAICSLAKKFGT
FT                   ALVCLVIDEKGMAKTTEDKMRIADRIYDLCVNRHGIDPRNLMFDMLTFTVGSGDLEYRD
FT                   AAIQTLEAIRQLHFKYPNVGSTLGLSNISFGLSTNARVFLNSVFLHHCIEAGMTSVIIN
FT                   VKHIIPLSKMSEEDRAICEELLFHPDDQSLFKFIGHFSDKTIDNSKNDEAYEALSDEEK
FT                   IAKLLLDGDKERMIPLVERVRLTISPDKIVNEILIDAMKVVGELFGSGKMQLPFVLQSA
FT                   ETMKTTVDYLNPYLSKQEKDTDTTLVIGTVKGDVHDVGKNLVDIILSNNGFKVINIGIK
FT                   TELEEYLEVMKSKDIHAIGMSGLLVKSTQVMKDNLETMAGMGITTPVLLGGAALTRSFV
FT                   DDFCRPIYQGPIFYCRDAFDGVIAMSRIEKYNADPSIGLDTRLGGDMVEKSVKEVIDVV
FT                   IPPFHELKMPSREVKIPTPPFWGRRVLRKEQLDFDMVCEWINKRSLFKLHWGYKRAGMP
FT                   VDEYKKLLETKVYPAYERIKREIVKRGLFDPTIIYGYYPVRSSDQELLIFDESSGWNID
FT                   ENANRQPLDEVIGNAKYVFEFPRQRKVPHRALSDFFTHTRDDVLPLTCVSVGDKFSEYE
FT                   KELYAANEYLEYNLVHGFGVELAEALAEVAHKQIRLDLNIASDDEGFSLRDVRMNRYAG
FT                   ARYSFGYPACPDLEPSRIIFDLLRPEEFGITLSETFQIHPEQSTTALVVHHKEATYYNI
FT                   "
FT   gene            145987..148578
FT                   /locus_tag="Sulku_0143"
FT   CDS_pept        145987..148578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0143"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR022272: IPR004358: IPR005467: IPR001638: IPR
FT                   003594; KEGG: abu:Abu_1637 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   extracellular solute-binding protein family 3; SMART:
FT                   ATP-binding region ATPase domain protein; extracellular
FT                   solute-binding protein family 3; SPTR: Histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Bacterial extracellular solute-binding proteins,
FT                   family 3; NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32810"
FT                   /db_xref="GOA:E4TXB3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB3"
FT                   /protein_id="ADR32810.1"
FT                   /translation="MKKLFLFLLIFTVSLWGVEKVTLQLPWLHQFQFAGYYVAKEKGYF
FT                   SDEGLDVTILDANKKEASLKSVLDGRAQYGVGHSSLIVNYINGAPIVLMAAAYQSSPMI
FT                   LLTRKDANITGPKDLKNKRVMLTDDMVQWAEIQAMLRSIGMSTKDLIVQPHSYDSMSLS
FT                   RRETDAMVAYVSNEPFILKQAGLETYAIDPKNYGFNYYSDILFTSKEETVRHPERVEAF
FT                   YNASIQGWLWAFDHIEETAALIYRKYNPQHKSLEALIYEGKVLKELAFRPNTPFGTIDQ
FT                   SRLELIAQGYRLMGAVKAIPPFEPLLYKHDKLHLSDQEKEWLKMHPVIRVGVDHNWPPI
FT                   ESVDEKGRYTGISASYLHFLEKRLGVRFDVDYSRPLWSDSIRAVNNKELDMLSCAAIAD
FT                   NRNDKLRFSRPYLKQTVVIVTNSNVGYVNDLNDLNGKKVAVVRSYASEEYLRTYYPKII
FT                   PVLADSSLEALKKVASGEAYACIEGLSVVSYLIERHNLKNIKVVGETPFRYELAFAFRK
FT                   DWGIMASISDKVLASVTPAEYEEIHGHWLEMKHDEPVNYRLVWGIAGFMALLFFLVAYK
FT                   NHRLDVLVRQRTGELETFNQRLQDEVDKAVEKNRKQEKLLMQQAKMAEIGSMLESIAHQ
FT                   WRQPLNILGLSMTRLNLSCALSGKSESAKVIEIAEAQIEYMSQTIDDFRNFFKQDRSQI
FT                   PVNIAAMVNDVEALLGPLLVRKKITVKHEIDPLIEVLVYPNELKQVIINLVNNAREAIE
FT                   QRRGNERIIYIRCENDKRYCTISIEDTGGGIDASIIDKIFDPYFTTKFESQGTGIGLYM
FT                   AKMIIEKHFLGKLSVYNTSKGACFEIRLNREQKKDTEENKVLKRESTDGSL"
FT   gene            148820..149356
FT                   /locus_tag="Sulku_0144"
FT   CDS_pept        148820..149356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0144"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; InterPro IPR002569; KEGG: cts:Ctha_2671 peptide
FT                   methionine sulfoxide reductase; PFAM: Methionine sulfoxide
FT                   reductase A; PRIAM: Peptide-methionine (S)-S-oxide
FT                   reductase; SPTR: Peptide methionine sulfoxide reductase
FT                   msrA; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Peptide methionine sulfoxide reductase; TIGRFAM:
FT                   methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32811"
FT                   /db_xref="GOA:E4TXB4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB4"
FT                   /protein_id="ADR32811.1"
FT                   /translation="MGTMEKALIGGGCFWCIEAVYNRVIGVQSAISGYAGGARKHPSYE
FT                   QVCSGATGHAEVVEVTYDSAVISYEEILEIFWAIHDPTTLNAQGADRGTQYRSVIYYYD
FT                   EVQKEKAEASIAQAQKNWTDPIVTERSPAPEFFVAEEYHQDYYSEHPTQGYCYAVIAPK
FT                   IEKFMKKFGDKVKRS"
FT   gene            complement(149355..149464)
FT                   /locus_tag="Sulku_R0009"
FT   ncRNA           complement(149355..149464)
FT                   /locus_tag="Sulku_R0009"
FT                   /product="RNA component of signal recognition particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            149519..150304
FT                   /locus_tag="Sulku_0145"
FT   CDS_pept        149519..150304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_2211 hypothetical protein; SPTR:
FT                   Spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32812"
FT                   /db_xref="GOA:E4TXB5"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB5"
FT                   /protein_id="ADR32812.1"
FT                   /translation="MIYLITALDAEAKPLWDHYRLKRDSSLPYTLYRNDEMTLLVGGIG
FT                   KANTMMALSALLGWRIPETGDILINIGICGAPSEYTIGEALLIHQIFEGERRYYPDILY
FT                   PHTLRESSLVCINSPQSIVRDYPVDMESSALFQAASRFFKLHQMAFIKIVSDHFTPESV
FT                   TKEGAMDLVRSHVKTLDELIRNLQSVQVDSLLFTSEERQKIDALKGHFTKSQGDALEDA
FT                   LNYFRLKNPEQSLKIDHDIPHSKRERSQLLETLIIALTA"
FT   gene            150273..151292
FT                   /locus_tag="Sulku_0146"
FT   CDS_pept        150273..151292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0146"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; KEGG:
FT                   csc:Csac_0382 DNA repair photolyase-like protein; SPTR: DNA
FT                   repair photolyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32813"
FT                   /db_xref="GOA:E4TXB6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB6"
FT                   /protein_id="ADR32813.1"
FT                   /translation="MKHSSLPSQPKLFSHLYIERGILEHPQTQMIRVKFSDSQVIVIEH
FT                   YKEVFNRSAQSFAAQSSAKKLILARKEGKFLHEGSQYSDGFGIKQFFYASSVMGCLYDC
FT                   DYCYLQGLYPSANTVLFVNLEDAFEQLTPYLGEDTLVATSYDTDTMAIESLTHQTKSWL
FT                   DFAAQNEKLHLEIRTKSANIKALKNNIPNDRVTLAWTLSPQEIIDRYEHATPSLQKRLS
FT                   AVREAIQLGWKVRLCIDPVIYTENFDSLYPQLIETIFATIDPESIEHLTLGSFRMSQSH
FT                   LRSLKKLRRSDVAFFPYTVKDEMATYPETVESYILETLLAKATQYLPQERIRTWQRQS"
FT   gene            151274..151960
FT                   /locus_tag="Sulku_0147"
FT   CDS_pept        151274..151960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0147"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002347: IPR002198;
FT                   KEGG: ant:Arnit_0526 short-chain dehydrogenase/reductase
FT                   SDR; PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Probable short-chain dehydrogenase; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32814"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB7"
FT                   /protein_id="ADR32814.1"
FT                   /translation="MATAIVTGTSSGIGEAIAQILLQNGYNVIGLSRRRGDIHHPLFEH
FT                   LPCDLSDLAVVDILQKKLTEIEDLEILVNAAGFGRFEPHEELSSKTITDMISLNLTTPI
FT                   LLANALMRPLKKTKGMIINITSIEATRHSKFSALYSATKAGLRAFGLTLFEETRNAGVK
FT                   VVTINPDMTETPFFDGFRFGVGKEDDTKLLTSDIAQAVQYLLDTREGICVTEMTIRSQR
FT                   FGITKK"
FT   gene            152062..153774
FT                   /locus_tag="Sulku_0148"
FT   CDS_pept        152062..153774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0148"
FT                   /product="flagellar hook-associated 2 domain-containing
FT                   protein"
FT                   /note="COGs: COG1345 Flagellar capping protein; InterPro
FT                   IPR003481: IPR010810: IPR010809; KEGG: wsu:WS0150 flagellar
FT                   capping protein; PFAM: flagellar hook-associated 2
FT                   domain-containing protein; flagellar hook-associated
FT                   protein 2 domain-containing protein; flagellin hook IN
FT                   repeat protein; SPTR: FLAGELLAR HOOK-ASSOCIATED PROTEIN 2;
FT                   PFAM: Flagellar hook-associated protein 2 C-terminus;
FT                   Flagellin hook IN motif"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32815"
FT                   /db_xref="GOA:E4TXB8"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB8"
FT                   /protein_id="ADR32815.1"
FT                   /translation="MSGTINSLGLGSGVLTADLIDKLKASDEAVSVTPFDSKISLNKQK
FT                   SQALDLLNSLLTTFKSSVNALDNDSLYQKRSVSGTNDGVSVSASAGSQIRDFSIGITNI
FT                   AKKNVVQSASFSSNTDKIANTDGKLNLNISGKNYTIDYTATTTLDDIKQSINDAAGSDV
FT                   SASVLQTGTSAYSLVVTSKVTGKEQTISLTDISGNLKNNNLVSEGVASGSFIAADDFIA
FT                   NTGAAGTMSVNVGGVGYNFAYDDTTTLEQMVDNINNDSTLSGKISASIVQYGANDYRMV
FT                   LTPKDGTEGSAITITDTPSSGTGLVGVMTGTTDKGGLVNTVQNGQDASFTFDGIAMTRS
FT                   TNTITDIATGLTINLLQDGGSSNISISQDRDQIATELEGLVSSYNTLQQQLDSMLSSDS
FT                   EAGTVGIFNGDNTIRNIGREITKMINSVDSKGSSLANYGIDLTRDGTMTFDKSVFTEKM
FT                   DADPEGTEAFFSGKTTVNSVGSETYTKGVFTTLSDLMTSYVGSSGTVTNLVTDTKSATT
FT                   SLNEERAKAVKLLEARYATLTAKFAAYDSMISKLNSQFSALQQQIDAAANANN"
FT   sig_peptide     152062..152136
FT                   /locus_tag="Sulku_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            153761..154003
FT                   /locus_tag="Sulku_0149"
FT   CDS_pept        153761..154003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0149"
FT                   /product="co-chaperone HscB"
FT                   /note="KEGG: reh:H16_A1162 co-chaperone HscB; SPTR:
FT                   Chaperone protein (HscB)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32816"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB9"
FT                   /protein_id="ADR32816.1"
FT                   /translation="MPIIKINVEEWSEAFQKAINSKNMGQIQALIRSLPVFEREEEIRD
FT                   VLLQTMDAEATVLEIRERLVEERKRHSHFYKNNVV"
FT   gene            154053..155060
FT                   /locus_tag="Sulku_0150"
FT   CDS_pept        154053..155060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0150"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /note="COGs: COG1086 nucleoside-diphosphate sugar
FT                   epimerase; InterPro IPR020025: IPR003869; KEGG:
FT                   sdl:Sdel_2208 UDP-N-acetylglucosamine 4,6-dehydratase;
FT                   PFAM: polysaccharide biosynthesis protein CapD; SPTR:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase; PFAM:
FT                   Polysaccharide biosynthesis protein; TIGRFAM:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32817"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC0"
FT                   /protein_id="ADR32817.1"
FT                   /translation="MLNGKNILITGGTGSFGKQFVKTILKRYKPNKIIIYSRDELKQYE
FT                   MAQRFNDPCMRYFIGDVRDLSRLESAMSGVDYVVHAAALKHVPIAEYNPMECIKTNING
FT                   AQNVIDAALHCGVSRVIALSTDKAASPINLYGATKLASDKLFVAANNIRGGKDIRFAVV
FT                   RYGNVLGSRGSVVPFFQKLIAEGAKELPITDERMTRFWITLQEGVDFVLKNFQRMHGGE
FT                   TFIPKIPSMKVVDVATAIAPHLPHKNVGIRPGEKMHEVMCPRDDSHLTLEFHDHYVIKP
FT                   TIQFTEAADFAKNNCGEIGTPVEYGFKYSSETNTDWLTPEALLEKIALTENEEK"
FT   gene            155057..156184
FT                   /locus_tag="Sulku_0151"
FT   CDS_pept        155057..156184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0151"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653: IPR020026; KEGG: sdl:Sdel_2209
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminotra nsferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   SPTR:UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminot
FT                   ransferase; TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family; TIGRFAM:
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32818"
FT                   /db_xref="GOA:E4TXC1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC1"
FT                   /protein_id="ADR32818.1"
FT                   /translation="MIPYSTQFIEEDDIAAVVDVLKSSHLTQGAKVEEFEAAIAEYVGA
FT                   RFCVAFNSATSALLGAYAVAEIGENDEIITTPISFVATSNMAIALGAKPVFCDVKTDGN
FT                   IDESLIESLITPRTRALVPVDFAGKPVAIEAIKAIAKKHNLLVIEDSSHALGSGIGTQR
FT                   IGSFADMTIFSFHAIKPITTGEGGAVVTNDEAFAQKLKLFRSHGIIKKQLWNSDMVSLG
FT                   HNFRLTEFAAALGLSQLHKLDRFLATRNEIARYYDERFAGHKLFATIAIDADEQSARHL
FT                   YPLLLSPALHCSKEDVFTELQTRGLGVQVHYKPIYQNSFYKERFGEQRLANTEHFYKSS
FT                   LSIPCHQKMSMEDARIVADTVLEVMEHYSHRECSF"
FT   gene            156195..156881
FT                   /locus_tag="Sulku_0152"
FT   CDS_pept        156195..156881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0152"
FT                   /product="pseudaminic acid CMP-transferase"
FT                   /note="COGs: COG1083 CMP-N-acetylneuraminic acid
FT                   synthetase; InterPro IPR020039: IPR003329; KEGG:
FT                   psa:PST_3838 acylneuraminate cytidylyltransferase; PFAM:
FT                   acylneuraminate cytidylyltransferase; SPTR: Putative
FT                   Acylneuraminate cytidylyltransferase; TIGRFAM: pseudaminic
FT                   acid CMP-transferase; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   pseudaminic acid CMP-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32819"
FT                   /db_xref="GOA:E4TXC2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR020039"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC2"
FT                   /protein_id="ADR32819.1"
FT                   /translation="MRVAIIPARGGSKRIPRKNIKTFAGLPIIAHSIKAAQESGLFDRI
FT                   VVTTDDEEIADVARRYGAEIPFMRPKELSDDHTATIPVIAHAIQTLQNDSVIEYACCIY
FT                   ATAPFIRAEDIRDAHNALITHNKQYAFPVTTFPFPIQRGVKRDKEGNIEMFYPEHFATR
FT                   SQDLEEAYHDVGQFYWGTAEAWLEGRAIFSDAATTIVLPRHLVQDIDTPEDWTRAELMH
FT                   KVLQEL"
FT   sig_peptide     156195..156299
FT                   /locus_tag="Sulku_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            156878..157741
FT                   /locus_tag="Sulku_0153"
FT   CDS_pept        156878..157741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0153"
FT                   /product="pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /note="COGs: COG3980 Spore coat polysaccharide biosynthesis
FT                   protein predicted glycosyltransferase; InterPro IPR020023;
FT                   KEGG: sdl:Sdel_2211 pseudaminic acid
FT                   biosynthesis-associated protein PseG; SPTR: Pseudaminic
FT                   acid biosynthesis-associated protein PseG; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated protein PseG;
FT                   TIGRFAM: pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32820"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC3"
FT                   /protein_id="ADR32820.1"
FT                   /translation="MNLLIRADSSSSIGLGHIMRDVVFAAQYSQDSVRFACQNLSGNII
FT                   DHIPYPVHILDSNDPEELIALIREQRIDRVVFDHYGIDEIFEKKIKEACGVSILSFDDT
FT                   YEKHYCDILLNHNISADKNRYVGLVPPHCELRCGGEYTLIRDEFKTEKQVKREKLYDVF
FT                   IAMGGTDPTNATMNILSTLSDEMRVCIVTTSGNPHVSELETCVQERKNITLEIDSARIA
FT                   QLLHQSRLAIITPSVMVHEVLFMEVPFIAVQTAANQEDMVVYLQQEGYIVLKEWDAGAI
FT                   ARFYNA"
FT   gene            157707..158174
FT                   /locus_tag="Sulku_0154"
FT   CDS_pept        157707..158174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0154"
FT                   /product="pseudaminic acid biosynthesis N-acetyl
FT                   transferase"
FT                   /note="InterPro IPR020036: IPR000182; KEGG: sdl:Sdel_2212
FT                   pseudaminic acid biosynthesis N-acetyl transferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: Pseudaminic acid
FT                   biosynthesis N-acetyl transferase; TIGRFAM: pseudaminic
FT                   acid biosynthesis N-acetyl transferase; PFAM:
FT                   Acetyltransferase (GNAT) family; TIGRFAM: pseudaminic acid
FT                   biosynthesis N-acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32821"
FT                   /db_xref="GOA:E4TXC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020036"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC4"
FT                   /protein_id="ADR32821.1"
FT                   /translation="MQVRLLDFTTLETQLLTMVLAWRNHSDISRWMVNTEEISIENHLR
FT                   FVESLKNRADKRYFLVQDEDRYIGVIDFTDIAQNSAEIGIYANPELRGVGEDLMRTVIE
FT                   YGFTSLSVRTLIASVFADNERAKHLYEKFDFIETNRTHYNGREMITMELKK"
FT   sig_peptide     157707..157769
FT                   /locus_tag="Sulku_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            158171..159205
FT                   /locus_tag="Sulku_0155"
FT   CDS_pept        158171..159205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0155"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="COGs: COG2089 Sialic acid synthase; InterPro
FT                   IPR020030: IPR006190: IPR013132: IPR013974; KEGG:
FT                   tmt:Tmath_0718 pseudaminic acid synthase; PFAM:
FT                   N-acetylneuraminic acid synthase domain; SAF domain
FT                   protein; PRIAM: N-acetylneuraminate synthase; SPTR:
FT                   Pseudaminic acid synthase; TIGRFAM: pseudaminic acid
FT                   synthase; PFAM: SAF domain; NeuB family; TIGRFAM:
FT                   pseudaminic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32822"
FT                   /db_xref="GOA:E4TXC5"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC5"
FT                   /protein_id="ADR32822.1"
FT                   /translation="MNIAHHNTDEKVFIIAELSANHNGSLDTALRTITAMKDAGADAVK
FT                   LQTYTPDTITLDCDSEMFTISQGTLWDKRKFHDLYAEAMTPWEWHPILFDHAKSLGMAA
FT                   FSSPFDVSAVDFLESLDVPAYKIASFEITDIPLIEYTAAKGKPIIISTGIATLSDIEEA
FT                   LDACRRVGNEQIMLLKCTSAYPAALEEMNLLTIADMKIRFGVNVGLSDHTMSLAAPIAA
FT                   VALGARVIEKHFILDRGMGGADSAFSLEPHEFKMMVDAVRDTEKLLGKVTYELSPKSLK
FT                   SREFSRSLFIAEDVKEGEVISDKNVRSVRPGFGLAPKHLKEILGKTFKAGAIKGTPLSW
FT                   DHIG"
FT   gene            159202..160206
FT                   /locus_tag="Sulku_0156"
FT   CDS_pept        159202..160206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R0679 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32823"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC6"
FT                   /protein_id="ADR32823.1"
FT                   /translation="MTISVVSHDAGSSEILCALIREYFDLASWHIFALPQSPMGRLCER
FT                   YTLPFTPIGDPEQQFRAIQPDLLLFGTGWQEKIERPYVRFCKEHAIMSVAFLDHWSNYR
FT                   ERFGFPEGGWEENLGDFTAVSDQKALSLAEAFNLPNPVGFQNFYLRDTIAQARQKEPHS
FT                   NNNLLFLSEPTDAVALRTYGDKNYWGFTQYSALEEILKNFHRFECAGLTIRLHPSDNGS
FT                   GYKKILKAYPHIRVQINDAAVCELSDQLLSAKMIIGFDTMALYIAALLGRPVLSYLPSK
FT                   NREFLLPLPNDRQVRSLLKIPPKLLTASTLSSDDFGMDFALFIKTIVVKERNV"
FT   gene            160199..161146
FT                   /locus_tag="Sulku_0157"
FT   CDS_pept        160199..161146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0157"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: mag:amb3807 dehydrogenase and
FT                   related protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Predicted dehydrogenase and related protein; PFAM:
FT                   Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32824"
FT                   /db_xref="GOA:E4TXC7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC7"
FT                   /protein_id="ADR32824.1"
FT                   /translation="MYKALIIGAGSIGGLIDSPTSKTVASHAHAYKKHPDTQLYAICEP
FT                   SELNVFAFMERWGEVHHYGSIDEISTDELYDIVSISSPTKSHFYDLITLLKRSDSSMIL
FT                   CEKPLVATQEELSSLSTLLMHSDKKILVHFVRRYNSAFINLAERIQKGEFGKSLGFQGV
FT                   CTKGLLHNGSHMIAVLSHFLGNVTSIKPFRASFCHDDLCGDFGISLERGDGAISVLSHP
FT                   PYSLFEITFWFETGVIKILDGGDKIEIYSRVPSTYEGYFSLALQESMTTNLSNYAYDSV
FT                   EFLLRKSKETCKNILSEHFHIHKMIFQTLAKVYP"
FT   sig_peptide     160199..160288
FT                   /locus_tag="Sulku_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            161143..162444
FT                   /locus_tag="Sulku_0158"
FT   CDS_pept        161143..162444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0158"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653; KEGG: phe:Phep_3939
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PRIAM:
FT                   Glutamine--scyllo-inositol transaminase; SPTR: Aspartate
FT                   aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32825"
FT                   /db_xref="GOA:E4TXC8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC8"
FT                   /protein_id="ADR32825.1"
FT                   /translation="MKKLAINGGEKLRTTPFPAYNTIGIEEEEAVLRVLRSGKLSTFLG
FT                   TWHDDFFGGPEVRALESEWAAYFGVKHAISVNSATSGLYAAIGACGISPGDEVIVSAYT
FT                   MSASATAALVYGAIPIFADIEEDFYCLDVKSIETKITPRTKAIIVVDIFGQPYDVEAIN
FT                   TLAKKYNLFVIEDTAQAPGAMLGEKYAGTLGDIGVYSLNYHKHIHSGEGGIIVTDDDVL
FT                   ADKIRLIRNHAEAVLSARGIKDKSELINMVGYNYRMTEIEASIARCQLKKLPSLLTQRL
FT                   ENTAYFNEQLAQIPCIKPTKIREGAKHAFYVHPLQFDAEVAGMHRNRFIDAVKAELPPT
FT                   LLREESVVLLSYGYVKPLYLQPLYQEKIAFGRDGYPFNLSEVTYPKGLCPITEEMHFNR
FT                   LVTHEFMRPGMGKADMDDVVQAFVKVWDNRAELV"
FT   gene            162441..162983
FT                   /locus_tag="Sulku_0159"
FT   CDS_pept        162441..162983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0159"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   phe:Phep_3937 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: Acetyltransferase,
FT                   gnat family; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32826"
FT                   /db_xref="GOA:E4TXC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC9"
FT                   /protein_id="ADR32826.1"
FT                   /translation="MKFEGERVYLRPIELSDADGAYPLWLNDPDVCRYNSHGDTLYTKE
FT                   MAQSYIKSVMDNPSTAVFAICLRENDRHVGNIALQQISLKNRNAELAILIGDPSVHGKG
FT                   IGYEAGKLLVEYAFSTLKLHRLYCGTHEANIGMQKLALKLGMSEEGRRREALWKNGVLA
FT                   DIVEYGLLNTVSEKETL"
FT   gene            162980..164113
FT                   /locus_tag="Sulku_0160"
FT   CDS_pept        162980..164113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0160"
FT                   /product="N-acetyl sugar amidotransferase"
FT                   /note="InterPro IPR020022; KEGG: tai:Taci_0673 LPS
FT                   biosynthesis protein; SPTR: LPS biosynthesis protein;
FT                   TIGRFAM: N-acetyl sugar amidotransferase; TIGRFAM: N-acetyl
FT                   sugar amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32827"
FT                   /db_xref="GOA:E4TXD0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD0"
FT                   /protein_id="ADR32827.1"
FT                   /translation="MTKQMIFTDTPPDNYGEPLYKEYLQYCTRCCMPSSNEGMQFDELG
FT                   ICLACRAQEQKMRINWKKSEEVLRETLESYKERSGDNYDCIIPISGGKDSVFQLHVLKK
FT                   VYGMKPLAVTFNHNWYSEIGRYNLENALEKLEIDHIMFTPNKALVKKLFVKSFYKIGDS
FT                   CWHCHAGVGAFPLQIAVKFNIPLLIWGESVCESSGRADFRDNVQKFDRDYFTKVSAKLY
FT                   PEQMIDEEITRKDLKPFELPSFEDIERVGVVGLHLGDYLFWDDERQMEFIKKEYDWREE
FT                   HRPGHYKGFKGNECKFETLHDHMKYVKRGFGRGTDQASADVRAGLLTREEGFEIAKKYD
FT                   QQRPAYLDEFLDMANITEEEYNNVLKAMRQGKFRECR"
FT   gene            164110..165459
FT                   /locus_tag="Sulku_0161"
FT   CDS_pept        164110..165459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0161"
FT                   /product="Amidase"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR000120; KEGG: pub:SAR11_0263 amidase; PFAM: Amidase;
FT                   SPTR: Glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADTsubunit A); PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32828"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD1"
FT                   /protein_id="ADR32828.1"
FT                   /translation="MRLSDCTATELLERLKTNSTTPKEIAQSCIERIRAIDPMVNAWEY
FT                   FDEAAIEAQLAKIGTYNRDDYPLYGIPVGVKDIYNTFDMPTQMGSPLWSDFTPGNDARM
FT                   IHYLRRSGAVMLGKTVTAEFAVHYQDKTRNPHDLSRSPGTSSSGSAVAVATGMVPVALG
FT                   SQTAGSISRPASYCGIYGFKPTFGVLPRIGVLKTTDSLDTLGFFARSVSDLALMFEASR
FT                   VHGENYEFVHQYIDNYVSVPDKVYRIGIIKHPKWDLASESAKNAFEAWCARLKSPCLQV
FT                   QTVTLPQFCDTIHATHQTIYDKSLAYYFKEEYAKHTLMSPIFYDIIQDGLRITKEEYQD
FT                   ALEKQSRETREFDAWMDSYDILITLATADEAPIGLTTSDIPDANLIWTYLGLPIATLPV
FT                   LKGENHLPIGVSAVSRKYNDKLLLDFLQYLALLGILPMVSPITPNSKSKE"
FT   gene            165466..166086
FT                   /locus_tag="Sulku_0162"
FT   CDS_pept        165466..166086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0162"
FT                   /product="pseudaminic acid biosynthesis-associated
FT                   methylase"
FT                   /note="InterPro IPR020027: IPR013217; KEGG: mhu:Mhun_3095
FT                   hypothetical protein; PFAM: Methyltransferase type 12;
FT                   SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated methylase;
FT                   TIGRFAM: pseudaminic acid biosynthesis-associated
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32829"
FT                   /db_xref="GOA:E4TXD2"
FT                   /db_xref="InterPro:IPR020027"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD2"
FT                   /protein_id="ADR32829.1"
FT                   /translation="MSKFSTEQEKFWAGEFGDDYISRNRGENLIASNTVIFARLFQRIQ
FT                   KIESIIEFGANIGMNIHAIGNLLPKAYLSAVEINAVAVEHLKKIPDLNIYHQSILEFES
FT                   ERHYDLVFTKGVLIHIDPNELQNVYERMYKSSKRYIAMVEYHSPSPVELDYRGHKEKLF
FT                   KRDFAGELWEKYPDLTLLDYGFFYGRDPRHGQEDVNWFLFEKK"
FT   gene            166156..168156
FT                   /locus_tag="Sulku_0163"
FT   CDS_pept        166156..168156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0163"
FT                   /product="protein of unknown function DUF115"
FT                   /note="COGs: COG2604 conserved hypothetical protein;
FT                   InterPro IPR002826; KEGG: ant:Arnit_2922 hypothetical
FT                   protein; PFAM: protein of unknown function DUF115; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32830"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD3"
FT                   /protein_id="ADR32830.1"
FT                   /translation="MSAEIITEALNTFQKNLLFLERNYPELYERINLLNLLIEAEEYIE
FT                   RYALEYKEEGYFDVLELSSNELLYKENSYEHAKRVTEGVNFKRTGGIFYAQRLAAATDE
FT                   QAEYIDKSELSFHNVLWATIKIINYVKRYTSYETYMQSVDKIIFIGIGLGLYVESIADK
FT                   LKSQVVFIKEKNLEIFRLSLFVTDYEKLAVNRYLYFSITDDTEKERENFMPFLHKGNNH
FT                   NLYMKFIPFTLDYEEEVKRLQTHVFSQSYINYGYSPMLLRYIDSPRYLIREYSFLNIGR
FT                   YYVDNLFSKKPVLLLFSGPSTLKNIRWVQENSDRFIIVSALSTCRLLSSYNISPDVVMH
FT                   IDPGENTAALFEGLDIAEYFKNTVVILSANVDEATVQKFDKKSIHFIDQGTHYKRGFGT
FT                   LSAPSVGEYTYALFLILGAANMFLLGIDMALDSETLQSHGDFHPDQFTGKVDKENASLE
FT                   ASEAIEFVPGNFLEQVPTLAAYKLSIWQLEMFTDKFKQDYHRIYNLSNGALLQGCEPLR
FT                   IGEYDWGQWNVLDKKEIHQPLKDFFQSIGSTEFNEEDKGWIKYQIKTAKALEKIIKQHQ
FT                   KKKFAHPEAYLNSLTKLSIELSDMDYKTNSNLAQVYYEYFLIVLSYIYALFNTQELSNP
FT                   NKHVVQMHRMLDDQLLKISKTYLSKMESYLE"
FT   gene            complement(168199..170607)
FT                   /locus_tag="Sulku_0164"
FT   CDS_pept        complement(168199..170607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0164"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR010810: IPR001029; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: Putative
FT                   flagellin; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32831"
FT                   /db_xref="GOA:E4TXD4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD4"
FT                   /protein_id="ADR32831.1"
FT                   /translation="MGFRINTNIAAMTAHTSGVMNNRNLDESLSKLSSGLRINKAADDA
FT                   SGMVIANALRNQANSLGQAISNGNDAIGLIQTADGALNEYSKILDTIKTKAVQASSDGQ
FT                   NTSSRLAIQKDISRLMEELNTIAKTTSFNGQKLLSGSFTNKTIQMGASSNEGVNFSVAS
FT                   TEPNKIGHTSRAQLNLASEVGSVQLTMKSALTGENITMKAIDIQYNNTPENGMGALADE
FT                   INSHSGITGIRAKAVVEVTSGSAIAAGTTGSGFAINGINIGAINVKANDGDGALMAAIN
FT                   GKTTQTGVAATITDDGKITLKATDGRAIKVEGNVSDVFGGTANQLSTVGYIELVQKGAA
FT                   EFQVSGIGAGAVGGTINLSGATSMVKDSILAAGSSIAVGSTLKVGTTIGGDVNLTAATT
FT                   LVLDGTLKAGTTAAAGTTFAKGTTMGAAVNLTAAVALSADMYITAGSTLVSGTIFDAGT
FT                   LVQQDFTVNGVTYHKGDVLSSDVTLTASLTLTSDMTINVDLSGTANSSIATASTINVGS
FT                   VLGGNIVSSSTATVSEDMTLKSGSILAAASKLKAGSVLGADTVNSSAVTTYTTTDLKAG
FT                   SSLAAASTLKEGSTIGGTVINSSAITLNADMTIKAGSTLATGTVIKAGTVLMQDLTAAQ
FT                   TGASAMSAGDKVTVDITTGAAITLSADLTLLRGTGTAPTIAAGSTLMPNTENSGRVGID
FT                   AGEVTNLSSISVLNLTDAMKAIDTLDAAIGDLDTIRADLGSVQNQLTATINNISVTQVN
FT                   VKAAESQLRDVDFAAESANFSKFNILAQSGSYAMSQANAVQQNVLKLLQ"
FT   gene            complement(170830..173238)
FT                   /locus_tag="Sulku_0165"
FT   CDS_pept        complement(170830..173238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0165"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR010810: IPR001029; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: Putative
FT                   flagellin; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32832"
FT                   /db_xref="GOA:E4TXD5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD5"
FT                   /protein_id="ADR32832.1"
FT                   /translation="MGFRINTNISAMNAHSNSVMNNRNLDESLSKLSSGLRINKAADDA
FT                   SGMVIANALRNQANSLGQAISNGNDGIGLIQTADGALNEYSKILDTIKTKAVQASSDGQ
FT                   NTSSRLAIQKDINRLMEELNTIAKTTSFNGQKLLSGSFTNKTIQMGASSNEGVNFSVAS
FT                   AETNKIGHTSRATLNLASEVGSVQLTMKSALTGENITMKAIDIQYNNTPENGMGALADE
FT                   INSHSGITGIRAKAVVEVTSGSAIAAGATGTDFTINGINIGAINTKANDGDGALMAAIN
FT                   AKTAQTGVAATITDDGKMTLKSTDGRAIKVQGNVGDVFGGTANQLSTVGYIELVQKGAA
FT                   EFQVSGIGAGAVGGTINLSGATSMVKDSILAAGSSIAVGSTLKVGTTIGGDVNLSAATT
FT                   LVLDGTLKAGTTLLSATTFAKGTTTGAAFNTSAAVALSSDMFITAGSTLVSGSILDSGT
FT                   VVQQDFTVNGVTYSKGDTLTSDVTLTASLTLTSDMTINVDLSGTANSSIAAASTINVGS
FT                   VLGGNLVSSSSATVSEDMTLKSGSIIAAASKLKAGSVLGADTVNSSAVTTYTTTDLKAG
FT                   SSLAAASTLKEGSTIGGTVINSSAITLNSDMTIKAGSTLATGTVIKAGTVLTQDLTAAQ
FT                   TGAAAMSAGDKVTVDITTGAAITLSEDMTLLRGDGTAPTIAAGSTFMPNTENSGSVGID
FT                   AGEVTNLSSVSVLNLTDAMKAIDTLDAAIGDLDTIRADLGSVQNQLTATINNISVTQVN
FT                   VKAAESQLRDVDFAAESANFSKFNILAQSGSYAMSQANAVQQNVLRLLQ"
FT   gene            complement(173337..174002)
FT                   /locus_tag="Sulku_0166"
FT   CDS_pept        complement(173337..174002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0166"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: glo:Glov_0968 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32833"
FT                   /db_xref="GOA:E4TXD6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD6"
FT                   /protein_id="ADR32833.1"
FT                   /translation="MRQGFMLIEVMLAIVMAGILAAVLATMGYYTVIQGNTLKQQNSKT
FT                   MLEVIRSRLLNTASNPDNDAYFELLKEVNATVPVVIGLGKDAWGRNISYTTYDFGTHNT
FT                   NATYADNNTTSISPNANVLGRLLSRGEDGILQTNATHSSAQGDDILLEIGIGETNHMKL
FT                   YNGSEVSTQTRGYNSAIVALSTDPYPASPINGTILFLRDTNVTKIYDSNTSDWIQISP"
FT   sig_peptide     complement(173940..174002)
FT                   /locus_tag="Sulku_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(174003..175043)
FT                   /locus_tag="Sulku_0167"
FT   CDS_pept        complement(174003..175043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0167"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR018076; KEGG: dat:HRM2_22330 PilC; PFAM:
FT                   Type II secretion system F domain; SPTR: Type II secretion
FT                   system protein; PFAM: Bacterial type II secretion system
FT                   protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32834"
FT                   /db_xref="GOA:E4TXD7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD7"
FT                   /protein_id="ADR32834.1"
FT                   /translation="MKPDVLTLLKALQLSLENGKSLTNALNLLQNTAKDKDERAIYINI
FT                   TRSIQEGASFSNAIEKYISPSPDIIQFVAMAEKGGGFVKTLKSVVNYLEIKNRFHQESN
FT                   DKIALPVIYFTLTAIIIIFIRFFAVPFHISEAKSYDPRIYAIIAEHLDMALILSNLLLG
FT                   GLLFFSAYFLIVMIALFNYSGAIQGVAKRIASHLPISSLVIGYFEKFILLSLLSEMLKN
FT                   GVSLKMTFKTAANSTIIPRISKQFEGILAQVSRGEKNFWSIPFFEEIEQHLLAGAGTVA
FT                   QLGNMFGEFADRARFNALTMASKFFRSMTIVAILLLSFAVFVEFFTIVLTQVLIQQGII
FT                   DQVGHA"
FT   gene            complement(175033..176595)
FT                   /locus_tag="Sulku_0168"
FT   CDS_pept        complement(175033..176595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0168"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482: IPR003593; KEGG: nam:NAMH_1148 type II secretion
FT                   system protein E; PFAM: type II secretion system protein E;
FT                   SMART: AAA ATPase; SPTR: Type II secretion system protein
FT                   E; PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32835"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD8"
FT                   /protein_id="ADR32835.1"
FT                   /translation="MNIKKILTSKQLEVCQKEQYYYQQIGIKKHLLDIALSHHFIQKKE
FT                   TSKTYNLELMKEYEMIIADERDDTLTILRKELLGEKRLAELSGKVHKKIEQKNIPVREF
FT                   QQKYTSLLRVDPESIERKIKQFNAMDDGENEVIDIFEMLLEYGIQRSASDIHINAYESF
FT                   YWLRYRIDGKIIARYLLNHELAQRFALIIKERCNIDMINVYAPQGGSFSREYENRTIDF
FT                   RIEIAPSQYGENIVLRILDKASNIKSLNSLFPKSHPMSEHLHHFVNQSSGFFLVVGPTG
FT                   SGKTTTLNAILNQRDRLHEIIYTIEDPIEYKIDFVTQYQINEASGFTFAEGMKSIMRQD
FT                   PDVIVIGEMRDRESILTGLKAAHSGHMVFSTLHTPNSFMAMERIRDEGGDLFILAYSLS
FT                   GVVAQRLIPKLCSCKQPCGVEDGKAFFSTETYGFEKSGCIRCNFTGYSGRALLLDMVFI
FT                   PGDMKIRYQFYLALKNSTVFKAWEHFITFSYFQSAAYLFEMGTCDYETLSSELLSLGYV
FT                   HET"
FT   gene            complement(176636..177130)
FT                   /locus_tag="Sulku_0169"
FT   CDS_pept        complement(176636..177130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0169"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG: son:SO_3524
FT                   type IV pilus biogenesis protein PilE; SPTR: Type IV pilus
FT                   biogenesis protein PilE; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32836"
FT                   /db_xref="GOA:E4TXD9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD9"
FT                   /protein_id="ADR32836.1"
FT                   /translation="MKNKGFTLIEIAATIFLVGLLGAIGYFYLNTSSLTKSQYKSALQS
FT                   HMNLIESMVFQCKSLSEQFPKELNASVDASNTLLTELECNTSTPYSLDGGRNGFVPVSP
FT                   SGFNPYTATESGSAFYIMTSAENNSTQDKALKELILNYTSQQATLEHNLTSARFKFYLS
FT                   R"
FT   sig_peptide     complement(177062..177130)
FT                   /locus_tag="Sulku_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(177133..177726)
FT                   /locus_tag="Sulku_0170"
FT   CDS_pept        complement(177133..177726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0170"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG:
FT                   vha:VIBHAR_03468 Tfp pilus assembly protein major pilin
FT                   PilA; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32837"
FT                   /db_xref="GOA:E4TXE0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE0"
FT                   /protein_id="ADR32837.1"
FT                   /translation="MTIYKNHRKGISLVEMTIAVILFGVLSTVTMLYYKNLFNIDLTSK
FT                   KARIAALMDQGRQLSGAYDVYIAQFGIAPLDVNLSDFNATNVMILKHLPKDIIEMTTVG
FT                   WELNTSAVDGHPAFQFPIDLNGTSYKLAGVKDDDQYCAIFNHEINTSLDLNVSDNMNFG
FT                   TAASQYSALGDAFCYTEILGANDHKHWIMIVQQN"
FT   sig_peptide     complement(177634..177726)
FT                   /locus_tag="Sulku_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(177843..178448)
FT                   /locus_tag="Sulku_0171"
FT   CDS_pept        complement(177843..178448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0171"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG:
FT                   vha:VIBHAR_03468 Tfp pilus assembly protein major pilin
FT                   PilA; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32838"
FT                   /db_xref="GOA:E4TXE1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE1"
FT                   /protein_id="ADR32838.1"
FT                   /translation="MRNIYKSHRKGISLIEMIIAVILFGVLSAIGVKYYKNFFNTDLTA
FT                   KKARVAALLDQAAQMSNAYDAYIAQVGSVASLDINLTELDDANVSILSRLPVAITELAS
FT                   GNADGTGGWELNNTTGIAGTSGIALQYKLDKNATGRLNTSDDEQYCAIINHEFNASVEY
FT                   NASNATAFHTNPTIAYQNLGPVFCWNNGSHLTLFIVKP"
FT   gene            complement(178605..179207)
FT                   /locus_tag="Sulku_0172"
FT   CDS_pept        complement(178605..179207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0172"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG: emi:Emin_1442
FT                   Tfp pilus assembly protein major pilin PilA-like protein;
FT                   SPTR: Tfp pilus assembly protein major pilin PilA-like
FT                   protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32839"
FT                   /db_xref="GOA:E4TXE2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE2"
FT                   /protein_id="ADR32839.1"
FT                   /translation="MKQYTGMRKGISLIEMIVAVILFGVLSAIGVKYYKNFFNTELTAK
FT                   KARVAALLDQASQMSNAYDAYIVQVGSIANLDTNLTQLDDANVSILSRLPIAITELASG
FT                   NVDGTGGWELNKTTGISGTTGIALQYKLDKNATGRLNTSDDEQYCAIINHEFNASIEYN
FT                   ASNATVFPVSATSAYQRFGQVFCWNNGTHLTLFVVKP"
FT   sig_peptide     complement(179118..179207)
FT                   /locus_tag="Sulku_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(179250..179693)
FT                   /locus_tag="Sulku_0173"
FT   CDS_pept        complement(179250..179693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apr:Apre_1080 dihydroxyacetone kinase, DhaK
FT                   subunit; SPTR: Bacteriophage N4 receptor, outer membrane
FT                   protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32840"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE3"
FT                   /protein_id="ADR32840.1"
FT                   /translation="MKKYSLLGLFVVILLTILVSTYFYFLDIVYEDKTVAEEVKTFSAL
FT                   KTAVEQPVAVYAEQDVLRTKNDQYDAMLQELGMDAEVKIDQKKLTIQGGIHDTYSYLLL
FT                   KRLLDVVKNDDVELVSSCIGQGCTGDEFGFSITIRPYVLKIPQ"
FT   sig_peptide     complement(179631..179693)
FT                   /locus_tag="Sulku_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(179680..180474)
FT                   /locus_tag="Sulku_0174"
FT   CDS_pept        complement(179680..180474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV2_1341 Mg-dependent DNase; SPTR:
FT                   Putative group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32841"
FT                   /db_xref="GOA:E4TXE4"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE4"
FT                   /protein_id="ADR32841.1"
FT                   /translation="MAIFTAGSISLTNDISNIRTQVYNYARQDLDSSAVKVSLRKHSEG
FT                   INYIAFLPKEKLVYENILLLASKNQGKSVIIFELDYKNVGVVVEDDKIIDYILDKPEDF
FT                   ATERGYGTLYADNTKGDKLVSINLDKERKDTWVGSFLLACTIVVTSGILYAGYGYLNAT
FT                   EINITNRDTLVKEYKELVTKNCQTSFAMTKKVDIVHELEKIENLTKETESTLQQISYQN
FT                   DSLCAEVVTPNLNAFVRLLPPEAKIIKEDVAQGIVQYCNEKI"
FT   gene            complement(180477..181922)
FT                   /locus_tag="Sulku_0175"
FT   CDS_pept        complement(180477..181922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0175"
FT                   /product="type II and III secretion system protein"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR004846; KEGG: mpt:Mpe_B0408 pilus (IV)
FT                   biogenesis; PFAM: type II and III secretion system protein;
FT                   SPTR: Pilus (IV) biogenesis; PFAM: Bacterial type II and
FT                   III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32842"
FT                   /db_xref="GOA:E4TXE5"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE5"
FT                   /protein_id="ADR32842.1"
FT                   /translation="MRSIILAAVLLGLTGCSVATKQETLTPEMHLKELDNPTTQIQRSE
FT                   PAVQVVEVKADNFHIEPQIIPDKEIIKRAKIMGAELSDVIALLTEATNENVVFQLQAES
FT                   VNSNKFSTSSSANGASNNEYTGKNDYLLTETTINLSASNISFGKILQKTVGDKLSILYD
FT                   DNTFYLGNLRTVTLKIPSINGLPEILKASITSMGASNVTTDAITSSVSFSAREKEYSDI
FT                   MKYLEILRNNLYVIEYEISIYDVELKDNYALGIDWSLVPSLAKDGLSFVASATGSLGSA
FT                   GASAVPLTFGMIMKNDTYNGKALVNALENFGKVESVQRPKLLGLAGTNVKLTDGVEAPY
FT                   ISGIQNTSVGNGTAQVSTTSATALSGLEINLKSNMLDGTVITDIGLKINDIVGYTSFEV
FT                   NGNKFSQPQTVTKAINNTMRVQPGVPIVISGLFRNKSDKGWNGLPGLGDSAAGVVGGAR
FT                   HTSNTKSEMVIVVTPRVIKYVMK"
FT   sig_peptide     complement(181863..181922)
FT                   /locus_tag="Sulku_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(181922..182311)
FT                   /locus_tag="Sulku_0176"
FT   CDS_pept        complement(181922..182311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2647 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32843"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE6"
FT                   /protein_id="ADR32843.1"
FT                   /translation="MNYFWSFLFLALSLNAAYNPFFREPVKPKKAPVATSDARPMPLPP
FT                   LLAPPSLPSKTEFDLSQLIYNCFLETNKGKFILLKIGENTVVLKEGDPFYANNHKYFIR
FT                   NITSNYITVDDAGRIQTIYFTTGAN"
FT   sig_peptide     complement(182264..182311)
FT                   /locus_tag="Sulku_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            182477..183022
FT                   /locus_tag="Sulku_0177"
FT   CDS_pept        182477..183022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0177"
FT                   /product="Peptidase M15A"
FT                   /note="COGs: COG3108 conserved hypothetical protein;
FT                   InterPro IPR013230; KEGG: rpf:Rpic12D_5086 protein of
FT                   unknown function DUF882; PFAM: Peptidase M15A; SPTR:
FT                   Putative uncharacterized protein; PFAM: Bacterial protein
FT                   of unknown function (DUF882)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32844"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE7"
FT                   /protein_id="ADR32844.1"
FT                   /translation="MEIKRLESPLLNPSRRTFIKNVIALSASTSLFADNKEKDEILSVI
FT                   RNGTSYKIPFIRDGKIEENGYDDLCRVFADVRAGVAVRMDPNLFLILTKAQQWLSSNHI
FT                   NRPIILTSGYRTEHTNSITEGAAFNSMHLYGKAADIKIEGIPADYLARLLRMCGGAGIG
FT                   IYPTFVHVDTWRERAWRG"
FT   sig_peptide     182477..182548
FT                   /locus_tag="Sulku_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            183109..185331
FT                   /locus_tag="Sulku_0178"
FT   CDS_pept        183109..185331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0178"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="COGs: COG0550 Topoisomerase IA; InterProIPR000380:
FT                   IPR005733: IPR006171: IPR013497: IPR 013498: IPR006154:
FT                   IPR003601: IPR003602; KEGG: tdn:Suden_0171 DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain-containing protein; DNA
FT                   topoisomerase type IA zn finger domain protein; PRIAM: DNA
FT                   topoisomerase; SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; SPTR: DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: Toprim domain; Topoisomerase DNA
FT                   binding C4 zinc finger; DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32845"
FT                   /db_xref="GOA:E4TXE8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE8"
FT                   /protein_id="ADR32845.1"
FT                   /translation="MKLIIVESPAKAKTIKNFLSKDYEVIASKGHIRDLPKNRFGIKID
FT                   DEKIIAEYRISEDSTATVKQIQELAKKSDTIYIATDEDREGEAIGWHIAHAIDKDPSSL
FT                   PRIVFHEITKNAIIHALETPRTIDMDRVNAQQARRLLDRIVGYKLSPLLANKIQKGLSA
FT                   GRVQSSTLKIVVDREREIRAFIPEEYWTIDTLFKKDIEAALVNFENEKIDKLTIKTGDE
FT                   AARIVETLKGESFKVGEIETKERKSSTPPPFMTSTLQQTASSQLGFSPKKTMMVAQALY
FT                   EGVKTPEGTSGVITYMRTDSLNLATEAVEAAREVILTRYGKEYLPKEAKVYTKKSKGAQ
FT                   EAHEAIRPTMLGFTPEVAATYLKPDEIKLYRLIYNRFLACQMNDARFEQQSITFESAKA
FT                   QFRATGRKLLFDGFYRVTGSDDKDKLLPSLTTGDSIEIQTVTPEQHFTEPPARYSEASL
FT                   IKKLESEGIGRPSTYAPTISTLQARNYIEIEKRAIMPTEIAFTVTEMLENHFNEIVDAS
FT                   FTATMEETLDEISESGKSWHKILLDFYYPFIEKIDAGKSNIVSLKMAKPLGRNCPQCGS
FT                   ELLLRSGRFGEFIACSGFPKCKYTEQTEENQKENPATPDEVSEEVCDKCGSAMVVKNGR
FT                   NGKFLACSGYPKCKNTKTLNQETKFSQVPCPECGGKLLWRQSRRGAFWGCEHYPKCKFI
FT                   SKFEPSDKKCEVPGCGGALAPRTYRNKEVYECVKCKDRTPREEAGE"
FT   gene            185328..185843
FT                   /locus_tag="Sulku_0179"
FT   CDS_pept        185328..185843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0179"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="COGs: COG0622 phosphoesterase; InterPro IPR000979:
FT                   IPR004843; KEGG: tdn:Suden_0170 hypothetical protein; PFAM:
FT                   metallophosphoesterase; SPTR: Putative uncharacterized
FT                   protein; TIGRFAM: phosphodiesterase, MJ0936 family;
FT                   TIGRFAM: phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32846"
FT                   /db_xref="GOA:E4TXE9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE9"
FT                   /protein_id="ADR32846.1"
FT                   /translation="MKIGLLSDTHTKKGRSQKVIDHLKAQGAEFLIHAGDIVKPEILDQ
FT                   LKSSGLRYVAVYGNNDANLIEYHTRYNLVQEPHYFKLGGVNFKLMHLPFYMNADAEVII
FT                   FGHTHVFECDFKNRTLFLNPGEACARDKPYSSCAMLEITDNELKVTHYSRALESEYFEE
FT                   RHYTFERA"
FT   gene            185847..186695
FT                   /locus_tag="Sulku_0180"
FT   CDS_pept        185847..186695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0180"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase; InterPro IPR002684:
FT                   IPR007197: IPR010722: IPR006638; KEGG: tdn:Suden_0169
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; PRIAM: Biotin synthase;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Biotin
FT                   synthetase; TIGRFAM: biotin synthase; PFAM: Radical SAM
FT                   superfamily; Biotin and Thiamin Synthesis associated
FT                   domain; TIGRFAM: biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32847"
FT                   /db_xref="GOA:E4TXF0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF0"
FT                   /protein_id="ADR32847.1"
FT                   /translation="MKKIFLCSICNINSGTCNEDCKFCSQSVKYKADIERYRQKPMEQI
FT                   LEEARRLEALGALGFCLVTAQKGLDDKTLDFVCNVASTLKREVPRLRLIACNGTASFEQ
FT                   LNELRRAGVSAYNHNLETSREFYPQVCTTHPWDERYETCENVNRSGLKLISGGIFGMGE
FT                   TQEDRLSMLYSLKELNPISVPLNFYHHNAALPLNPSPLTIDESLELISLARKILDKADR
FT                   IMIAGGREITFKERQHEIFEAGANSIVIGNYLTTAGREAHADLMMLQDLGFEIAMTPED
FT                   K"
FT   gene            186737..187090
FT                   /locus_tag="Sulku_0181"
FT   CDS_pept        186737..187090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0181"
FT                   /product="AMMECR1 domain protein"
FT                   /note="InterPro IPR002733; KEGG: sdl:Sdel_0034 AMMECR1
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: AMMECR1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32848"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF1"
FT                   /protein_id="ADR32848.1"
FT                   /translation="MSQSVLLTIARASIEEVLQGQNSINRRELLEQFPILSEPMATQIT
FT                   LYLGTKIRGSAKTQTAERSLLEDIIYNAKTAAFQDENFDPLVTSEYLHATIHLTIFSPE
FT                   GELSHQSDPILSE"
FT   gene            complement(187103..188050)
FT                   /locus_tag="Sulku_0182"
FT   CDS_pept        complement(187103..188050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0182"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR000103: IPR013027; KEGG: tdn:Suden_0165 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32849"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF2"
FT                   /protein_id="ADR32849.1"
FT                   /translation="MEHTYELAIIGAGPAGIATAIESYAVGMRDIILLEKDENHNATIR
FT                   KFYKDNKRVDKDWKGQKIELDGTIYFMDGTKESTLDFFDQMLDHESLELRTHTEVQKIV
FT                   KNDDGFEVFVAGGSIRAKYVVVTIGRMGKPNKPDYKIPPSIKNQIHFTLDGCGSGEKIM
FT                   VVGGGDSAIEYAVELCDRNEVTICYRRGTFRRANPTNQADIDKAVSNGSVRALLNTEII
FT                   ELESESGKVKVIFSDDSSELFDRLVYAIGGTTPSGFLQSSGIREEDGKPVHDENYQTNI
FT                   SGLFVAGDITQESGGSIALGLNHGFAIANYIKSL"
FT   gene            188124..188456
FT                   /locus_tag="Sulku_0183"
FT   CDS_pept        188124..188456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmu:TC0253 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32850"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF3"
FT                   /protein_id="ADR32850.1"
FT                   /translation="MYYVIQRHHGDPKKHYLAYTVPRYISSENSQNIIFEFRHNDTVKR
FT                   KWAPKEEIVLLTDNEQFFKETLEKLESLKRTHLERIGAAETQLNQEISAMLSTMQTEFE
FT                   TIKKNN"
FT   gene            188533..189636
FT                   /locus_tag="Sulku_0184"
FT   CDS_pept        188533..189636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0184"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006664:
FT                   IPR006665: IPR003367; KEGG: tdn:Suden_2018 OmpA/MotB; PFAM:
FT                   OmpA/MotB domain protein; Thrombospondin type 3
FT                   repeat-containing protein; SPTR: OmpA/MotB; PFAM: OmpA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32851"
FT                   /db_xref="GOA:E4TXF4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF4"
FT                   /protein_id="ADR32851.1"
FT                   /translation="MKKLLFSSLLAATLLNASDYNYEVTPVVGYLWNSTANENTQSNRG
FT                   AMGGVDNHALYGLEMQMNNACDLIKPELSLLYGRDRADGETDKTGVLTTMLNGVYEMPT
FT                   DTAITPFAKAGVGYEWYTNTHPNDFDGMLLDAGLGLKAEITDRIALKLEGLYMYKMNRN
FT                   GSADGSNGEVHNVAALAGLTFSFDKKAAPVAAVAAPAVAEAVAPAPKAEAKPVPAPAPK
FT                   AVAPIDSDGDGVIDSLDKCPGTPKGFKVDADGCPLKATLHLNFATDSTKVDAEGAAKVA
FT                   EFASFLKESPAYKANIVGHTDSTASDAYNQKLSEKRAAKVKSMLIEDGVDSSRLTSEGM
FT                   GEKMPIASNKTKEGRAENRRIEVELCK"
FT   sig_peptide     188533..188583
FT                   /locus_tag="Sulku_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(189670..189903)
FT                   /locus_tag="Sulku_0185"
FT   CDS_pept        complement(189670..189903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0205 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32852"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF5"
FT                   /protein_id="ADR32852.1"
FT                   /translation="MISLTHIEAALSAVDAEIKALLYNQSLSLTEKDEKMLPLLRESKV
FT                   LKQAHEDLCYLRDNPPSTPNGCKAGSYRKEEE"
FT   gene            complement(189939..190487)
FT                   /locus_tag="Sulku_0186"
FT   CDS_pept        complement(189939..190487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0186"
FT                   /product="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="COGs: COG0164 Ribonuclease HII; InterPro IPR001352;
FT                   KEGG: sun:SUN_2262 ribonuclease HII; PFAM: ribonuclease
FT                   HII/HIII; PRIAM: Ribonuclease H; SPTR: Ribonuclease HII;
FT                   PFAM: Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32853"
FT                   /db_xref="GOA:E4TXF6"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF6"
FT                   /protein_id="ADR32853.1"
FT                   /translation="MQLCGIDEAGRGPLAGPLTIAGVILNNPIEGLNDSKKLTEKKRES
FT                   LYELICENSIYHIARFDAAQIDELGLSQCLATGLREIMSALGEADYLYDGNSKFGVSGL
FT                   RTMVKADATVPEVSAASILAKVTRDREMIQLASLYPQYGFDGHKGYGCAAHIEAIRQYG
FT                   YCEIHRKTFKLKAFQPSLF"
FT   gene            190573..191241
FT                   /locus_tag="Sulku_0187"
FT   CDS_pept        190573..191241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_2504 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32854"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF7"
FT                   /protein_id="ADR32854.1"
FT                   /translation="MFRASILVLCLVSVSASAATILGFGAEADYYTPSASGDFDYKNTH
FT                   TRFGNNDESGYQIGLFVEHPVPVIPNVRIDFTPKTSFSGSDGIGGSSKVSVTQTDITPY
FT                   YEILDNAVEIDFGVSFKVLDATVEGTINESLNEVIPMGYLGVALTPPYSPIGMEGSVKY
FT                   VGYNGDSLTDARIKLVWKIGAGLGAQAGYRYESLKVSDHFDLNSDVTFKGPFVGFNYRF
FT                   "
FT   sig_peptide     190573..190656
FT                   /locus_tag="Sulku_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(191238..192305)
FT                   /locus_tag="Sulku_0188"
FT   CDS_pept        complement(191238..192305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0188"
FT                   /product="uncharacterized ATPase"
FT                   /note="InterPro IPR021115; KEGG: tdn:Suden_0284
FT                   uncharacterized ATPase; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32855"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF8"
FT                   /protein_id="ADR32855.1"
FT                   /translation="MNTLLDEYYRYDLHNAGFIERKYTIGDENTLIYGITQSGKTSLIK
FT                   NHLLSYKKSTYLYLDCRDVRLDTNDLNRSLKNFCRENKISILALDNYNEEIELFDMDQI
FT                   ILSSDKMLPIPFHTVQLELLDYEEFLAFETKFDSTALNHFFQLGGFPAMHRIPSEERVL
FT                   YLQNTLKNTLEPIEFSILAQASKMVTQKVSAFNLYERLKGERKISKDKLYLHLQSMYDR
FT                   GYLKSLEKFNHPSAVKKLYLCDIAIKHALVTQKHFGRLFENLVFSELDKHHIECYYDEG
FT                   IDFYLPHRRQIIIASPFANEHALFKKVEALEAFIVSNRIREVIVVTMNLESTLSHPVSR
FT                   IEMIPFEMWALGDDA"
FT   gene            192479..192790
FT                   /locus_tag="Sulku_0189"
FT   CDS_pept        192479..192790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0189"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="COGs: COG0051 Ribosomal protein S10; InterPro
FT                   IPR018268: IPR005731: IPR001848; KEGG: tdn:Suden_0285 30S
FT                   ribosomal protein S10; PFAM: ribosomal protein S10; SPTR:
FT                   30S ribosomal protein S10; TIGRFAM: ribosomal protein S10;
FT                   PFAM: Ribosomal protein S10p/S20e; TIGRFAM: ribosomal
FT                   protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32856"
FT                   /db_xref="GOA:E4TXF9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF9"
FT                   /protein_id="ADR32856.1"
FT                   /translation="MEKIRLKLRAYDHRVLDRSVASIVEAVKRTGAEIRGPIPLPTKIR
FT                   KYTVLKSPHVNKDSREQFEIRMHARLIDIVSATPDTVDSLMKLDLAPEVDVEVRSMDK"
FT   gene            192801..193376
FT                   /locus_tag="Sulku_0190"
FT   CDS_pept        192801..193376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0190"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="COGs: COG0087 Ribosomal protein L3; InterPro
FT                   IPR019927: IPR000597; KEGG: wsu:WS1716 50S ribosomal
FT                   protein L3; PFAM: ribosomal protein L3; SPTR: 50S ribosomal
FT                   protein L3; TIGRFAM: 50S ribosomal protein L3; PFAM:
FT                   Ribosomal protein L3; TIGRFAM: 50S ribosomal protein L3,
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32857"
FT                   /db_xref="GOA:E4TXG0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG0"
FT                   /protein_id="ADR32857.1"
FT                   /translation="MEYIVEKIGMSRTISVPSKVVTLLKVKEIKVCEVNDGVALVAYSQ
FT                   GKSTNKPVEGQQKKYNLSAEFNKFATLEVANTEAGDLDMAPLANATTVKSSFNTKGRGF
FT                   TGVMKRWNFAGGPGAHGHRFHRTGGSIGNREWPGKVQKGRKMSGQYGDEQVTVKNEVMS
FT                   YDAENGVLVVVGSIPGANGALGRVKVVK"
FT   gene            193376..193987
FT                   /locus_tag="Sulku_0191"
FT   CDS_pept        193376..193987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0191"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="COGs: COG0088 Ribosomal protein L4; InterPro
FT                   IPR002136; KEGG: tdn:Suden_0287 50S ribosomal protein L4;
FT                   PFAM: ribosomal protein L4/L1e; SPTR: 50S ribosomal protein
FT                   L4; PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32858"
FT                   /db_xref="GOA:E4TXG1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG1"
FT                   /protein_id="ADR32858.1"
FT                   /translation="MSAIVLNEKFEKASEAALPESFSGINPHNLYLYVKSYQASIRANT
FT                   ASAKTRSMISGGGKKPWAQKGKGGARAGSRRSPIFVGGAIAHGPNTGRNYDQKINKKQK
FT                   KLALKCALDALAQAGKLFIVDTIEVPSGKTKDAKVLFDKLNVRDALLVKKILDENTYLA
FT                   FRNISSTYVVEENELNAFLAATYRSVVIEKAVWENLTKES"
FT   gene            193989..194270
FT                   /locus_tag="Sulku_0192"
FT   CDS_pept        193989..194270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0192"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="COGs: COG0089 Ribosomal protein L23; InterPro
FT                   IPR013025; KEGG: tdn:Suden_0288 50S ribosomal protein L23;
FT                   PFAM: Ribosomal protein L25/L23; SPTR: Ribosomal protein
FT                   L23; PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32859"
FT                   /db_xref="GOA:E4TXG2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG2"
FT                   /protein_id="ADR32859.1"
FT                   /translation="MADITDIKSILYTEKTLGLQEEGVIVVQTSPRMTKNALKEVFREY
FT                   FGIVPARVNSLNQDGKVKRFRGLAGKQNDFKKFYVKLPEGAQIDSLAV"
FT   gene            194272..195117
FT                   /locus_tag="Sulku_0193"
FT   CDS_pept        194272..195117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0193"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171: IPR005880; KEGG: tdn:Suden_0289 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: 50S ribosomal
FT                   protein L2; TIGRFAM: ribosomal protein L2; PFAM: Ribosomal
FT                   Proteins L2, RNA binding domain; Ribosomal Proteins L2,
FT                   C-terminal domain; TIGRFAM: ribosomal protein L2,
FT                   bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32860"
FT                   /db_xref="GOA:E4TXG3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG3"
FT                   /protein_id="ADR32860.1"
FT                   /translation="MAIKTYKPTTPSRRFYTNVDNSDITAKASVRSLLIKLPAAAGRNN
FT                   NGRITSRHKEAGAKKLYRIIDFKRNKFGVNGTVAAIEYDPYRNCRIALINYVDGDKRYI
FT                   LQPKGLVVGDVVAAAESGLDIKAGNAMKLMNIPVGTTVHNIELKPGKGGQIVRSAGTSA
FT                   QIMGREGKYVSLRLPSSEMRYVLGECMATVGTVGNEEYINIVLGKAGRTRHMGIRPQTR
FT                   GSAMNPIDHPHGGGEGKTNSGRHPVTPWGKPTKGAKTRKKKASDKLIITRRKPNAKRVG
FT                   "
FT   gene            195120..195401
FT                   /locus_tag="Sulku_0194"
FT   CDS_pept        195120..195401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0194"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="COGs: COG0185 Ribosomal protein S19; InterPro
FT                   IPR020934: IPR002222: IPR005732; KEGG: sdl:Sdel_1964
FT                   ribosomal protein S19; PFAM: ribosomal protein S19/S15;
FT                   SPTR: 30S ribosomal protein S19; TIGRFAM: ribosomal protein
FT                   S19; PFAM: Ribosomal protein S19; TIGRFAM: ribosomal
FT                   protein S19, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32861"
FT                   /db_xref="GOA:E4TXG4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG4"
FT                   /protein_id="ADR32861.1"
FT                   /translation="MARSVKKGPFVDGHLMKKVIAAKETKSNKPIKTWSRRSVVLPDMI
FT                   GLTFNVHNGRQFVPVFVTENHIGYKLGEFAPTRTFKGHKGSVQKKIGK"
FT   gene            195411..195728
FT                   /locus_tag="Sulku_0195"
FT   CDS_pept        195411..195728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0195"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR005727: IPR001063; KEGG: tdn:Suden_0291 50S ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17; SPTR: 50S
FT                   ribosomal protein L22; TIGRFAM: ribosomal protein L22;
FT                   PFAM: Ribosomal protein L22p/L17e; TIGRFAM: ribosomal
FT                   protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32862"
FT                   /db_xref="GOA:E4TXG5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG5"
FT                   /protein_id="ADR32862.1"
FT                   /translation="MARALLKFVRVSPTKSRLIAREVQGMNAEQAMAALEFTPNKAAKI
FT                   IAKVVASAVANSGIDAQDCVIKSCRVDNGPVLKRFTQRARGTASGIRKPTAHILVEVEG
FT                   K"
FT   sig_peptide     195411..195494
FT                   /locus_tag="Sulku_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            195731..196441
FT                   /locus_tag="Sulku_0196"
FT   CDS_pept        195731..196441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0196"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="COGs: COG0092 Ribosomal protein S3;
FT                   InterProIPR018280: IPR005704: IPR004088: IPR004044: IPR
FT                   008282: IPR001351: IPR004087; KEGG: tdn:Suden_0292 30S
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; Ribosomal protein S3 domain; KH type 2 domain
FT                   protein; SMART: KH domain protein; SPTR: 30S ribosomal
FT                   protein S3; TIGRFAM: ribosomal protein S3; PFAM: KH domain;
FT                   Ribosomal protein S3, C-terminal domain; Ribosomal protein
FT                   S3, N-terminal domain; TIGRFAM: ribosomal protein S3,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32863"
FT                   /db_xref="GOA:E4TXG6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG6"
FT                   /protein_id="ADR32863.1"
FT                   /translation="MGHKVNPIGLRLGINRNWESRWFPNFKTAAVSLGEDHKIRTYLKK
FT                   ELYYAGVSNIVIERTAKRLRVTIIAARPGIIIGKKGSDIEKIKESLQNLIGKPVAVNIK
FT                   EEKKAQASAQLVAENVATQLEKRVAFRRAMKKVMQNAQRAGAKGIKVSVAGRLGGAEIA
FT                   RTEWYLEGRVPLHTLRAKIDYGFAEAHTTYGVIGIKVWIFKGEVLTKGIQPEAKESKEE
FT                   RGEDQQRRPRRKAN"
FT   sig_peptide     195731..195817
FT                   /locus_tag="Sulku_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            196444..196869
FT                   /locus_tag="Sulku_0197"
FT   CDS_pept        196444..196869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0197"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR020798: IPR000114: IPR016180; KEGG: tdn:Suden_0293 50S
FT                   ribosomal protein L16; PFAM: Ribosomal protein L10e/L16;
FT                   SPTR: 50S ribosomal protein L16; TIGRFAM: ribosomal protein
FT                   L16; PFAM: Ribosomal protein L16p/L10e; TIGRFAM: ribosomal
FT                   protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32864"
FT                   /db_xref="GOA:E4TXG7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG7"
FT                   /protein_id="ADR32864.1"
FT                   /translation="MLMPKRTKYRKMMKGRNRGYATNANKLDFGSIGFKATEAGRINSR
FT                   QIEAARIAANRHIKRQGKIWIRVFPAKPLTAKPLEVRMGKGKGSVDQWVMNIKPGRIIF
FT                   EMGGVEETLAREALSLAMQKLPFKTKIVTAEMSNEIY"
FT   gene            196856..197041
FT                   /locus_tag="Sulku_0198"
FT   CDS_pept        196856..197041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0198"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="InterPro IPR018254: IPR001854; KEGG: tdn:Suden_0294
FT                   50S ribosomal protein L29; PFAM: ribosomal protein L29;
FT                   SPTR: Ribosomal protein L29; TIGRFAM: ribosomal protein
FT                   L29; PFAM: Ribosomal L29 protein; TIGRFAM: ribosomal
FT                   protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32865"
FT                   /db_xref="GOA:E4TXG8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG8"
FT                   /protein_id="ADR32865.1"
FT                   /translation="MKYTDLNGKTAAELQGMLKEKKIELFTLKIKQKMMQLTNTSELRT
FT                   AKKDIARINTAMNAVK"
FT   gene            197052..197303
FT                   /locus_tag="Sulku_0199"
FT   CDS_pept        197052..197303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0199"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="COGs: COG0186 Ribosomal protein S17; InterPro
FT                   IPR019979: IPR019984: IPR000266; KEGG: abu:Abu_0761 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17; SPTR:
FT                   30S ribosomal protein S17; TIGRFAM: 30S ribosomal protein
FT                   S17; PFAM: Ribosomal protein S17; TIGRFAM: 30S ribosomal
FT                   protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32866"
FT                   /db_xref="GOA:E4TXV3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV3"
FT                   /protein_id="ADR32866.1"
FT                   /translation="MTHKREIQGIVVTKAGEKTATIVVERRVMHPRYHKTVKRFKKYMI
FT                   HDENNQLNIGDEVIAIECRPLSKSKSFRLKTLVKGVNA"
FT   gene            197300..197668
FT                   /locus_tag="Sulku_0200"
FT   CDS_pept        197300..197668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0200"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="COGs: COG0093 Ribosomal protein L14; InterPro
FT                   IPR019972: IPR005745: IPR000218; KEGG: cjd:JJD26997_2071
FT                   50S ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e; SPTR: 50S ribosomal protein L14; TIGRFAM:
FT                   ribosomal protein L14; PFAM: Ribosomal protein L14p/L23e;
FT                   TIGRFAM: ribosomal protein L14, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32867"
FT                   /db_xref="GOA:E4TXV4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV4"
FT                   /protein_id="ADR32867.1"
FT                   /translation="MIQSFTRLAVADNTGAKELMCIKVLGGSKRRYATVGDVIIASVKK
FT                   AAPTGKIKKGQVVTAVVVRTKKEVHRENGSLIRFDENAAVILDKKREPIGTRIFGPVSR
FT                   EVRYAGFMKIVSLAPEVV"
FT   gene            197668..197898
FT                   /locus_tag="Sulku_0201"
FT   CDS_pept        197668..197898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0201"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="COGs: COG0198 Ribosomal protein L24; InterPro
FT                   IPR003256: IPR005824; KEGG: tdn:Suden_0297 50S ribosomal
FT                   protein L24; PFAM: KOW domain protein; SMART: KOW domain
FT                   protein; SPTR: 50S ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW motif; TIGRFAM: ribosomal
FT                   protein L24, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32868"
FT                   /db_xref="GOA:E4TXV5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV5"
FT                   /protein_id="ADR32868.1"
FT                   /translation="MAKFNFKKGDIVEVIAGDDKGTKAELLQVMPKKNKVIVKGCRVAK
FT                   KAIKPSEQNPQGGFLNKEMPIDASNVRKVEA"
FT   gene            197901..198446
FT                   /locus_tag="Sulku_0202"
FT   CDS_pept        197901..198446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0202"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: tdn:Suden_0298 50S ribosomal protein L5;
FT                   SPTR: 50S ribosomal protein L5; PFAM: ribosomal L5P family
FT                   C-terminus; Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32869"
FT                   /db_xref="GOA:E4TXV6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV6"
FT                   /protein_id="ADR32869.1"
FT                   /translation="MARLKDKYLALKPELQTTLGIANVMQVPALEKVIISVGCGFAMKD
FT                   NKLIQNIQDTISNIAGQRAMVVNARKSVAGFKVREGMPVGVKVTLRGAQMYDFMDKLIS
FT                   VSLPRVKDFRGIPRNGFDGRGNYNFGITEQLIFPEVDYDSIMQIHGMNITVVTSATADK
FT                   DAFKLLEMLGMPFAKGRE"
FT   gene            198461..198631
FT                   /locus_tag="Sulku_0203"
FT   CDS_pept        198461..198631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0203"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="COGs: COG0199 Ribosomal protein S14; InterPro
FT                   IPR018271: IPR001209; KEGG: tdn:Suden_0299 30S ribosomal
FT                   protein S14; PFAM: ribosomal protein S14; SPTR: 30S
FT                   ribosomal protein S14 type Z; manually curated; PFAM:
FT                   Ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32870"
FT                   /db_xref="GOA:E4TXV7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV7"
FT                   /protein_id="ADR32870.1"
FT                   /translation="MIAKAARTPKFAVRAYTRCQICGRPHSVISDFGICRVCFRKMANE
FT                   GLIPGVRKSSW"
FT   gene            198674..199069
FT                   /locus_tag="Sulku_0204"
FT   CDS_pept        198674..199069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0204"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: tdn:Suden_0300 30S ribosomal protein S8;
FT                   PFAM: ribosomal protein S8; SPTR: 30S ribosomal protein S8;
FT                   PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32871"
FT                   /db_xref="GOA:E4TXV8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV8"
FT                   /protein_id="ADR32871.1"
FT                   /translation="MINDLIADSLTRIRNAAMRRLDSTTLVHSKVVEAVVAILADKGYI
FT                   ESFNVVEDGVKKTINVVLKYDEKGRTVINEVKRVSKPGRRVYKGKDELKRFKNGYGTII
FT                   VSSSKGVLPNDKAFELGVGGEVLCTIW"
FT   gene            199079..199615
FT                   /locus_tag="Sulku_0205"
FT   CDS_pept        199079..199615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0205"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="COGs: COG0097 Ribosomal protein L6P/L9E; InterPro
FT                   IPR002358: IPR000702: IPR019906: IPR020040; KEGG:
FT                   tdn:Suden_0301 50S ribosomal protein L6; PFAM: Ribosomal
FT                   protein L6, alpha-beta domain; SPTR: LSU ribosomal protein
FT                   L6P; TIGRFAM: ribosomal protein L6; PFAM: Ribosomal protein
FT                   L6; TIGRFAM: ribosomal protein L6, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32872"
FT                   /db_xref="GOA:E4TXV9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV9"
FT                   /protein_id="ADR32872.1"
FT                   /translation="MSRIGKLPISIPADVKATLEGTVLTFTKGATTQTLDTLGNCGVAL
FT                   DGNTLTFSTNSDQRTDRAFWGTYRALAANIITGLTTGFEKKLEINGVGYRAAVNGNVLN
FT                   LQLGFSHDINYDIPAGISMAVEKNVISIKGADKQQVGQIAAEIRSFRPPEPYKGKGVKY
FT                   SDETILRKAGKTSKK"
FT   gene            199627..199983
FT                   /locus_tag="Sulku_0206"
FT   CDS_pept        199627..199983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0206"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR004389: IPR005484; KEGG: tdn:Suden_0302 50S ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E; SPTR: 50S
FT                   ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32873"
FT                   /db_xref="GOA:E4TXW0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW0"
FT                   /protein_id="ADR32873.1"
FT                   /translation="MTGKTLKNKSAKRLQRKRRIRSKISGCASLPRVSIFRSNRYISAQ
FT                   AINDEAAVTLAAVHSKTLGLKANKADAEKAAAVFAKNLKDAGISEVTFDRNGFLYHGVV
FT                   KAFAEALRANEIKF"
FT   sig_peptide     199627..199758
FT                   /locus_tag="Sulku_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            199993..200436
FT                   /locus_tag="Sulku_0207"
FT   CDS_pept        199993..200436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0207"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR018192: IPR005712: IPR013810: IPR005324; KEGG:
FT                   tdn:Suden_0303 30S ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5; ribosomal protein S5 domain protein; SPTR: 30S
FT                   ribosomal protein S5; TIGRFAM: ribosomal protein S5; PFAM:
FT                   Ribosomal protein S5, N-terminal domain; Ribosomal protein
FT                   S5, C-terminal domain; TIGRFAM: ribosomal protein S5,
FT                   bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32874"
FT                   /db_xref="GOA:E4TXW1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW1"
FT                   /protein_id="ADR32874.1"
FT                   /translation="MQAINREEFSEAIVNIGRVTKVVKGGRRFRFTALVVVGNKKGTVG
FT                   YGVGKAKEVPDAIRKAVDEAFKNLTEVKIKGTTIAHDIEVKYNASRILLKPASEGTGVI
FT                   AGGATRPVLELAGIQDILTKSLGSNNPNTVVRATIDALSRIKG"
FT   gene            200440..200838
FT                   /locus_tag="Sulku_0208"
FT   CDS_pept        200440..200838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0208"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="COGs: COG0200 Ribosomal protein L15; InterPro
FT                   IPR005749; KEGG: ccv:CCV52592_1015 50S ribosomal protein
FT                   L15; SPTR: 50S ribosomal protein L15; TIGRFAM: ribosomal
FT                   protein L15; PFAM: Ribosomal protein L18e/L15; TIGRFAM:
FT                   ribosomal protein L15, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32875"
FT                   /db_xref="GOA:E4TXW2"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW2"
FT                   /protein_id="ADR32875.1"
FT                   /translation="MALENLTPAEGSTHSKKRLGRGQGSGQGKTAGKGHKGQKARKGYN
FT                   EKRNFEGGQQPLARRLPKFGFTSRVVKPTTINVEKVKEIAALSEITMETIRSVHRLAKS
FT                   VVSVKLVGASAKDLASKIKDENVTTTGN"
FT   gene            200838..202100
FT                   /locus_tag="Sulku_0209"
FT   CDS_pept        200838..202100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0209"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: tdn:Suden_0305 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR:
FT                   Preprotein translocase subunit secY; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32876"
FT                   /db_xref="GOA:E4TXW3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW3"
FT                   /protein_id="ADR32876.1"
FT                   /translation="MNQQLVNKILITIGFLFIYRLLAYVPVPGVDTAVIASFFNSHQAD
FT                   ALGLFNMFSGNAVERLSIISLGIMPYITASIIMELLAATFPNLAQMKKERDGMVKYMQI
FT                   IRYATIVITIVQAIGVSVGLQSMTGQDGASAILVDHSTFVTLAVVSMLAGTMLLMWIGE
FT                   QITQSGIGNGVSLIIFAGIVSAIPSAISQAVTMVNTGAMGFLSLLGIIALIIATILVII
FT                   YVELGERRIPVTYAKKTMMQNQNKRVMNYIPVKVNLSGVIPVIFASAILMFPMTVMSSS
FT                   TNPTVQAIADVLNPNHYFFNFLTFLFVVFFAFFYASIVFNAKDISENLKRQGGFIPGVR
FT                   PGESTKEFLNDTAGRLTITGAIYLGLIATLPWVIVKAMGVPFFFGGTAVLIVVQVALDT
FT                   MRRIEAQVYMSKYQTLSAVGL"
FT   sig_peptide     200838..200906
FT                   /locus_tag="Sulku_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            202103..202861
FT                   /locus_tag="Sulku_0210"
FT   CDS_pept        202103..202861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0210"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="COGs: COG0024 Methionine aminopeptidase; InterPro
FT                   IPR002467: IPR001714: IPR000994; KEGG: nis:NIS_0243
FT                   methionine aminopeptidase; PFAM: peptidase M24; PRIAM:
FT                   Methionyl aminopeptidase; SPTR: Methionine aminopeptidase,
FT                   type I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   Metallopeptidase family M24; TIGRFAM: methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32877"
FT                   /db_xref="GOA:E4TXW4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW4"
FT                   /protein_id="ADR32877.1"
FT                   /translation="MAIALRKNSEIELLRSANKIVAGTLELLAQHTKPGMTLKELDAIG
FT                   EEYIRSQGAIPSFKGLYGFPNAVCTSVNDVIIHGIPTDYALKEGDIVGFDVGTKKGGYF
FT                   GDAAISVGVGKISQEDEALIACAKDALYFAIDIIQDGMRFKELSYEIEQFINGRGFVPL
FT                   RGFCGHGIGKKPHEEPEIPNYLDGNNAKAGPKIKNGMVFCLEPMICQKEGTSKILANGW
FT                   DVVSTDGLRGSHYEHTVAIINGRAEILSIA"
FT   gene            202872..203090
FT                   /locus_tag="Sulku_0211"
FT   CDS_pept        202872..203090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0211"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR004368: IPR006196; KEGG: tdn:Suden_0307
FT                   translation initiation factor IF-1; PFAM: S1 IF1 family
FT                   protein; SPTR: Translation initiation factor IF-1; TIGRFAM:
FT                   translation initiation factor IF-1; PFAM: Translation
FT                   initiation factor 1A / IF-1; TIGRFAM: translation
FT                   initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32878"
FT                   /db_xref="GOA:E4TXW5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW5"
FT                   /protein_id="ADR32878.1"
FT                   /translation="MAKDDVIEVDGKIIEALPNATFRVELPNGHVILCHIAGKMRMHYI
FT                   KILPGDTVKIELTPYSLDKGRITYRYK"
FT   gene            203145..203786
FT                   /locus_tag="Sulku_0212"
FT   CDS_pept        203145..203786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0212"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="COGs: COG0790 FOG: TPR repeat SEL1 subfamily;
FT                   InterPro IPR006597; KEGG: ara:Arad_2749 hypothetical
FT                   protein; PFAM: Sel1 domain protein repeat-containing
FT                   protein; SMART: Sel1 domain protein repeat-containing
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: Sel1
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32879"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW6"
FT                   /protein_id="ADR32879.1"
FT                   /translation="MKKYLYLLFFLVTPLFSSEGQQSFWETYTDALRGNKEAQFQVGVI
FT                   FERGIGREENQSLAAQWFEKSAEQGHVDAQYNVAIMYAAGRGVDVDEGKAMMWLAKAAK
FT                   QKDKEARKLLNDIIDGKLDKKSSDAVNNYHDAVSDNSFEMITPTTLMTKEGAKVCDQKG
FT                   ICIALKANTALTSTSKNRQFYKISGTVTKKGWQEYKKEGWIDENSVEIRR"
FT   sig_peptide     203145..203204
FT                   /locus_tag="Sulku_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(203795..204112)
FT                   /locus_tag="Sulku_0213"
FT   CDS_pept        complement(203795..204112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0213"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="COGs: COG3123 conserved hypothetical protein;
FT                   InterPro IPR009664; KEGG: tdn:Suden_2102 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1255; SPTR:
FT                   UPF0345 protein Suden_2102; PFAM: Protein of unknown
FT                   function (DUF1255)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32880"
FT                   /db_xref="GOA:E4TXW7"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW7"
FT                   /protein_id="ADR32880.1"
FT                   /translation="MSQFINVTIDKKANVYFDGKVTSRTVHFADGSIKTLGIMAPGEYT
FT                   FGTADKEIMEIMSGEMDIQLPGSDAWITINGPMSFEVPANSSFNLKVKTISDYCCSYIK
FT                   E"
FT   gene            complement(204142..204357)
FT                   /locus_tag="Sulku_0214"
FT   CDS_pept        complement(204142..204357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1835 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32881"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW8"
FT                   /protein_id="ADR32881.1"
FT                   /translation="MGYRPRKSPFTHLKARNLVYTENDQTYTLISFNRDSMLLEVHIKD
FT                   GTETKIVTDFPFAHLPKKIKQELNPL"
FT   gene            complement(204347..205186)
FT                   /locus_tag="Sulku_0215"
FT   CDS_pept        complement(204347..205186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0215"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2996 conserved hypothetical protein;
FT                   InterPro IPR014464; KEGG: tdn:Suden_0312 hypothetical
FT                   protein; SPTR: Nucleic acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32882"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW9"
FT                   /protein_id="ADR32882.1"
FT                   /translation="MNETLKVGEINILVIDRSTVPGLFLRALDESDILLPNQYVTESMH
FT                   IGDTIDVFVYTDSEDRPVATTVKPKAMVNEIAFVEVVDTNSIGAFVDWGLPKDLFVPRA
FT                   LQKRPFAVGEKRLVRVILDDQTNRLVGTEKISGALETPPKSFYPNTPVEFMIIAKTPMG
FT                   YKVIVDHKYEGMIYANEIFEDVRVGQIKKGFVKLLRPDGKLDLSLQMVGKAKASSAADK
FT                   IFSMIQGNGGMLPYNYKSDPDLIQKTFGLSKKNFKAALTQLVDAKKITVQENGIYGI"
FT   gene            205227..205979
FT                   /locus_tag="Sulku_0216"
FT   CDS_pept        205227..205979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0216"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR020904: IPR002347:
FT                   IPR002198; KEGG: tdn:Suden_1903 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32883"
FT                   /db_xref="GOA:E4TXX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX0"
FT                   /protein_id="ADR32883.1"
FT                   /translation="MRILITGASSGLGEVLALHYATKDNTLVLIARREDRLSDVASRCR
FT                   ELGADVETLVADVNDFERIREIGTELGQNPIDRIILNAGVSVGHNGGVTPFEDFERLFK
FT                   TNFLSIHALLEPIIPKLMEQRSGEIVFISSLASLLSMPTSIAYSSSKRALNAYAEGLHY
FT                   QLKPHGISVMTIMPGFIDSEMTRKNRFKMPFLLKTEEGVARIVRAIERKKIRYAFPFRF
FT                   YLMIRIVLLFPQSLRDKIVNFTNFKKGQ"
FT   sig_peptide     205227..205277
FT                   /locus_tag="Sulku_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            206005..208080
FT                   /locus_tag="Sulku_0217"
FT   CDS_pept        206005..208080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0217"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="COGs: COG3383 Uncharacterized anaerobic
FT                   dehydrogenase; InterPro IPR006655: IPR006963: IPR006656:
FT                   IPR006657; KEGG: nis:NIS_1552 formate dehydrogenase, alpha
FT                   subunit; PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; SPTR: Formate dehydrogenase,
FT                   alpha subunit; PFAM: Molybdopterin oxidoreductase;
FT                   Molydopterin dinucleotide binding domain; Molybdopterin
FT                   oxidoreductase Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32884"
FT                   /db_xref="GOA:E4TXX1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX1"
FT                   /protein_id="ADR32884.1"
FT                   /translation="MTIDSVCTYCGVGCDISAEVEDNKIQKIFAKDEGVVSQGRLCIKG
FT                   KQGWDFLTHPKRLRNARVRKTFLAKNSALFADFDMDYLEPVDHDFYEISYESAYELAAR
FT                   KLKSITDEHGSHSFAAIGGARTSCESSYLFQHFTRHVVGSPHVDNCARVCHSPSLKGMR
FT                   TTIGEGAMSNPFDDIYETEFMVVMGSNTTEGHPIVANRMLDVIKNNGVELAVLDVRRIQ
FT                   LSKSATHHLSIPYEANLMILNMLAYVIISENLVNVEFVNSRTKGYEAYKSSILNDSYAN
FT                   PEFLLQIPGYESLVDDIRIVARKYATRKSLFFWGLGITEHLDGSYAVMAITHLAMLTGN
FT                   IGKRGAGLMPLRGQNNVQGTCDVGMLPYYAPDYQPPKEVGMMTPDLINAMCDGKIKALF
FT                   NISEDIAHIHPNQNKIHAALGNLDLLVVNELFDNEVTKFADIIFGVKSAYEKTGVYVNA
FT                   ERRLHLSQPLVRATMPDDWEVIAEISKRYGVDLGVASSYDVWEKVRADAPNRFGGASYE
FT                   KLEANRLRGLQWPVQEEDLPVLHIGTFRTKDGLGSFHYHQYSPRGQVEELLNVKSHEGY
FT                   YLTTGRILVHYNNGAQTNACDKLSRSHSEDTLLVSVEDEDFFEYKDFVVLKSEYGQSAP
FT                   LRVKVSSTVKKGTLFTTFHHAKSNINFLFGDECDELIKTARFKSIKVEVIKPDYLD"
FT   gene            208086..208421
FT                   /locus_tag="Sulku_0218"
FT   CDS_pept        208086..208421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0218"
FT                   /product="Uncharacterized protein family UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509; KEGG:
FT                   ant:Arnit_2816 hypothetical protein; PFAM: Uncharacterised
FT                   protein family UPF0102; SPTR: UPF0102 protein Arnit_2816;
FT                   PFAM: Uncharacterised protein family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32885"
FT                   /db_xref="GOA:E4TXX2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX2"
FT                   /protein_id="ADR32885.1"
FT                   /translation="MHTRARGNLAEERGCDYLRGKGLRIIDRNVYNRFGEIDIIALSSD
FT                   NVLHFIEVKSGSSYEQAVNNITSSKLQKLNRTIQTYLQQKKLNLDYCIDALIISDETLE
FT                   WIENITL"
FT   gene            complement(208418..210466)
FT                   /locus_tag="Sulku_0219"
FT   CDS_pept        complement(208418..210466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0219"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR000160:
FT                   IPR001633; KEGG: nam:NAMH_0258 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; SPTR: Diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain; GGDEF domain; TIGRFAM: diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32886"
FT                   /db_xref="GOA:E4TXX3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX3"
FT                   /protein_id="ADR32886.1"
FT                   /translation="MKLSHKLALTAVLGGSALISLFLFKTFSHDYFTDRNKLGLNFKAI
FT                   ETAQNQLDNQILNNAFFLYTNQDGINDKINHVHKELDILLRNPHIIQEHPNTYAALQKY
FT                   RAQFNHKVNAIYDFQTTNIVIKNTTAALLASQQHLFEHDETTPQGQEVLYEINRLAGSI
FT                   LLAKNALDSELITSLRPKIAALEHYRFVNPKNEELTQRMISHFKVIEQYFPQFVKVTEQ
FT                   IKDPALSATLSEAETAFYRESDAELRFVSYFSYLLVTLFIISIGIIAIFLVQSEREARI
FT                   DPLTRLRNRKAYEEDLKRKGEKAALILININKFKHYNDFYGVKEGDRLLIETAHHIQNI
FT                   PFAGYNPSYYRLGADDFGILFELFDYNDLHAISKTFLKTFSERPILIDNEPRTPSISIS
FT                   ASKFSPLLETADMALKNKTHTNPTVYHQGLNLHQIIADNVTKARELKDALAENRIVPYF
FT                   QPIISLSTRSVTKHEVLARIIMKDDQARSIYPYLHIAKESNLYPQLTRAIVTQSFAIIA
FT                   EHEGDFSINVSIDDIGNKETVALLEQLLEQYESIGKRIIFELLESEAIEEYNEIVEFIV
FT                   KMRRYGCRIAIDDFGSGYSNFSRILNLAIDIIKIDGSLIRNLDTDDKAITIVQTIVNFT
FT                   KNSSIKTVAEFVHNEAIADIVEKLEIDSAQGFYFYEPARHPVTVGQP"
FT   sig_peptide     complement(210383..210466)
FT                   /locus_tag="Sulku_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(210463..211389)
FT                   /locus_tag="Sulku_0220"
FT   CDS_pept        complement(210463..211389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0220"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="COGs: COG1858 Cytochrome c peroxidase; InterPro
FT                   IPR009056: IPR004852; KEGG: pmx:PERMA_0386 cytochrome c551
FT                   peroxidase (cytochrome cperoxidase); PFAM: Di-haem
FT                   cytochrome c peroxidase; PRIAM: Cytochrome-c peroxidase;
FT                   SPTR: Cytochrome c551 peroxidase (Cytochrome cperoxidase);
FT                   PFAM: Cytochrome c; Di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32887"
FT                   /db_xref="GOA:E4TXX4"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX4"
FT                   /protein_id="ADR32887.1"
FT                   /translation="MKGLIWIVCLLSSLTYAIEPIAPIPQTLPYDPQKAALGQKLFYDP
FT                   ILSKDYSISCASCHKRAYGGTDGESVSVGIYQLQGNMNAPTVLNSTFNFKQFWNGRANN
FT                   LREQALGPIHNPIEMGFSAAEAVSRLKKIPEYKESFQTITKRSLITSDDIADMIAEYEK
FT                   TLITPNAKFDLFLKGKSTLSYEEQEGYNLFKTLGCATCHNGVNVGGNSFQKMGVIIPVK
FT                   WDQKSSDRYALTKREIDKNVYKVPTLRNIALTAPYFHDGSAPTLKDAVKRMSYHNLGIT
FT                   LSDQESAYIISFLKTLTGKLPKTSLYR"
FT   sig_peptide     complement(211315..211389)
FT                   /locus_tag="Sulku_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            211575..211892
FT                   /locus_tag="Sulku_0221"
FT   CDS_pept        211575..211892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0221"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017937: IPR005746: IPR006662: IPR017936: IPR
FT                   013766; KEGG: wsu:WS0452 thioredoxin; PFAM: Thioredoxin
FT                   domain-containing protein; SPTR: THIOREDOXIN; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32888"
FT                   /db_xref="GOA:E4TXX5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX5"
FT                   /protein_id="ADR32888.1"
FT                   /translation="MGKYVELTVSNFDEITKEGVSLVDFWAPWCGPCRMIAPVIEELAA
FT                   EYEGKANICKVNTDEEQDIAVKYGIRSIPTILFFKNGEVVEQMVGAASKQAFADKLNAL
FT                   L"
FT   gene            212076..213014
FT                   /locus_tag="Sulku_0222"
FT   CDS_pept        212076..213014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0222"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR008255: IPR005982: IPR000103: IPR013027; KEGG:
FT                   tdn:Suden_1869 thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; PRIAM:
FT                   Thioredoxin-disulfide reductase; SPTR: Thioredoxin
FT                   reductase; TIGRFAM: thioredoxin reductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM:
FT                   thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32889"
FT                   /db_xref="GOA:E4TXX6"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX6"
FT                   /protein_id="ADR32889.1"
FT                   /translation="MLDCAIIGGGPAGLTAGLYTTRGGLDNVTMFEKGMPGGQITMSSE
FT                   IENYPGVTGHITGMDLMIPWPEQCQRFGLKHEMSEVTRVARGEDGIFIIQKSDGTSDEA
FT                   KSVIVCTGSAPKRAGFVGEDTFFGRGVSTCATCDGFFYKNKEVAVIGGGDTALEEALYL
FT                   AKICTKVYLIHRRDSFRSAPNTIARVKGTPNIELVLNAVPEEVFGGAMGVDGIRVKLQD
FT                   GSLRQIDVPGIFVFVGNNVNNQVLIQEDGSFLCDMTPWGEVKVDLSMKTSVPGLFAAGD
FT                   MRESAPKQVVCAAGDGAVAALQAIAFVDGHH"
FT   gene            213101..213871
FT                   /locus_tag="Sulku_0223"
FT   CDS_pept        213101..213871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0223"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COGs: COG0289 Dihydrodipicolinate reductase;
FT                   InterPro IPR000846: IPR011770; KEGG: tdn:Suden_1870
FT                   dihydrodipicolinate reductase; PFAM: dihydrodipicolinate
FT                   reductase; PRIAM: Dihydrodipicolinate reductase; SPTR:
FT                   Dihydrodipicolinate reductase; TIGRFAM: dihydrodipicolinate
FT                   reductase; PFAM: Dihydrodipicolinate reductase, N-terminus;
FT                   Dihydrodipicolinate reductase, C-terminus; TIGRFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32890"
FT                   /db_xref="GOA:E4TXX7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX7"
FT                   /protein_id="ADR32890.1"
FT                   /translation="MIRAGVFGAGGRVGKLLIEDLHNENEISLGAVYVRNELNFSIDPS
FT                   VLVTNDMATLLKGSDVIIDFSLPEATQLLLEQAIEHPTPLVIGTTGMDVHQMNLLKSAS
FT                   ESMPILYATNMSLGVALLNKLVHMAAKTLEGFDIEIVEQHHRHKKDAPSGTALTLAHSA
FT                   AAGRNLDLDAVRVSGRNGNIGERTKDEIAVMALRGGDIVGRHTVGFYNDGEFVELHHTA
FT                   TSRNTFSKGAIRAAKWLVGKPNGLYSIQDCLELA"
FT   gene            213882..215231
FT                   /locus_tag="Sulku_0224"
FT   CDS_pept        213882..215231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0224"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro IPR005854: IPR017932: IPR000583:
FT                   IPR000836; KEGG: tdn:Suden_1871
FT                   amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase; SPTR:
FT                   Amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain; Glutamine amidotransferases class-II;
FT                   TIGRFAM: amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32891"
FT                   /db_xref="GOA:E4TXX8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX8"
FT                   /protein_id="ADR32891.1"
FT                   /translation="MRSLNEKCAVVGIFDHPEASKLAYFSLHALQHRGQEAAGISTGDG
FT                   EKLYTIKDRGLVTQVFDTQKLNTLKGHMAIGHTRYSTAGDDSILDAQPVFARYDLGEMS
FT                   IVHNGNLTNAKEVRDALIKKGAIFQTYMDTENLIHLIAKSDQHHLTDRIIDAVKKIEGA
FT                   YSLVFLSRTKMFAMRDPHGFRPLSLGRVGDGYVVASETCAFDLIGAEYIRDVEPGELLI
FT                   FEKGKAPKSIKVFEPTPKHCIFEYVYFARPDSNVYNQNVYEMRKAMGKALAQEQPIEAD
FT                   MVVPVPDGGVPAAIGYSQQSGIPFEMAIMRNHYIGRTFIEPTQEMRDLKVKMKLSPIND
FT                   LIRGKRLIVIDDSIVRGTTSRQIVRMLKAAGASEVHMRISSPPTTDPCYYGVDTPDKEK
FT                   LIAANMTNEEICAFIEADSLGYLSNEALLASVNGKEENYCTACFTGKYII"
FT   gene            215347..216309
FT                   /locus_tag="Sulku_0225"
FT   CDS_pept        215347..216309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1242 Fe-S oxidoreductase; InterPro
FT                   IPR005911: IPR007197: IPR006638; KEGG: tdn:Suden_1872
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: conserved hypothetical
FT                   protein; PFAM: Radical SAM superfamily; TIGRFAM: radical
FT                   SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32892"
FT                   /db_xref="GOA:E4TXX9"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX9"
FT                   /protein_id="ADR32892.1"
FT                   /translation="MRTQIFTFGQYLHRRFGAKVSKVPVSISGFTCPNIDGSVAKGGCT
FT                   FCENDSFSPSLDRARELKGFYLNLQSTSNPHLEKQLQQLEWQFQALSSRLSDENNAQKF
FT                   LVYFQSFTNTYAPLETLKALYEKALTFDNVVGLSIGTRSDSISDETFEYLADLSQKTEI
FT                   WIEFGIQSIYDTTLERINRGHDSANVKEAIRKAKSYGLNVCGHLIFGLPGETKEMMLET
FT                   AKEAYALGIDSVKYHPLYVVKRTALANEYARGEFEPIDEELYLEVLREAIVLKPSHVSV
FT                   QRISAGIGDESLIAPQWCKDKNRQLRSINKALESVGLKY"
FT   gene            complement(216317..216850)
FT                   /locus_tag="Sulku_0226"
FT   CDS_pept        complement(216317..216850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0226"
FT                   /product="DNA gyrase subunit B"
FT                   /note="KEGG: cco:CCC13826_2105 DNA gyrase subunit B; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32893"
FT                   /db_xref="GOA:E4TXY0"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY0"
FT                   /protein_id="ADR32893.1"
FT                   /translation="MSPLTIWHYLLIAVLILLLLIGFLVSLRTNSKFSVFTTISLTLML
FT                   IGFFTWRSINENVYIVEVSQLDQERFYQSEQIVLKGIVRNVGNYPVANVIATVKLINSH
FT                   GGVGGKQSLFTQPSVFAQIYEGDNPNFKRQTVEKEELVADYLNPGKAKPFTIIMKYPSY
FT                   FKHATFDVTAKAAY"
FT   sig_peptide     complement(216758..216850)
FT                   /locus_tag="Sulku_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(216847..217362)
FT                   /locus_tag="Sulku_0227"
FT   CDS_pept        complement(216847..217362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1874 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32894"
FT                   /db_xref="GOA:E4TXY1"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY1"
FT                   /protein_id="ADR32894.1"
FT                   /translation="MKTKIIDFIHHLIIYDYLLFGGIFILFLLFLVLAIALRHKMALAV
FT                   LFVVLAFGTLTAGSVAGYIQLHKYLFKNKIILHEVKALQYTEALLIKGDINNTSKRSFK
FT                   ECTITTGVYKVTHNKYLDRVYPYVPFKKSSQKFIKPIPPGESKPFKLFVEPFRYTKDYN
FT                   ITIKAECR"
FT   sig_peptide     complement(217255..217362)
FT                   /locus_tag="Sulku_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(217359..218033)
FT                   /locus_tag="Sulku_0228"
FT   CDS_pept        complement(217359..218033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0228"
FT                   /product="phosphoribosyl-AMP cyclohydrolase;
FT                   phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /EC_number="3.5.4.19"
FT                   /note="COGs: COG0139 Phosphoribosyl-AMP cyclohydrolase;
FT                   InterPro IPR008179: IPR002496: IPR021130; KEGG:
FT                   tdn:Suden_1875 phosphoribosyl-AMP cyclohydrolase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; Phosphoribosyl-ATP
FT                   pyrophosphohydrolase-like; SPTR: Histidine biosynthesis
FT                   bifunctional protein hisIE; TIGRFAM: phosphoribosyl-ATP
FT                   diphosphatase; PFAM: Phosphoribosyl-ATP
FT                   pyrophosphohydrolase; Phosphoribosyl-AMP cyclohydrolase;
FT                   TIGRFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32895"
FT                   /db_xref="GOA:E4TXY2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY2"
FT                   /protein_id="ADR32895.1"
FT                   /translation="MNLDLIDWQKSELLPVIVQDSTTLEVLMMAYMNREALELSLSTRI
FT                   AHYYSRSKKRLWKKGESSGHLQHIEQFLLDCDNDTLLLIVRQEGVACHTGRKSCFFTNI
FT                   ESGEAISRPLIDTAATYGIIDELYHTILSRKNADPSTSWTAKLLSKGDNTILKKVVEEA
FT                   GEFSFAIKDGNEDEIIYECADLVYHVLVALGHKNISPDRIKQELARRFGMSGIAEKNSR
FT                   EQ"
FT   gene            complement(218104..219141)
FT                   /locus_tag="Sulku_0229"
FT   CDS_pept        complement(218104..219141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0229"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR000163:
FT                   IPR001107; KEGG: tdn:Suden_1876 band 7 protein; PFAM: band
FT                   7 protein; SMART: band 7 protein; SPTR: Band 7 protein;
FT                   PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32896"
FT                   /db_xref="GOA:E4TXY3"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY3"
FT                   /protein_id="ADR32896.1"
FT                   /translation="MASDMNDYFNKKKNEANRGGGFQSPKPPKMDFNLSGQKAGMLWII
FT                   GGILLLLVLAKPFIIITEGERGILSTNGKYEERALLPGLHFLIPFIQKVYLVDTKVRII
FT                   NYADKIDRASTAGDGIVLKPAITVLDKRGLPVTIELTVQYRLNPQVAAQTISNWGFSWE
FT                   DKIIDPVARDIVRNVVGQYEAENLPIMRNAIAQKIEVGIRNTVEGQKNAPAQLESIQLR
FT                   EIGLPQKVKDQIERVQVAKQEVERAQQDVERAKQEAFKKETEAQGTANAITIQAEAQAK
FT                   ANRLIGSSLTPGLLKLEQIQVQGKFNEALKENKDAKIFLTPGGSTPNIWLDTKTGDGQK
FT                   ISSTK"
FT   gene            complement(219196..220116)
FT                   /locus_tag="Sulku_0230"
FT   CDS_pept        complement(219196..220116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0230"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR005785: IPR001544; KEGG: tdn:Suden_1877 branched-chain
FT                   amino acid aminotransferase; PFAM: aminotransferase class
FT                   IV; SPTR: Branched-chain amino acid aminotransferase;
FT                   TIGRFAM: branched-chain amino acid aminotransferase; PFAM:
FT                   Aminotransferase class IV; TIGRFAM: branched-chain amino
FT                   acid aminotransferase, group I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32897"
FT                   /db_xref="GOA:E4TXY4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY4"
FT                   /protein_id="ADR32897.1"
FT                   /translation="MNEAKYIWMNGKLLPWHDAKIHVLSHTLHYGNGAIEGTKAYKTPK
FT                   GYAIFRLNDHTKRLIESAKMTLINVPYTVEELNHAQIELLKANEFTGENVYLRPIVYLG
FT                   YGVMGVYHKEAPVEVAVSAWEWGAYLGEEGMKKGIRLKISSFSRPNNKSNMGKAKAVAN
FT                   YLNSQMAKFEAVEAGYDEALLLDDEGYVAEASGASFFMIKDGEIITPPNDNSLASITQK
FT                   TVIEMAEKMGYTVSRRRISREEIYIADEAFLTGTAAEITPVREVDARVLGAGGRGPITE
FT                   KIQSSYFDIVYGRNPDYDHYLTYIN"
FT   gene            complement(220226..220675)
FT                   /locus_tag="Sulku_0231"
FT   CDS_pept        complement(220226..220675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0231"
FT                   /product="globin"
FT                   /note="COGs: COG2346 Truncated hemoglobins; InterPro
FT                   IPR001486; KEGG: abu:Abu_1553 hypothetical protein; PFAM:
FT                   globin; SPTR: Protozoan/cyanobacterial globin family
FT                   protein; PFAM: Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32898"
FT                   /db_xref="GOA:E4TXY5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY5"
FT                   /protein_id="ADR32898.1"
FT                   /translation="MLELKITDGVLGVRPPVTKPHPGFFFQVGEERFRKLVDDHYEKIR
FT                   NSDIAFLFPVNDEEDFANAKKHAADFLIQICGGPDYFAQTRGEPRMVGRHAPFRIDEHG
FT                   RRRWLEFYAELLPPLEAEGINPEYIQSFWDYLDIFSIWMINTPSH"
FT   gene            220810..222225
FT                   /locus_tag="Sulku_0232"
FT   CDS_pept        220810..222225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0232"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016160: IPR015590; KEGG: tdn:Suden_1899
FT                   aldehyde dehydrogenase; PFAM: Aldehyde Dehydrogenase; SPTR:
FT                   4-trimethylaminobutyraldehyde dehydrogenase, putative;
FT                   PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32899"
FT                   /db_xref="GOA:E4TXY6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY6"
FT                   /protein_id="ADR32899.1"
FT                   /translation="MDAHVWMGSRQVVTQSYNERLSPYDGRVVSRAAECSADDARQALI
FT                   IAQNASKIAKKVALHQRCAWLLDVASKLKEQREEFARVLCDEVGKPITYARIEVDRCIE
FT                   TITLSAETMRTMHGESINTDAMPSGRAAHAYWRREAAGVVVAITPFNFPLNLVAHKLAP
FT                   ALVAGNAVVLKPTPEAPLCAYKLAQLFIESPYATPDALSVVYGDAEVGSALVGSDIPRV
FT                   ISFTGSVGVGNIITRSAGIKKISLELGGNAATYIDTSADLEYAAARCAIGAFVNSGQVC
FT                   ISLQRIYVDSSVYDEFALKMAEATSKLVVGSPYNDDTFLGPLINDEAASRAMSWVESAI
FT                   EEGARALTPPRCEGRIFYPCVMADVTESMKIVCEEVFAPIVSLVRVDGIDDAITRMNNS
FT                   PYGLQFSVFTNNLSHATKAIDELDAGGVVINDMPTLRFDIQPYGGVKLSGVGREGPRFA
FT                   IEEFTEIKSIVIL"
FT   gene            222244..222711
FT                   /locus_tag="Sulku_0233"
FT   CDS_pept        222244..222711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0233"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG1225 Peroxiredoxin; InterPro IPR017936:
FT                   IPR000866; KEGG: tdn:Suden_1803 alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; SPTR: Alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32900"
FT                   /db_xref="GOA:E4TXY7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY7"
FT                   /protein_id="ADR32900.1"
FT                   /translation="MLEVGTTAPDFCLSNQDDVEICSRDLRGKWIVLYFYPKDSTPGCT
FT                   TEACEFSDAMDDYDDMGAIILGVSADSTKSHRNFIEKKSLQITLLSDPTTQMMQEYGVW
FT                   AMKKNYGKEYMGIVRSTYIIDPKGIVRVAWTNVKVKDHVAKVKEELAKVQG"
FT   gene            complement(222738..224267)
FT                   /locus_tag="Sulku_0234"
FT   CDS_pept        complement(222738..224267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0069 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3373)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32901"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY8"
FT                   /protein_id="ADR32901.1"
FT                   /translation="MKQRILGSVITAALLTTNAFSDDSLIQRFEKMEREMAALKAELES
FT                   IKAENSRLSTQLSTPSNTNSKQDATTSANINETLEDIQDQISTINKKTNGDNLKFGVDF
FT                   RTSVDNLHYKMADGSTHKNDAVFSNRLWLNMGYAANKNISFTGQLAYNKIFGERAQTTQ
FT                   SPAMEGFDWISGESAYDDTLRVRSAYFLYTDDELAGLEIPWTFSIGRRPSTEGHLINFR
FT                   DDVKTSSPLAHAINVEFDGASAKFGTEELTGLAGSYFKLCAGRGMSEAEPRFSSAPYTG
FT                   NGSSKTNNIDMAGIIVVPYDDKQFSTGFQYTYANNLIDQEAPGGNMETVGGLHTATAFA
FT                   MVNGIGDGWSEFLDDSLIFISGAVSKTDPYKGSGKQGMLGSFDSETGYSYWIGTQFPSL
FT                   ISEEGRWGIEFNHGSSFWRPLTYGEDTLIGSKIAARGDAYEVYFTEPLVDDILTFQLRY
FT                   TYINYDYSGSNGFFGSVTGTPMSMDQAIGAGYGDNVVDKAQDIRAYLRYKF"
FT   sig_peptide     complement(224205..224267)
FT                   /locus_tag="Sulku_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            224571..225347
FT                   /locus_tag="Sulku_0235"
FT   CDS_pept        224571..225347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0235"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="COGs: COG0052 Ribosomal protein S2; InterPro
FT                   IPR018130: IPR005706: IPR001865; KEGG: tdn:Suden_1802 30S
FT                   ribosomal protein S2; PFAM: ribosomal protein S2; SPTR: 30S
FT                   ribosomal protein S2; TIGRFAM: ribosomal protein S2; PFAM:
FT                   Ribosomal protein S2; TIGRFAM: ribosomal protein S2,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32902"
FT                   /db_xref="GOA:E4TXY9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY9"
FT                   /protein_id="ADR32902.1"
FT                   /translation="MVTMKDLLECGVHFGHQTRRWNPKMKKYIFGVRKNIYIIDLQKTL
FT                   RYFRNAYQQVVDAAAEGKTVLFVGTKKQARVAIRDAAVACGMPYVDNRWLGGMLTNFPT
FT                   IQKSIRKLDIIEEMQANGQINLLTKKEALMMNRQKEKLIAYLGGIRHMKTLPDMMFVID
FT                   AVKEHIAVQEARNLGIQVVAPLDTNCDPDVIDIPIPGNDDAIRSIQLFCKEMAEAINEG
FT                   KALRNGGNDEAVAEEEVAPEAAAVEAATEEVVAEEA"
FT   gene            225350..226417
FT                   /locus_tag="Sulku_0236"
FT   CDS_pept        225350..226417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0236"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="COGs: COG0264 Translation elongation factor Ts;
FT                   InterPro IPR018101: IPR001816: IPR000449: IPR014039; KEGG:
FT                   tdn:Suden_1801 elongation factor Ts; PFAM: Translation
FT                   elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; SPTR:
FT                   Elongation factor Ts; TIGRFAM: translation elongation
FT                   factor Ts; PFAM: Elongation factor TS; UBA/TS-N domain;
FT                   TIGRFAM: translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32903"
FT                   /db_xref="GOA:E4TXZ0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ0"
FT                   /protein_id="ADR32903.1"
FT                   /translation="MAEITAAMVKDLRTATDAPMMDCKKALTECDGDMEKAKDWLRDRG
FT                   MAQTAKKADRVAAEGLLGLKVSETFSSASLVEINSETDFVAKNDGFIALVGNTAAHVFT
FT                   TGVSTVEELNETSYETGTFSEYFTSQVARIGEKIVTRRFVTLNAGENGCVNGYVHSNGR
FT                   VGVLVAAACSDAKVAEAMAPMLKNVAMHAAAMKPTTLTSKDFDPAFVEAETIGRIEAIK
FT                   TENEELARLKKPLKNVPQYISACQLTPEVMAAAEEAIKAELAAEGKPEKIWANIIPGKL
FT                   ARFVADNTTLDKELALLDQNYVMDDSLTVAEAITKEAAKHGGTAELVEFVKYEVGEGIE
FT                   KQVNDFAAEVAAQMS"
FT   gene            226505..227146
FT                   /locus_tag="Sulku_0237"
FT   CDS_pept        226505..227146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0237"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: tdn:Suden_1799 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: Lipoprotein-releasing system
FT                   ATP-binding protein LolD; manually curated; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32904"
FT                   /db_xref="GOA:E4TXZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ1"
FT                   /protein_id="ADR32904.1"
FT                   /translation="MTLLKATSLSHAFDYPLFEDISMTLNEGESIAIVGVSGSGKSTLM
FT                   HILSSLLHPLKGNVELFGEDIYRLDDKSLVKLRRNDLGMIYQSHYLFKGFSAYENLEVA
FT                   TLLSGEKIDPTLLKRLGIDHVINQKVTELSGGQQQRVSIARVMSKKPRLIFADEPTGNL
FT                   DHATALEVMEIFDDYLREHKAAMILVTHDEALAERCTHVYRMQNGSLKEM"
FT   sig_peptide     226505..226540
FT                   /locus_tag="Sulku_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            227151..227915
FT                   /locus_tag="Sulku_0238"
FT   CDS_pept        227151..227915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0238"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="COGs: COG1684 Flagellar biosynthesis pathway
FT                   component FliR; InterPro IPR006303: IPR002010; KEGG:
FT                   tdn:Suden_1798 flagellar biosynthesis protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; SPTR:
FT                   Flagellar biosynthetic protein fliR; TIGRFAM: flagellar
FT                   biosynthetic protein FliR; PFAM: Bacterial export proteins,
FT                   family 1; TIGRFAM: flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32905"
FT                   /db_xref="GOA:E4TXZ2"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ2"
FT                   /protein_id="ADR32905.1"
FT                   /translation="MEWAEIFSEGRTIAFILLFIRFGALFMAVPIFSHMNIPISIKAAM
FT                   AFFFTVFFFGAVPPLHIPTDTLSLTVAILGEMLFGLAVGIVLQLAYHVITFAGGQISFM
FT                   MGFSLASAIDPQSGVSMPIISQFLSLLALMILLIFDLHHWILLYASQSISTVPLGGFLM
FT                   TPSLFKYIMHAMTNMFVVGFMIAFPITALSMLADLIFGMLMKTMPQFNLLVIGMPIKIA
FT                   VSFVVLMATLGATLMIVTSQTQNAYNFLEKLF"
FT   sig_peptide     227151..227279
FT                   /locus_tag="Sulku_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(227907..228383)
FT                   /locus_tag="Sulku_0239"
FT   CDS_pept        complement(227907..228383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1499 nuclease NucT; SPTR: Membrane
FT                   bound endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ3"
FT                   /protein_id="ADR32906.1"
FT                   /translation="MIKLLVLLFIFVSVYAQETIFKLPDNHSRFLHQLDRSFKTASQIL
FT                   IITPSLHHSDLSKKLLSAIKKGTTVTLTVQETKGDPLSLIQYKNIELYLSEVKLDQTLI
FT                   LVDDSLVCTSDGTINEELFRSAHSVIRCSDNPNKIRSIRNASYPFIQHARPYLE"
FT   sig_peptide     complement(228318..228383)
FT                   /locus_tag="Sulku_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            228463..229947
FT                   /locus_tag="Sulku_0240"
FT   CDS_pept        228463..229947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1797 hypothetical protein; SPTR: DNA
FT                   topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32907"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ4"
FT                   /protein_id="ADR32907.1"
FT                   /translation="MKILLFNDNPVVRKLVALSAQKTKDDLSVVWSTDEIEGNEYDLLI
FT                   VDDALYSDEILDSINEKIVAKNTLFMATRGKAVPSGFDNVINKPFLPTDLVDMFVQIEK
FT                   KVSVGRDQSDNEVEEHASSTSTYAINLEDSLSELEGDETEALVGAEDDLDFGDLDDYED
FT                   KLPETAILDQEEVQEVQELLEDTEEDDLTMDDEFSVEGSAPISLPDEEIGVPIELEDDF
FT                   SLDDANIIDEEKEEEELLGFDDIEENEIPSDEEVPKNDLSEDDEFGDLELPEPLEESSG
FT                   LSDEDELLSMGEDDALGELELPEDDGLSDMNDATSFDLSGLEEMDESMLMDDDELGDLE
FT                   SKIEDAVGGLESEELERELETDDFDLSLNDEMMEELMSTEEENLMDTGSFDELDMLDER
FT                   ELKIAVGEEVEEEDEPVLVAKGGSSLAAEALDEVLNESSPYAEFTDEIEEAEPVASHAE
FT                   GVEALQALLKALSNENVSKSLKGMNISININFGNGA"
FT   gene            229944..230564
FT                   /locus_tag="Sulku_0241"
FT   CDS_pept        229944..230564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0241"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro IPR020590:
FT                   IPR017665: IPR008144: IPR008145; KEGG: tdn:Suden_1796
FT                   guanylate kinase; PFAM: guanylate kinase; PRIAM: Guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region; SPTR: Guanylate kinase; TIGRFAM: guanylate kinase;
FT                   PFAM: Guanylate kinase; TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32908"
FT                   /db_xref="GOA:E4TXZ5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ5"
FT                   /protein_id="ADR32908.1"
FT                   /translation="MNRQSGAILVLSGPSGAGKSSLIQKIKDQIGPIYFSISTTTRPIR
FT                   EGEVDGVHYYFVGVEEFKRDIEDEMFLEYAVVHGNYYGTSLGPVKKALKEGKLVIFDID
FT                   VQGHDAVQNRLSDITTSVFITTPSLEELKRRLYNRSTDSEEVILGRIEMAKREVQRISE
FT                   YDFLIVNDNLEEAAEILVSIAKAARMKIPTFQINEFVQTWEAS"
FT   sig_peptide     229944..229994
FT                   /locus_tag="Sulku_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            230637..230873
FT                   /locus_tag="Sulku_0242"
FT   CDS_pept        230637..230873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0242"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="InterPro IPR006312: IPR003369; KEGG: tdn:Suden_1795
FT                   twin-arginine translocation protein TatA/E; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106; SPTR:
FT                   Twin-arginine translocation protein TatA/E; TIGRFAM:
FT                   twin-arginine translocation protein, TatA/E family subunit;
FT                   PFAM: mttA/Hcf106 family; TIGRFAM: twin arginine-targeting
FT                   protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32909"
FT                   /db_xref="GOA:E4TXZ6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ6"
FT                   /protein_id="ADR32909.1"
FT                   /translation="MSMPSGTELLLIFGIVILLFGAKKIPDLAKGIGQGIRNFKKEMKE
FT                   EEPVATTTPTEAPKQVDASASTTAEAPKTTTQA"
FT   sig_peptide     230637..230702
FT                   /locus_tag="Sulku_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            230877..232457
FT                   /locus_tag="Sulku_0243"
FT   CDS_pept        230877..232457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0243"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR001412: IPR001278: IPR015945: IPR005148: IPR
FT                   008909; KEGG: tdn:Suden_1794 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32910"
FT                   /db_xref="GOA:E4TXZ7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ7"
FT                   /protein_id="ADR32910.1"
FT                   /translation="MKQRVNALLRDKFNADVILEKPKDRSFGHFATPIAFSLAKELRKS
FT                   PMLIAEEIAGSFADESMFSAVESVQGYINFRLSEAFLDEYASWALSHGDEFGSSDKKGT
FT                   ILLEFVSANPTGPLHIGHARGAVYGDTMLRLGRHLGYDITAEYYVNDAGNQIDLLGVSL
FT                   QLEGRSSLLGESVEWPEKYYRGEYLSDLAREVVELFGEEALRDESRQKELALWAKDKIL
FT                   ALIVDDLAAINVHFDTFVGEASLYSEWDRVMAKMGEGVYVNEGKTFIRSSDLGDDHDRV
FT                   VVREDGRPTYLAGDIIYHNQKFERGYDDYINIWGADHHGYIARVKAAITFLGYDSSKLE
FT                   VLLSQMVSLLKDGEPFKMSKRAGTVILMSDVVEEIGAEALRFMFASKKCDTALEFDIEE
FT                   LKRQDSSNPIYYIQYAHARIQTLISKSEKNMDEIMGSHLYGLSSDADGLLFEALLLPEI
FT                   IDDAFESRQAQKLPDYLKVLAGRLHKFYYDTRIIGTEDEAKLLKLLLVVALSIKTGLSL
FT                   LGIQAKDRM"
FT   gene            complement(232506..233252)
FT                   /locus_tag="Sulku_0244"
FT   CDS_pept        complement(232506..233252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0244"
FT                   /product="flagellin domain protein"
FT                   /note="InterPro IPR001492: IPR001029; KEGG:
FT                   cff:CFF8240_0520 flagellin; PFAM: flagellin domain protein;
FT                   SPTR: Flagellin; PFAM: Bacterial flagellin N-terminal
FT                   helical region; Bacterial flagellin C-terminal helical
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32911"
FT                   /db_xref="GOA:E4TXZ8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ8"
FT                   /protein_id="ADR32911.1"
FT                   /translation="MKVNSLSNALPQMNTETSNRDKTLEKIATAVELKLEDSSSRTIAD
FT                   MMQNQISSLSQGLMNANDGIAMLQIADGALSSLSDQTQTLNDLSVRNNSAILNSADKQA
FT                   LNSQFQRTLSSMQNIVNTTSYNGNPLFNNNFSISIGEGTLSASIANVSPKGLSIDNQEG
FT                   INQYAQTLASAQSDVGSATNNFISSTNVLLQQITDTAAAKSQIADTDMAKQVSEFQQSN
FT                   NQISAGLLAMAHQTDTMRQSMARLLG"
FT   gene            233395..234243
FT                   /locus_tag="Sulku_0245"
FT   CDS_pept        233395..234243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0245"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR017755:
FT                   IPR003010; KEGG: tdn:Suden_1844 nitrilase/cyanide hydratase
FT                   and apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; SPTR: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; TIGRFAM:
FT                   N-carbamoylputrescine amidase; PFAM: Carbon-nitrogen
FT                   hydrolase; TIGRFAM: N-carbamoylputrescine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32912"
FT                   /db_xref="GOA:E4TXZ9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ9"
FT                   /protein_id="ADR32912.1"
FT                   /translation="MVKVAAIQMQMSEDKASNVAKAESMVRDAARNGANIILIPELFEG
FT                   YYFCKDMDDKYFAWAQPLENNPLIAHFSALAKELGVVLPISYFERDGERYFNSLVMIDA
FT                   DGTVMENYRKTHIPDGPGYEEKFYFEPGDTGFKVWETRYGNVGVGICWDQWFPETARSL
FT                   TLLGADMIFYPTAIGSEPEIGVDSASHWQRVQMGHSAANIIPVIAANRIGEEVGESCTL
FT                   TFYGSSFITDHTGAKVAEASRNREEILYSEIDPASIREHRHYWGLIRDRRPECYGEIVK
FT                   Q"
FT   gene            234248..234928
FT                   /locus_tag="Sulku_0246"
FT   CDS_pept        234248..234928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0246"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: abu:Abu_1762
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver; SPTR:
FT                   Two-component response regulator; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32913"
FT                   /db_xref="GOA:E4TY00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY00"
FT                   /protein_id="ADR32913.1"
FT                   /translation="MEKSATKNLHVLYVEDDDVARENGIEYLENYFDHVHAASDAFEGL
FT                   KLYREVHPEIIITDIQMPKLNGLEFIKQIRKENKETQIIVISAYSDTTYLLQAIELQLV
FT                   KYLIKPVQESAFKEALRQCIESIHHKDSNIINLPENTYFDTYNQTLVRDGDIVALRTKE
FT                   LQILSLLLKYKNRYVTYSEIENHVWRESAMSNDALKTLMKNLKAKLPPNLISNLSGTGY
FT                   KIEC"
FT   gene            234918..236237
FT                   /locus_tag="Sulku_0247"
FT   CDS_pept        234918..236237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0247"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR004358: IPR005467: IPR003594; KEGG: abu:Abu_1761
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: Two-component sensor histidine
FT                   kinase; PFAM: 7TM diverse intracellular signalling;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32914"
FT                   /db_xref="GOA:E4TY01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY01"
FT                   /protein_id="ADR32914.1"
FT                   /translation="MSAEAFTHLAYGATFGILLMSIVYTLVRYVYSKEIMYISYCAMQV
FT                   FSLGYISVYSHLFSLSAFSQEIFLLLATLSAVIFAITFHEGNLIPKITNFKELVINTLL
FT                   LNVVILTAFYHYILFEYLPYTVVYAILFLSIVFNLRSGFKPTIVYVIGWSLLCILLFVF
FT                   QLKQVYVEHGYIDIVLAAFAVEAVLFTISISYKYNLFKNQALDHQNMLFQQSKMAKSGE
FT                   MIANITHQFRQPLNNLSYLLMNLKSRYENRTLDDAYFDKKIASAQEQLQFLSKTIDDFK
FT                   EFYTPDKVKEPFSLTEAIRNSVAVIAPDLKSKGIVLEVVACDEEVIVFGKKNELSQVLL
FT                   ALISNASDALRGVSEPKIILRSNRNGSEAMIRLEDNGSGIPSDVLGKIFEPYVTTKSQG
FT                   SGIGLYLCKMIIEKSFGGKIEVESKVREGSVFTLSMALYH"
FT   sig_peptide     234918..235013
FT                   /locus_tag="Sulku_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(236231..237559)
FT                   /locus_tag="Sulku_0248"
FT   CDS_pept        complement(236231..237559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0248"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro IPR017900:
FT                   IPR014116: IPR017896; KEGG: abu:Abu_1760 ferredoxin-like
FT                   protein; SPTR: Ferredoxin-like protein; TIGRFAM: cytochrome
FT                   c oxidase accessory protein CcoG; PFAM: Ubp3 associated
FT                   protein Bre5; TIGRFAM: cytochrome c oxidase accessory
FT                   protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32915"
FT                   /db_xref="GOA:E4TY02"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY02"
FT                   /protein_id="ADR32915.1"
FT                   /translation="MSYATKRYWFYAFVTLFTFVVPFITLNENHLLLLSFEKLQFHFMG
FT                   LAYDVNEFYIMPFLLMFLFIGIFALTSILGRAWCGWGCPQTIFRTIYRDLIQGTLLDLR
FT                   NNANKQKRMDTSPLENKLKIVVGFLLWTLIATTASTNFIWYFVPPEDFFTYMYHPEEHL
FT                   FIIIFIATTAAFLIYDIVWMQESFCTYLCPYSRIQTVLYDDNTKHVVYNHNRGGLIYQN
FT                   NQKQITDSKQWIGTEECTTCEACVKVCPTHIDIRQGLQLECINCLGCADACTAVMGKLG
FT                   KKSLIEWGSQKSIFHDIKCSIFSKRNMMYFVAMAGSLIFAAAFASEQERVLVNINKPNE
FT                   LYKVQEGIVSNNYIVNIHNTQKQTYTYDVKVEDKNFRIDSFEALTLKPDGMRKRILVIS
FT                   TNQNLSQSDRRDTALKVKLMIFAKEDPKISVVKEISFIYPRTQ"
FT   sig_peptide     complement(237482..237559)
FT                   /locus_tag="Sulku_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            237684..238472
FT                   /locus_tag="Sulku_0249"
FT   CDS_pept        237684..238472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0249"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="InterPro IPR001623; KEGG: tdn:Suden_1842 heat shock
FT                   protein DnaJ-like; PFAM: heat shock protein DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   SPTR: DnaJ domain protein; PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32916"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY03"
FT                   /protein_id="ADR32916.1"
FT                   /translation="MKVVLRNNAIFVQGSSNTLEESWMEEFFDHHIHNTLFLDNGVLVL
FT                   NNENSSDQKEEFLETLSERFTKANELTSSFYSRSLKRCRTAAVRIEVPFRESEKVDIEV
FT                   YAYNSGCVQFTLLSPNRWVMRYLKQQLSNLVTSSTDDDIFIDVSTAAAKARLEKTLNRR
FT                   EVLHFTINYQYDDEFMSRLYGNYKGWGFGNDAIDKMIRYHAIFEIPMGSTPEDLKKRYR
FT                   MLAKRYHPDRVQSKNPKIINKYTEKFQLLQEAYGALRAVS"
FT   gene            complement(238455..239360)
FT                   /locus_tag="Sulku_0250"
FT   CDS_pept        complement(238455..239360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0250"
FT                   /product="DUF234 DEXX-box ATPase"
FT                   /note="InterPro IPR004256; KEGG: tdn:Suden_1841 DUF234
FT                   DEXX-box ATPase; PFAM: DUF234 DEXX-box ATPase; SPTR:
FT                   Dexx-box atpase; PFAM: Archaea bacterial proteins of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32917"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY04"
FT                   /protein_id="ADR32917.1"
FT                   /translation="MDKKLISDFFHLNLPRDMEQCIELFAIFGGYDTPIDADAPIESLI
FT                   TQHILEPFELHRERFLSSLQDNPLYLNLLHAIAVGDRRQGSAYRRARIGKERGNEAFEF
FT                   LRYSGYLTLERSREMPLERAHPKQRFKKEIEHHKISHKYRFKFPFLRFWFAFVEPFSKS
FT                   IQEGNYLPFFAHFHERFNAFVGFTFEELCDLYIREILAPRFKNDLLDSGSYWNREVEID
FT                   LLTETMEGETWVGECKWTNHKVNKKELRHLEEKCVKLSIAPDRIFLFTKRGFSNELNDL
FT                   KDKRLFRFSAEDLSVLTDRP"
FT   gene            complement(239415..239744)
FT                   /locus_tag="Sulku_0251"
FT   CDS_pept        complement(239415..239744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100060083 similar to tetratricopeptide
FT                   repeat domain 6; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32918"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY05"
FT                   /protein_id="ADR32918.1"
FT                   /translation="MLNTIREAQKQFQLLHQLLNLPMNRDTEYFTQLSIESEEAYVLMN
FT                   AGMCINTSVCRECAEHRDFIRSILEILSELEINASAANTYAAKLNEYSERVSKILKNIA
FT                   VVLAS"
FT   gene            239835..240851
FT                   /locus_tag="Sulku_0252"
FT   CDS_pept        239835..240851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0252"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395; KEGG:
FT                   sun:SUN_1152 aldo/keto reductase-family protein; PFAM:
FT                   aldo/keto reductase; SPTR: Aldo/keto reductase-family
FT                   protein; PFAM: Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32919"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY06"
FT                   /protein_id="ADR32919.1"
FT                   /translation="MEYRYIGRSGLRVSPICMGTMTFGSQCDEKTAFKIMDKAYEAGVN
FT                   FFDTAELYPVPPEEKLAGLTEEMVGRWLKTKPRESIILASKVAGAASGWFVPPIRHGYT
FT                   AIDRFHIVRAIEGSLKRLDTDYIDLYQMHWPDTVVPIEESMRAFDALVQSGKVRYIGTS
FT                   NDSARGTMKSLMVSKYEKLARFESIQNNFSLLNRRDLTEIGALCREEKVSLLPYSPLAG
FT                   GVLSGKYNQDINAHGRFSDYVKSSNKRQRLMAARFMNDKTLASTQEYLRIAHEAGLHPV
FT                   TMAIAWSKQFDFVASTIIGATTPEQLDASLGAMNVTLSPEILQKLDEVHAKILYPMG"
FT   gene            240823..241323
FT                   /locus_tag="Sulku_0253"
FT   CDS_pept        240823..241323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0253"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: tdn:Suden_1836 putative lipoprotein; SPTR:
FT                   Lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32920"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY07"
FT                   /protein_id="ADR32920.1"
FT                   /translation="MQKFFILWVSLAALFIGGCAQKHYEISKPKLIVMKTPKLKFADTG
FT                   YIRSSGERVEAELFTAGVAVEKISIDDKVCVNAGCMSEEAFVREYLSPDYPKDTLRRIL
FT                   LAEPIFGGINTSEQCGGARTQYIRDDKRDIVYRLKTDETYFKDRVNGFIIKISDLDDNQ
FT                   SLP"
FT   sig_peptide     240823..240888
FT                   /locus_tag="Sulku_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            241360..242592
FT                   /locus_tag="Sulku_0254"
FT   CDS_pept        241360..242592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0794 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32921"
FT                   /db_xref="GOA:E4TY08"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY08"
FT                   /protein_id="ADR32921.1"
FT                   /translation="MNVSPGFSLPLRLIAPYFVAAVLFNIASMIFLFFLQSDIGLRDFR
FT                   VIGWVHAYMIGFVMMSIIGAMAQLSVVVAEVHHRYPKVFAWIGPLLGAGTVVLVIGFIY
FT                   NPFWLGIGGGLILCALAIFAFNLFITLRFSRRRTAVTRSMQWSTLFLGIGLMIGMMMAL
FT                   GYGGIIPVDPTHWRMGHIFAVFGGYVMINIMGVSTVLLPMFGACNRVSDNDYTVSFYTM
FT                   VIAVGMMLFASVLQIEILEYVALWLGIGSVMYYMFRVYLIFTSRKRVYSDIWERSVSVA
FT                   FIALALSVGSGVYGIVSGSEKAHMISFWFLTAGFLGFLITAHLYKIVPFLVWFERYAPY
FT                   VDEREVPMLHQLLPAKLADIQWGFAVAGLVMIAAAMGTGINALWQIGAFLSVLSGGVLL
FT                   AVLIRVLGDKL"
FT   sig_peptide     241360..241422
FT                   /locus_tag="Sulku_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            242621..243766
FT                   /locus_tag="Sulku_0255"
FT   CDS_pept        242621..243766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0255"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR004838: IPR001176: IPR004839;
FT                   KEGG: dal:Dalk_0036 aminotransferase class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Aminotransferase
FT                   class I and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32922"
FT                   /db_xref="GOA:E4TY09"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY09"
FT                   /protein_id="ADR32922.1"
FT                   /translation="MKLSKRSGNVEQSHIRSMTKACNALGGINMAQGVCDLDVPREVIE
FT                   GAYGAMKEGINIYTPTEGLPRLRNAIASKMKRFYDVEIAPEQVLVSDGATGAFYTACMA
FT                   LLNPGDEVILFEPYYGYHRSTLTSLGIVPTFVRLEAPEWSLDINALEAVVTPKTRAMVI
FT                   CNPANPSGKVYTREELEMIGAFAERHDLIIFADEMYEHFLYGDAVHISALSVPSLKERC
FT                   VVLSGFSKVFSITGWRLGYAIAPIHVIEAMAQLNDLIYVCAPAPLQIGAAVGLEELEDE
FT                   YYTELARLHEHKRDLFCDALRDAGLTPSIPKGAYYVMTDVSAVAGNDDFEKAMEILERT
FT                   GIASVPGRAFYHDDAGKNMVRFCYSKPLEVLVEAAERIQRL"
FT   sig_peptide     242621..242719
FT                   /locus_tag="Sulku_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            243802..244035
FT                   /locus_tag="Sulku_0256"
FT   CDS_pept        243802..244035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tkm:TK90_2821 type IV secretory pathway VirB4
FT                   components-like protein; SPTR: Type IV secretory pathway
FT                   VirB4 components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32923"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY10"
FT                   /protein_id="ADR32923.1"
FT                   /translation="MLSVQINNPAVENFFHHSSESIVQFLEKAVAHLEKNPSFIVSSMD
FT                   DARARVESARKSDDTLSEEEYKSDMEAFWKSV"
FT   gene            244020..244316
FT                   /locus_tag="Sulku_0257"
FT   CDS_pept        244020..244316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0257"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: tdn:Suden_0815 plasmid
FT                   stabilization system protein; PFAM: plasmid stabilization
FT                   system; SPTR: Plasmid stabilization system; PFAM: Plasmid
FT                   stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32924"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY11"
FT                   /protein_id="ADR32924.1"
FT                   /translation="MEECVIRIVRNRKFTIQLQNILRFIALDKRSAALDFQHEIDTKFE
FT                   LLKTQPMMGRVSLYAEDENVRDLIYCGYTIVYEIKDEQTIRILEIFKWQDKLG"
FT   gene            244321..246162
FT                   /locus_tag="Sulku_0258"
FT   CDS_pept        244321..246162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0258"
FT                   /product="KAP P-loop domain protein"
FT                   /note="InterPro IPR011646; KEGG: plu:plu1827 hypothetical
FT                   protein; PFAM: KAP P-loop domain protein; SPTR:
FT                   Similarities with unknown protein; PFAM: KAP family P-loop
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32925"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY12"
FT                   /protein_id="ADR32925.1"
FT                   /translation="MTQNTAVNHHIKDFLEYYIALDQPEYAVLLSGKWGSGKTFFINQV
FT                   TEKYQDSKNIVKVSLFGLKSKEDIHKKVLLKLFNIDDTHDVSVTARVVGQVLKKFTGIN
FT                   LSDMPMGWALKQEGNQNAIFIFDDLERTGIELLELHGYINELTETHKQKVILLADEDKL
FT                   KDDEKYILFKEKTIGKTFQIEQDFDTVFSSFLNGLKHSKEILQNNQSVIKSVYETAGYN
FT                   NLRSLRQGLLDFDRLINYFEPKFKNHAELMTEIIQNFFVFTFEIKSGKLDIQTLQEMTM
FT                   LRVGRMLNEEKSDDKLTPIEKVFHKYSFLSYELLLSMESWIDFFTLGILASERITDDLN
FT                   RSRYFFREEREEWLNLWYFRELEEEEFQIALKSTLDKLERNEYSDAEIVMHITGILLRL
FT                   SANRLYQNTEADIVQTMKEYIDRNRKNWDDIYTVDDFRIEQSGFGLGYQNEEMDEFKEV
FT                   KNYLLEKAKETMYEDLSAQGERLLKYLEENNISMFMEMLSETRNDILYRLPVFQNLNPE
FT                   DFVETLYHVKNQHFRSVVKTLLIRYDQVGWGVYFPLLEELDFWKSVCQIIRGEIEDKPI
FT                   NIKVTWLKYLNESIEEKIIRKIEKQMQHIEKEKNNVE"
FT   gene            246152..247000
FT                   /locus_tag="Sulku_0259"
FT   CDS_pept        246152..247000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0259"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro IPR018246:
FT                   IPR001719: IPR012307; KEGG: tdn:Suden_1835 endonuclease IV;
FT                   PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; PRIAM: Deoxyribonuclease IV (phage-T(4)-induced);
FT                   SMART: AP endonuclease family 2; SPTR: Probable
FT                   endonuclease 4; TIGRFAM: apurinic endonuclease Apn1; PFAM:
FT                   Xylose isomerase-like TIM barrel; TIGRFAM: apurinic
FT                   endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32926"
FT                   /db_xref="GOA:E4TY13"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY13"
FT                   /protein_id="ADR32926.1"
FT                   /translation="MSNKYVGAHVSASGGVFNAPLNAMAIGAKAFALFTKNQKQWAAKP
FT                   LDDETIGLFKDNLAKSGILPKHVLPHDSYLINLGHPEEDKRQKSLEAFIDETRRCMQLG
FT                   LDRLNFHPGSHLKQISEEECIERIASSMNETLSVTNGVTLVIENTAGQGSNLGWRFEHL
FT                   SAIIERIEDKSRVGVCIDTCHMFTAGYDIRTRAAYDATWKEFDTIVGFKYLKGMHINDS
FT                   KPDLGSHVDRHDSIGKGKIGVEPFGFIMNDPRMDDIPLVLETIDETIWAQEIALLYSLQ
FT                   R"
FT   sig_peptide     246152..246226
FT                   /locus_tag="Sulku_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            247004..248215
FT                   /locus_tag="Sulku_0260"
FT   CDS_pept        247004..248215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0260"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="COGs: COG2067 Long-chain fatty acid transport
FT                   protein; InterPro IPR005017; KEGG: tdn:Suden_1834
FT                   hypothetical protein; PFAM: membrane protein involved in
FT                   aromatic hydrocarbon degradation; SPTR: Membrane protein;
FT                   PFAM: Outer membrane protein transport protein
FT                   (OMPP1/FadL/TodX)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32927"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY14"
FT                   /protein_id="ADR32927.1"
FT                   /translation="MKRSLVLSVALSAALSAAGYKIPENSINATALSAAYVANVHGADA
FT                   AYYNPAAMVYNDDANLLEVDATYIGLSGIDFSGSTGNYSSKKEDFLVPTLHFSSKKLGD
FT                   SGARVGFSIVAPAGLSKRWDYPAAKASAKEFTLKTIEVNPSFAVPISDSVSFGAGLRIV
FT                   RSDGVVKSDTGTPSYISRNLEGDSIDIGYNIALVYKPLKELSLAATYRSKVNLTVEGEA
FT                   DLNYLPSIHPAHAAYSGSASVAVPIPAALNLAAAYTFDTGTTIEAVFERTYWSAYKTLD
FT                   FDYDGTMNAATVAFGTPIAKNWEDTNTYRLGITQKIDQWTAMAGLAYDQTPVPEATLGY
FT                   ELPDADALIVSLGGRYKMDEHWDIGLAGLIDMKKDRSVHNSSINGEFTNARAYLVTAGI
FT                   GYRF"
FT   sig_peptide     247004..247105
FT                   /locus_tag="Sulku_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            248212..249756
FT                   /locus_tag="Sulku_0261"
FT   CDS_pept        248212..249756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0261"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020845:
FT                   IPR000873; KEGG: wsu:WS0237 long-chain-fatty-acid--CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   Serine O-acetyltransferase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32928"
FT                   /db_xref="GOA:E4TY15"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY15"
FT                   /protein_id="ADR32928.1"
FT                   /translation="MIHYPYENFYAMLYGVAKENPRKNVIFIDNERYSYQRFLENVDRT
FT                   ARALEVIGVGRGDKIALICPNSVEFVQSIFAISKLGAISVPINTMLKNEEYRYILGDCG
FT                   AKAVITAFKLAQEVRGLRDDVASIEHTIWIDKAPFEDAKHLLLGEMVADHVHHHSPSPA
FT                   KLDDTAVIFYTSGTTGHPKGAMISNRNLFSNLVAAQERFDLSPKDRFIVYLPMFHSFTF
FT                   AIMVILPFFMRASFVIIPSILPFSNIVRQTLLKRVTIFMGVPDIYNALIRARLPWYFLW
FT                   FNSVRCFISGGSALSEDTLTRFRSLFKRAVMLEGYGLSECSPAVAVNLLEKQKTLSVGL
FT                   PLYGYEVKIVNDEMEELPCGEAGELIVRGECVMQGYLNNPTATAETIQNGWLRTGDIAK
FT                   IDEEGYIYIVDRIKDLIISKGINIYPRQIEEHLMLLPHIKLAAVIGVSDPHSGEVPIAF
FT                   VELEEGYETTTPAFIKAQLKEHLALFKIPKTITVVESLPKTATGKVLKRVLKQGNY"
FT   gene            249753..251489
FT                   /locus_tag="Sulku_0262"
FT   CDS_pept        249753..251489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0262"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959: IPR003593; KEGG: tdn:Suden_1833 AAA ATPase;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: AAA ATPase; PFAM: ATPase family associated with
FT                   various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32929"
FT                   /db_xref="GOA:E4TY16"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY16"
FT                   /protein_id="ADR32929.1"
FT                   /translation="MKYLIDFLENKIIEETHIFSQLKCTVEEAKILQLLTRKFLQSQED
FT                   VIVAELLQELYGSDDYSYLGHFGEVKTLLELGWITHHSFTPLKISELSHLELYNTPVAV
FT                   TSVFMKLLEEGSLEMTLPDIKPYADHLEYLQDQFFRIELYQKMSIIRHSGNEHSLGINR
FT                   IQNKLDLLEKRIDERIAQTSLDVVLDRFFKQKKLEPKEQVIFLALLKEEYSATEGNLRE
FT                   MNTLIDLISFDDYERIKNRALLEDGSRLINEEVIDYEEMLNPFGGISRAFYIVDEVLQS
FT                   IMHPQKKKKVRKLKLDMLIKEQEIFELIEPTTSLENVVLNPSTEQTLSNLMRQLDREVI
FT                   ARLHEWGVKDKKAGIDARIIFYGPPGTGKTLTAHSLSRSLKRQVLSFDCSKILSMYVGE
FT                   SEKNVRKIFDTYADLTRQTKTEPILLLNEADQFLSARSAGIGSSADQMHNQMQNIFLEQ
FT                   IEKFQGILIATTNLLENIDQAFSRRFNYKIEFKKPDQKQRVTLWNMMLPKNAPYEKGFN
FT                   VEKLASYPLTGGQINLIVKNTAYQVAARSEGTFRLEDFIAEIQKERSGSFEGEKSMGFI
FT                   NR"
FT   gene            251606..252700
FT                   /locus_tag="Sulku_0263"
FT   CDS_pept        251606..252700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0263"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004090: IPR004089; KEGG: cla:Cla_1032
FT                   MCP-domain signal transduction protein; PFAM: chemotaxis
FT                   sensory transducer; SMART: chemotaxis sensory transducer;
FT                   SPTR: Methyl-accepting chemotaxis protein; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   Myosin-like coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32930"
FT                   /db_xref="GOA:E4TY17"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY17"
FT                   /protein_id="ADR32930.1"
FT                   /translation="MGWFSDDTELKEELSVLQKENTALRDENQELARKLQECEAKIAKE
FT                   DERHRCENASMIMTYQNEQLKKNLVDVQGNMASSVASSKENIAQSTALLENIVELGQKA
FT                   SGISHTLEGLNHLALESMDTVKALSDRAQDVASILVLIKDISDQTNLLALNAAIEAARA
FT                   GEHGRGFAVVADEVRKLADRTDKAISEINISLQSMKQDVTTIGEKFDQVQESIADSNES
FT                   IGSFNANMDHNAQMMRETFASTEHTAERIFMSLAKLDHIVWKVNTYLSAITRKEQFNFV
FT                   DHHNCRLGKWYYEGEGADFFKKTPSYSALETPHSVVHNSTHKIFDLMKTESVGSERFVK
FT                   VFEEMEHASDGVFATLDRMLQEKN"
FT   gene            253017..253406
FT                   /locus_tag="Sulku_0264"
FT   CDS_pept        253017..253406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0264"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0838 NADH:ubiquinone oxidoreductase subunit
FT                   3 (chain A); InterPro IPR000440; KEGG: tdn:Suden_1829 NADH
FT                   dehydrogenase subunit A; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; SPTR:
FT                   NADH-quinone oxidoreductase subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32931"
FT                   /db_xref="GOA:E4TY18"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY18"
FT                   /protein_id="ADR32931.1"
FT                   /translation="MEHYNTANPYFGVFVLFVLTFGAFYATTVIARLASRALAAKDTEK
FT                   LKMTVYECGPEVTKQPNRISTQFYLFALLFLLFDVEIVFMFPWAIDFKLLGWFGFVEMM
FT                   MFILLLAIGFVYAWKKGALEWHNIK"
FT   sig_peptide     253017..253133
FT                   /locus_tag="Sulku_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            253388..253897
FT                   /locus_tag="Sulku_0265"
FT   CDS_pept        253388..253897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0265"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0377 NADH:ubiquinone oxidoreductase 20 kD
FT                   subunit and related Fe-S oxidoreductase; InterPro
FT                   IPR006138: IPR006137; KEGG: tdn:Suden_1828 NADH
FT                   dehydrogenase subunit B; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH dehydrogenase i chain b; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32932"
FT                   /db_xref="GOA:E4TY19"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY19"
FT                   /protein_id="ADR32932.1"
FT                   /translation="MAQHQVNYLKDGGLPVALTTIDKVVNWGRSNSLWALTYGLACCGI
FT                   EMMASGASRYDFDRFGTIFRASPRQAELMVVAGTLTKKHAEFIRRLYDQMTEPKWVISM
FT                   GSCANTGGMFNTYATVQGVDRVIPVDLYLPGCAPRPETLQYAVLLLQQKIRRESASRAQ
FT                   KPKRLM"
FT   gene            253897..254703
FT                   /locus_tag="Sulku_0266"
FT   CDS_pept        253897..254703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0266"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0852 NADH:ubiquinone oxidoreductase 27 kD
FT                   subunit; InterPro IPR020396: IPR010218: IPR001268; KEGG:
FT                   tdn:Suden_1827 NADH dehydrogenase subunit C; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 30 kDa subunit; SPTR:
FT                   NADH-quinone oxidoreductase; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32933"
FT                   /db_xref="GOA:E4TY20"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY20"
FT                   /protein_id="ADR32933.1"
FT                   /translation="MRAYTPKDDVQKKPYYTDRYWVAPQVAKIDVSEDEVFAHDLEAIK
FT                   ASFDVLDAYIQVGQMVVIINAADNYGVIEMMKNELGYNQLSELSAIDWLAQEGKFEIFY
FT                   QMLSMNKRKRVRIKCKIDEKESIQSVSSLFRSADWSEREMYDMFGVVINNHPYMKRILM
FT                   PDDWEGFPLRKTYPLQGDEFAQWYEVDKLFGKEARDIIGPEIRDSARVDRYDTERFARL
FT                   GHEVPRGSDISQGEPDTPLCYQESDGVFLIEKFDAEKSVVISDRDR"
FT   gene            254713..255939
FT                   /locus_tag="Sulku_0267"
FT   CDS_pept        254713..255939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0267"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR010219: IPR001135; KEGG:
FT                   tdn:Suden_1826 NADH dehydrogenase subunit D; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: NADH-quinone oxidoreductase
FT                   subunit D; TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32934"
FT                   /db_xref="GOA:E4TY21"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY21"
FT                   /protein_id="ADR32934.1"
FT                   /translation="MQQSNRLRPFFENITFDRADNELILNFGPQHPSAHGQLRLMLHLQ
FT                   QEQITKAHPDIGYLHRGMEKMAENMIYNEFMPTTDRMDYIASSSNNYGFALAVERLIGL
FT                   DVPRRAKVIRMMLLETNRLMSHLFWLATTALDIGAMTVFLFAFREREYLMDLIEDYCGA
FT                   RLTHAAVRIGGVPLDLPDNFIPDLRKFLDKLPENIKDYEDLLDTNRIWKMRMENVGVIS
FT                   KEMAQSWGCSGIMLRASGVEWDIRKEEPYELYDEVDFNVPVSDKGDNYARYKLYMAEMR
FT                   ESAKILYQVLDMYEGTGPELMAHAPQYISAPKIDIMTQNYSLMQHFVLVTQGMRPPVGE
FT                   VYVATESPKGELGYFINSQGGAYPYRLKLRAPSFWHTGILTDLLPGHYIPDVVSIIGTT
FT                   NIVFGEVDR"
FT   gene            255952..256176
FT                   /locus_tag="Sulku_0268"
FT   CDS_pept        255952..256176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0142 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32935"
FT                   /db_xref="InterPro:IPR032424"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYF8"
FT                   /protein_id="ADR32935.1"
FT                   /translation="MKRYDLRHLKENFAGRMSEIIKNEAVSGEVVIFLFEIGDFSPVQQ
FT                   SADLVKELGCELMNSLKFNEADWTIVVKK"
FT   gene            256186..258222
FT                   /locus_tag="Sulku_0269"
FT   CDS_pept        256186..258222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0269"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0493 NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductase; InterPro IPR000759:
FT                   IPR019575: IPR013027; KEGG: tdn:Suden_1824 glutamate
FT                   synthase (NADPH); PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding; SPTR:
FT                   Formate dehydrogenase, beta subunit; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32936"
FT                   /db_xref="GOA:E4TYF9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYF9"
FT                   /protein_id="ADR32936.1"
FT                   /translation="MSKVYFSTWRGEQINNIGKNDDAWENSAYNLPLEYNEHAHSKAFI
FT                   GWDGVALFNPDVDVVRLATEYAAQYQVYSEACGRCAPGRWGGRILYDLLDKIARGEGSV
FT                   SDMEHLKEVSRTMQETSKCEIGKTVPNPLLDLMTHFESDFMDCINNQKPSKHYHLEDTS
FT                   YIAKITAPCMDACPAHVDIPAYIEGVRDLRFDDSLMATRQTMPLAHTCGRVCPHPCETE
FT                   CRRTNLDEPISIMELKRLGADYETDHGFGFFHPSEKKPSIGKKVAVIGAGPAGLTGAYY
FT                   LALDGIDVDVYEELPVLGGEVAVGVPEYRMPIDKYNQDIEAVRSLGVNFITNTKVTADM
FT                   MRQFENDYDATLVATGTRISKKVYCDNERPEIQGYWGAIDFLDKVNLQVKYDIMVPEAD
FT                   QKRHMLPTDFVDLTGKTLVCVGGGFTSMDVVRCAIRANAAKVVMLYRRDEATIIKNTTY
FT                   EEYHEAVEEGVEFIFHSAVAKMNDENDVLKSLVIDRFELVPDPNGGRPTLEKVEGASFE
FT                   MECDYLIPAVSQSADLKLLPEEWEIERTSWATIKTNGKDYMTSRKGIFAAGDCEYGPMT
FT                   IVNAVGQAKRAASVMSRYVTSGEITLTNDEIMEDHLRKLKVYNKKEKIQGWLPGLARQH
FT                   SEVLTVDERKDNNREVKYGFTQEEALAEAERCMRCYYIAMVAH"
FT   gene            258233..260488
FT                   /locus_tag="Sulku_0270"
FT   CDS_pept        258233..260488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0270"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterProIPR017900:
FT                   IPR019825: IPR000283: IPR001041: IPR 017896: IPR019574:
FT                   IPR006963; KEGG: tdn:Suden_1823 NADH dehydrogenase subunit
FT                   G; PFAM: NADH:ubiquinone oxidoreductase, subunit G,
FT                   iron-sulphur binding; ferredoxin; molybdopterin
FT                   oxidoreductase Fe4S4 region; SPTR: Ferredoxin; PFAM:
FT                   Molybdopterin oxidoreductase; NADH-ubiquinone
FT                   oxidoreductase-G iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32937"
FT                   /db_xref="GOA:E4TYG0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG0"
FT                   /protein_id="ADR32937.1"
FT                   /translation="MINFTINGQPVIANKGETILQAARKAGFYIPTMCYLEKTTPCASC
FT                   RLCVVETDKTDGLILSCQTPPTEGLAVVIDSDRLKTERTNIMRLYDVNHPLECGVCDKS
FT                   GACDLQNKTLEFGVSSQHFSAKDQHRKIEHWGLINYDPSLCILCEKCVHVCNEIIGDDA
FT                   IELQFGGYKSSVIPKNSDALDCTFCGECIAVCPVGALVSSNFQYSANAWELSQIPATCV
FT                   HCSAGCSLMYEVRHTSNLTGAKDKIYRVTNDFEHTTLCGAGRFGFDFNVEGTKDEAQFA
FT                   KAVDAIKNADAIRFSSLITNEEAMILQSLKEKLGLKLYNEEARAYQNFMNAYASISGKT
FT                   GFGGSLDAIKQSDGIIVFGGRVTTDNPMVRYAMTTAARHNGAKVVYMHPIEDDLLQNVV
FT                   TQYVKYEVGTEEGVVAMLAKTLLENADVSDETRHFFEGLDEGYLCAESNIGDEEYARMA
FT                   KTFARAKRKTLVIGSDVLTHKRAANISRLCAMIETYTEFSVVVIAPSVNTIGVSLICDL
FT                   DADNNGENVVGYNAAGSYTMGSFDEAMLKLPSLNSQEGTFVSINHQVLPTNVAVAFDGY
FT                   TLNDLANALGLSAHNTIDYTAQLPESKGFNGSSFDDLGNFYSALGEDNRGYVLENRDVE
FT                   ADGKLEEIDDLPEFNGTVVYRCNPVNQFNTYTARTEQLEKEAILRGSAQFAAAAKIGDG
FT                   DKIRIEFPHSTQERIFKLDSAMKGTIALVPAYDVGFGGLNEQYRFEKVKIMRMGSES"
FT   gene            260485..262971
FT                   /locus_tag="Sulku_0271"
FT   CDS_pept        260485..262971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0271"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterProIPR017900:
FT                   IPR006655: IPR001041: IPR017896: IPR 019574: IPR006963;
FT                   KEGG: tdn:Suden_1822 NADH dehydrogenase subunit G; PFAM:
FT                   NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur
FT                   binding; ferredoxin; molybdopterin oxidoreductase Fe4S4
FT                   region; SPTR: Ferredoxin; PFAM: NADH-ubiquinone
FT                   oxidoreductase-G iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32938"
FT                   /db_xref="GOA:E4TYG1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG1"
FT                   /protein_id="ADR32938.1"
FT                   /translation="MNEITITIDGRTVQTQEGEYILNAARANGIFIPAICYLTRCSPTL
FT                   ACRICLVEADGKQVYACNAKAKEGMEITTTTPNILEERRAIMEVYDVNHPLECGVCDQS
FT                   GECELQNYTLEVGVDSQNYAIKDTHKPAQDWGLIHYDPALCIMCERCITVCKDMIGDAA
FT                   LSTVARGSDAIHGEYKAMMPKDAYAMWNKLNKSLIAPNGGDTLDCTNCGECTSVCPVGA
FT                   LVSSDYQYTSNAWEHKQIPATCAHCSAGCQLSYDIKHTSISNPESKIYRVKNEWNYVSL
FT                   CGAGRYGYDFENRDVSKDKAAFDKAIEAFKKADTIAFTSTITNEEAMILQRLKEKYGYR
FT                   LVNSEALALKNFLGSYSAISKTSLYGGDLKQVHEADFVVSIGSALKTDNPNARFAMNNA
FT                   LSMNKGSGLYFHPINDPVIQDMSKNITQFNHAPMMEEAALYLMLDLFGDKAAMPSAVTE
FT                   YLAGFHSTKTVTIEESVDEKVTETVTKKVLNEETGVEEEVSEEVTKTIKKKVSKEVEVD
FT                   DNALFGLLNAPEKFAETLEKYLAKKEKFALMVGPDLYTHPNAANCARLVALIEKYTPFS
FT                   VTMIPNLANTLGAALICDLDSSRGSYTIGYNTRGDFTLSALGNGDLDMPALNQQEGTLT
FT                   GIDKRVNPTNAALGYGGYVLNDIANALGITAKYTVDYTAQLPVKNGFKALSFDTLPNYY
FT                   TNAGEEVRGYVLENIAVNSGGDESVQPLNPNAAIRENVVYLANPVLQFSAFTAASHQLN
FT                   AKGGLYASHTAMQTNGWSEGDALRVKTAHGELSVNVIADGKIGGDITYLPTFDTAINSE
FT                   ALFDGYRFACVSIQKV"
FT   gene            262975..263964
FT                   /locus_tag="Sulku_0272"
FT   CDS_pept        262975..263964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0272"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR018086: IPR001694; KEGG:
FT                   tdn:Suden_1821 NADH dehydrogenase subunit H; PFAM:
FT                   respiratory-chain NADH dehydrogenase subunit 1; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: NADH-quinone oxidoreductase
FT                   subunit h; PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32939"
FT                   /db_xref="GOA:E4TYG2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG2"
FT                   /protein_id="ADR32939.1"
FT                   /translation="MDVAFIIETIVKIVVILLIFSALAGLGTYFERKVLAFMQRRLGPM
FT                   HVGPFGLLQVAADGIKLFTKEDIIPQNVVKPIFKIAPVITAATAFMASAAIPFWPQFTV
FT                   FGYTVHPIVADINVGILYVLGVMAIGLYGPLLGGMASANKWSLISAARSAAIFISYEVI
FT                   SGLSLLAPLMMVGSLSLIDINNYQAGGIGNWIVWSQPVAFILFWIAAFAETGRTPFHLV
FT                   ANDHEIIDGFGTEYSGMRWGMFFIGEYANMFFISFVIAIIFLGGFGDGTIAGAIQLLLK
FT                   VAFFFFFFLWTRAAWPDIRPDQLMWLCWKVLMPIAVINIVVTGIVMMF"
FT   sig_peptide     262975..263082
FT                   /locus_tag="Sulku_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            263977..264600
FT                   /locus_tag="Sulku_0273"
FT   CDS_pept        263977..264600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0273"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR017900: IPR010226: IPR017896; KEGG:
FT                   tdn:Suden_1820 NADH dehydrogenase subunit I; SPTR:
FT                   NADH-quinone oxidoreductase subunit I; TIGRFAM:
FT                   NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S binding
FT                   domain; TIGRFAM: NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32940"
FT                   /db_xref="GOA:E4TYG3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG3"
FT                   /protein_id="ADR32940.1"
FT                   /translation="MHHEEVFTDRNVSEHSAYYYVDIEAYPESGWDKFKQVLKRALRGE
FT                   LFVGLWVVLREMIKFDIHTVQYPKEKLPIGPRYRAVHKLLRLWESGYERCIGCGLCEKI
FT                   CISDCIRMDTRIDENSRKEVTEYSINLGRCIFCGYCAEVCPELAIVHGQRYENASEQRA
FT                   HFVIKDDMLTPLDLLKAGEQAEYPGFGAIIPGSDASVKKTPLAY"
FT   gene            264610..265197
FT                   /locus_tag="Sulku_0274"
FT   CDS_pept        264610..265197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0274"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0839 NADH:ubiquinone oxidoreductase subunit
FT                   6 (chain J); InterPro IPR001457; KEGG: tdn:Suden_1819 NADH
FT                   dehydrogenase subunit J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; SPTR:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 6;
FT                   PFAM: NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32941"
FT                   /db_xref="GOA:E4TYG4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG4"
FT                   /protein_id="ADR32941.1"
FT                   /translation="MFEAIAFYLFAALTIVMFTITVMTSQALYAITAMAAGMIFISAFF
FT                   FILGADFLGAIQIIVYTGAVMALYAFGMMFFDTTRDVVEKRTNPQIVFVLGVLAAVMVV
FT                   AIFVAPIVSNNIQALYPIQENIGNSQAVGMVLFTKYLVPFEVAAVMLLVAMIGGIILAG
FT                   KKMDKSLTLMAEEEISTMDDMTEEEVQAGGHH"
FT   sig_peptide     264610..264714
FT                   /locus_tag="Sulku_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            265197..265502
FT                   /locus_tag="Sulku_0275"
FT   CDS_pept        265197..265502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0275"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0713 NADH:ubiquinone oxidoreductase subunit
FT                   11 or 4L (chain K); InterPro IPR001133; KEGG:
FT                   tdn:Suden_1818 NADH dehydrogenase subunit K; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: NADH-quinone
FT                   oxidoreductase chain 11; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32942"
FT                   /db_xref="GOA:E4TYG5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG5"
FT                   /protein_id="ADR32942.1"
FT                   /translation="MEVTLSHYLVLSSILFSIGLIGVMRRKNLLMLFFATEILLNATNI
FT                   AFAAISHYIGDLSGQMFAFFIIAIAASEVAIGLGLLIVWYKRTGKIDLDQMNSMRG"
FT   sig_peptide     265197..265340
FT                   /locus_tag="Sulku_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            265506..267392
FT                   /locus_tag="Sulku_0276"
FT   CDS_pept        265506..267392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0276"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterProIPR003945: IPR003916: IPR018393: IPR001516: IPR
FT                   001750: IPR010934; KEGG: tdn:Suden_1817 NADH dehydrogenase
FT                   subunit L; PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein; NADH dehydrogenase subunit 5 domain protein; SPTR:
FT                   NADH-plastoquinone oxidoreductase, chain 5; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; NADH-Ubiquinone oxidoreductase (complex I), chain 5
FT                   N-terminus; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32943"
FT                   /db_xref="GOA:E4TYG6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG6"
FT                   /protein_id="ADR32943.1"
FT                   /translation="MELYLYIALFAPLVGSLFSALFTATPKSSITGYVASGLLFTSFVS
FT                   SAILLNYVMGGHTVHVEMMTWMATGDLYIPFGFVVDQVSVVMMMVVTIVSTVVHVYSIG
FT                   YMDHDKGFNRFFAWLSAFVFSMMVLVMSDNFAGLFIGWEGVGLCSWGLIGFWYHKESAT
FT                   WAANEAFIMNRIADLGMLIGIFLIYWNVGSLQYDVVFAEVGNLQPVIITWIGIFLFIGA
FT                   MGKSAQFPLHTWLADAMEGPTPVSALIHAATMVTAGVYLVVRANPIYDLIPNVGIFIAS
FT                   LGAFVALFAASMALVNRDMKRIIAYSTLSQLGYMFVAAGLGAYWVALFHLMAHAFFKAL
FT                   LFLGAGNVMHAMHDELDPFKMGGLRKVMKGTFVMMTLASVALAGIYPFAGFFSKDLILE
FT                   VGFVEHHYVIYTVLLLTAGLTAFYSFRLVALIFHGEERYKLFGIHPHEAYKFMLVAMSP
FT                   LLVLAIIAGSFKMTYYQLVINLLPSTQYHVHSATTFWIMTIGTQLFVILAILFAYKKYS
FT                   NWNSVPDGTSKMEKSFGYKLLWNQYYIPKIYDEVFSKPYLELSKIAWKQIDLKIVDATV
FT                   DAIANAIYKTGENTRDIQNGNLSSMLRWMVVGLVVLMTLAVAFNVGYNVFGA"
FT   sig_peptide     265506..265589
FT                   /locus_tag="Sulku_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            267402..268949
FT                   /locus_tag="Sulku_0277"
FT   CDS_pept        267402..268949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0277"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1008 NADH:ubiquinone oxidoreductase subunit
FT                   4 (chain M); InterPro IPR010227: IPR003918: IPR001750;
FT                   KEGG: tdn:Suden_1816 NADH dehydrogenase subunit M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   Donor-ubiquinone reductase I; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32944"
FT                   /db_xref="GOA:E4TYG7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG7"
FT                   /protein_id="ADR32944.1"
FT                   /translation="MIDHILTLLIFFPALAAMLGFVVTKDSMRAYGIAVAFIEFVLSLW
FT                   LWYAYDPMISGMQFMESMPLIPAFGINYLLGVDGISLFIIILSTFFTLIGIASLTEKRR
FT                   IKDLIITLLFLEMTMVGVFAALDAIVFYVFWELSLVPMLYIIGAWGGPLRIYASIKFFL
FT                   YTFTGSLVMLVGMLFMAYFYYQATGQWSFSILEWYRLILPENFQLWLFAAFFLGFAIKV
FT                   PMFPFHTWLPYAHGQAPTIGSVILAAILLKMGTYAFVRFSLPLFPDASVFFMFPIAIIA
FT                   IIMIIYTAMVAYAQEDIKQVVAYSSVSHMGVIILGTFALNVEGVSGSVFLMLAHGVVSG
FT                   ALFLLVGVIYDRRHTKLMSEFGGLASVMPRYATIFGIMMMASVGLPLTINFVGEFLSLL
FT                   GFYKQSHMLTLTAGVAIIVGAIYMLSAYKKAFFGPVTNEANRHLKDVNRTELLGLIPLV
FT                   IVAIWLGVYPKPVLEPINNSVESVIQLMHDKAQSPEAKERIPDLSGKNGIISMKEAN"
FT   sig_peptide     267402..267491
FT                   /locus_tag="Sulku_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            268949..270454
FT                   /locus_tag="Sulku_0278"
FT   CDS_pept        268949..270454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0278"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1007 NADH:ubiquinone oxidoreductase subunit
FT                   2 (chain N); InterPro IPR010096: IPR001750; KEGG:
FT                   tdn:Suden_1815 NADH dehydrogenase subunit N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   NADH-quinone oxidoreductase subunit N; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain N;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32945"
FT                   /db_xref="GOA:E4TYG8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG8"
FT                   /protein_id="ADR32945.1"
FT                   /translation="MLEPIHVSLASLNLATLAPMLIAIVGALGILVIDMVKGGLNKTLY
FT                   VMVSLLFLLLDLGALVDFAGVFIKNGTVLGFFDVMLMDGIAILSQIIIVVGSMLFIPLA
FT                   LTSKRFHEYNYPEYFALFLFMIAGFQFMVATDNLILIFVGLETASLALYTLIALHNRSK
FT                   SFEAAVKYFTMGALAAGFYAFGSMILYAISGSVEINQIATILAEDHYRNIGFVLLAMAF
FT                   MIAAFGFKLSMVPFHTWTPDVYEGSSAALAGYMSIVPKIAAFVVAMRLFEFLVHSGIVW
FT                   LQVILYIGVVVTMTASNIWALVQTDVKRMLAYSSISHAGFVMSAILIGTTQANTGLFLY
FT                   WALFSFTNLGAFTMLWVNRQKNLLPGQSSDHPYEKFSGMIKTMPMGAVMMGLFMLSLAG
FT                   IPPFGLFWGKMYMIGAAVSAGYTVLALIMALNSAIAGYYYLKLIVFMFMKEPRVGYEKY
FT                   YFMNASLSLRTIIGLAAVGTIFAVFAVNPLLKVITLFVYNSGY"
FT   sig_peptide     268949..269029
FT                   /locus_tag="Sulku_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            270476..272833
FT                   /locus_tag="Sulku_0279"
FT   CDS_pept        270476..272833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0279"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR019734: IPR013026: IPR001440; KEGG:
FT                   tdn:Suden_1814 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32946"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG9"
FT                   /protein_id="ADR32946.1"
FT                   /translation="MKFWIILSLCLPLFGLELSIQSGKEEGEKFSILHLRHTVPFACKA
FT                   MDDEFGETKRIECYLPTPPKQNFSPIDNGQLLVSSSTTSNGYTITVLPKSKIKLIPVLF
FT                   NLTKTKETYQNDAKKAFHWNIVGYQSNLPLISLSSSSATAINFPIKIAKSPPPFVGGLD
FT                   LKGNPIKITRVQDVTDYMEMKKAYAAKNYIKVIDRAENTLKEYPNTVFKNELMLYQIRS
FT                   YHQLGEFEKVLALSKRFLREFSSDPGLAEVLTYTANAYSKIGQITDADYFFDRLFDEQG
FT                   DSPFAPQGMIYKAEQLETNGEPKKAAQYYKKALSSTTDVAIASKAAFKLAQSELMSGDV
FT                   QKAAQYVDKIITVNPDYFSEVTDDAINMATSFMDKKDPKTAARLTEALLNKSDKKSDNY
FT                   QLLLKNLGLQLAKAGKRGEALKRFNEYLESFKYGDYAEEVRRAKDGLFFNEGDTNTTEE
FT                   IKKYNDLIDRYGDDSVGRKALYKKAQLLLKEKKYKEVLDIESDLYRLDSTEYPETNQLI
FT                   SKSAIGFEKSLLKEGKCADAMKFQKMYKIKLLPEWDESLFNCALKTAQYPTAKKIAQSH
FT                   LKSNSVAERQIWLFRMVKTQFGLGEYKAASKGGEELITLLGVQKNPPLNEIYRIMFDAA
FT                   QRVGDSDAMIRNIKSIEGVFPNDFTDIERYTQMVSLGLKRKDEAMTQTYSRKVITLQER
FT                   TKSYTQSPYIEFTLAQSYQNLGKDTDALNVLKTLNKQKLNTEKRARQQYLIGAIEQKLG
FT                   RKREARDAFNASIKADKNSAWGKLAKDALALF"
FT   sig_peptide     270476..270541
FT                   /locus_tag="Sulku_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(272819..273718)
FT                   /locus_tag="Sulku_0280"
FT   CDS_pept        complement(272819..273718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0280"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /note="COGs: COG0324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; InterPro IPR018022: IPR002627; KEGG:
FT                   tdn:Suden_1812 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; PFAM: tRNA isopentenyltransferase; PRIAM: tRNA
FT                   isopentenyltransferase; SPTR: tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   IPP transferase; TIGRFAM: tRNA isopentenyltransferase
FT                   (miaA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32947"
FT                   /db_xref="GOA:E4TYH0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH0"
FT                   /protein_id="ADR32947.1"
FT                   /translation="MKQLALIGSTASGKSDLALKLAEKYNALILSIDSLSIYKEIDIAS
FT                   AKPTKGELAKIEHFGVDRLNPDENASVMTFIDEYNRICDQAILNDKNVIIVGGSSFYLK
FT                   SMIEGLSEIPDFSSDTLLKTKEMLCDLSECHKLLSSVDPISMGKIAPSDAYRIEKMLLI
FT                   YLETQTAPSEWFRTNPPSPIITECPVLHLDIDRTLLRDRIALRTRKMVDAGLIDEVAEL
FT                   ERKYGRVPNSMKAIGIIETLEYLDGKISKPELIELVSIHTGQLAKRQQTFNIHQFTLRA
FT                   SASSHELENIADSILKQR"
FT   gene            273882..274733
FT                   /locus_tag="Sulku_0281"
FT   CDS_pept        273882..274733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0281"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR006371: IPR000537; KEGG: tdn:Suden_1811
FT                   prenyltransferase; PFAM: UbiA prenyltransferase; SPTR:
FT                   Putative 4-hydroxybenzoate polyprenyltransferase; TIGRFAM:
FT                   4-hydroxybenzoate polyprenyltransferase; manually curated;
FT                   PFAM: UbiA prenyltransferase family; TIGRFAM: putative
FT                   4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32948"
FT                   /db_xref="GOA:E4TYH1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH1"
FT                   /protein_id="ADR32948.1"
FT                   /translation="MRKRLQDFNELVMFQHSIFSLPFIFIAMIVAAEGWFGFKLLLLGA
FT                   FAAISARNAAMGFNRYIDRSFDIHNPRTSGRPSVDGRLDGASIAIFTAVNALVFMAVAY
FT                   FINDLAFYLSFPVLIVLFSYSFFKRFSSMAHIVLGISLGLAPIAGAIAVLGTVPQWSLW
FT                   LSIGVVFWVAGFDLLYSLQDMEFDKTNNLHSIPSKYGSQATLKISAFFHVLTVVFWAIF
FT                   VHKAALGMFASGAVLFSALMLTYEHILVRRDFTQIDRAFFTVNGYLGFVFIGLIILDKV
FT                   AV"
FT   sig_peptide     273882..273977
FT                   /locus_tag="Sulku_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            274730..275251
FT                   /locus_tag="Sulku_0282"
FT   CDS_pept        274730..275251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1810 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32949"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH2"
FT                   /protein_id="ADR32949.1"
FT                   /translation="MSDIRLVQATIDLAYEEVLDNNEKFEHEFNLIGVAEENSITQGIK
FT                   HVKVRGELDETNALMLNIMAELYRKMEKIEMLLSNGKINRLELSSKGLIDSIGLEHFKL
FT                   SSDSLEVGKHYYGRMEIATFPKREIALYFEAVEPSLAKIENIHVRDKEAWGYYMTACER
FT                   VMIRQMKGLE"
FT   gene            275248..275763
FT                   /locus_tag="Sulku_0283"
FT   CDS_pept        275248..275763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1809 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32950"
FT                   /db_xref="GOA:E4TYH3"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH3"
FT                   /protein_id="ADR32950.1"
FT                   /translation="MNHSIEIALVALAVVVVGLIYYVVTKESEVSTQIRSIAKVVEDLH
FT                   RELFMMDKRLKQELEIITSLQESVPREQTSLHAELGREVNELSVPILESLTHIEESFGG
FT                   YKEKTENRLRYLEERIRNLSLPTSISGLDDEKVISRYNQGIEIDAIAKELRLSKAEVEF
FT                   VLKINQLR"
FT   sig_peptide     275248..275322
FT                   /locus_tag="Sulku_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            275807..275883
FT                   /locus_tag="Sulku_R0010"
FT   tRNA            275807..275883
FT                   /locus_tag="Sulku_R0010"
FT                   /product="tRNA-Arg"
FT   gene            complement(275894..276640)
FT                   /locus_tag="Sulku_0284"
FT   CDS_pept        complement(275894..276640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0284"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG1434 conserved hypothetical protein;
FT                   InterPro IPR003848; KEGG: sun:SUN_1551 hypothetical
FT                   protein; PFAM: protein of unknown function DUF218; SPTR:
FT                   Putative uncharacterized protein; PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32951"
FT                   /db_xref="GOA:E4TYH4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH4"
FT                   /protein_id="ADR32951.1"
FT                   /translation="MFELKKLISSFIYPFPIFLISSALALYLLQRGNRRRAKILFVFSF
FT                   AWITILSYPPFSALLLKPLENAYPKVQLHSPFPRYIHVLGNGHTSSQNIPLSSELSLTS
FT                   LARVNEGILLYKSHPGMKLIFSGYGGGDSVSNARKNSQLAIALGVNSNDIVILEEAKDT
FT                   AEEAIAVKKIVGSQPLILVTSASHMVRASSIFRKNGICVIEAPTDFLVKKEDTLWQFPS
FT                   SGGLRRSECAFHEYLGLLWEKLKGSL"
FT   sig_peptide     complement(276566..276640)
FT                   /locus_tag="Sulku_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(276658..276987)
FT                   /locus_tag="Sulku_0285"
FT   CDS_pept        complement(276658..276987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0285"
FT                   /product="iojap-like protein"
FT                   /note="COGs: COG0799 Iojap protein; InterPro IPR004394;
FT                   KEGG: tdn:Suden_1756 iojap-related protein; PFAM:
FT                   Iojap-related protein; SPTR: Iojap-related protein;
FT                   TIGRFAM: iojap-like protein; PFAM: Domain of unknown
FT                   function DUF143; TIGRFAM: iojap-like ribosome-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32952"
FT                   /db_xref="GOA:E4TYH5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH5"
FT                   /protein_id="ADR32952.1"
FT                   /translation="MNPRIEKISAILDQNKAEAIEVFDLQGGDYFADYVVIASSLGERH
FT                   TLALLDHLKKGLKPEEQFLYVDESGDWVAIDLGDILVHILTPQYRVKYDLESFLGEIAA
FT                   RKNKA"
FT   gene            complement(276984..277517)
FT                   /locus_tag="Sulku_0286"
FT   CDS_pept        complement(276984..277517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0286"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro IPR005248: IPR004821:
FT                   IPR004820; KEGG: tdn:Suden_1755 nicotinate-nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase; PRIAM:
FT                   Nicotinate-nucleotide adenylyltransferase; SPTR: Probable
FT                   nicotinate-nucleotide adenylyltransferase; TIGRFAM:
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32953"
FT                   /db_xref="GOA:E4TYH6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH6"
FT                   /protein_id="ADR32953.1"
FT                   /translation="MKLALYGGSFDPPHAGHVAVVEEALRVLPIDRLIVVPASRNPFKP
FT                   SVTVDGAVRFEWLKEIFKPYERVVISDFEIAHDRSVYTIETVKHFAPFCDELYLIIGAD
FT                   NLEKLSHWHNFDELDAMVHWVVADRDGISIPENMIRLTTHVPISSTDFRSSYVTLGLDP
FT                   KIEQKIITYYKEHL"
FT   gene            277599..278603
FT                   /locus_tag="Sulku_0287"
FT   CDS_pept        277599..278603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0287"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase;
FT                   InterProIPR020830: IPR020831: IPR006424: IPR020832: IPR
FT                   020828: IPR020829; KEGG: tdn:Suden_1754
FT                   glyceraldehyde-3-phosphate dehydrogenase; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain; Glyceraldehyde 3-phosphate dehydrogenase, catalytic
FT                   domain; PRIAM: Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating); SPTR: Glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-terminal domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32954"
FT                   /db_xref="GOA:E4TYH7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH7"
FT                   /protein_id="ADR32954.1"
FT                   /translation="MALKIALNGFGRIGRCVTRLIAMRTDVELVAINDMASVEMMLYLL
FT                   QNDSVHGQFGIDAAIIGDDYLQIAGQKVRIFSEKNPENLDFASLGADVVFECSGLFLTG
FT                   ALTKHHLEKGVKKVILSAPTQDSAIPTFVLGVNEHLYAGENIISNASCTTNCLGPIAKI
FT                   LDETYGIEKGLMTTVHAYTNGQAIIDSAHGSDMRRSRAAALNMIPTTTGAAKAISLVLP
FT                   SLEGKLHGQSVRVPTADVSMVDLNVLISRSTSKEELSNLFKSYAEGSLKGILEVDERYR
FT                   VSQDFVGSPFSATVADDLIQVVDGNMVKIMAWYDNEWGYSNRLIEMALFITKQ"
FT   gene            278649..279839
FT                   /locus_tag="Sulku_0288"
FT   CDS_pept        278649..279839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0288"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR015911: IPR001576; KEGG: tdn:Suden_1753 phosphoglycerate
FT                   kinase; PFAM: phosphoglycerate kinase; PRIAM:
FT                   Phosphoglycerate kinase; SPTR: Phosphoglycerate kinase;
FT                   PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32955"
FT                   /db_xref="GOA:E4TYH8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH8"
FT                   /protein_id="ADR32955.1"
FT                   /translation="MQLLGIKECDIHGKKVFIRCDFNVPMDDYGNITDDRRIRSALATI
FT                   NYCLDQKCAIILASHFGRPKGEPDEKYSLAPIARRLHQLLKIDVQVADDVVGESALKLA
FT                   HELKNGEVLLLENLRFEKGETKNDPDLSAALASMAEVYINDAFGVSHRAHASVEGITAH
FT                   FDNAHKAAGFLLQKEIQFFGTLLEHPVRPFAAIVGGSKVSGKLEALINLLPKVDKMLIG
FT                   GGMAFTFLKALGHDVGNSLVEDDLIPEALKIMEEAKRLGVKFYLPVDVVAAEKFAPDSA
FT                   SRLCSVQEIPSGWMGLDIGPATVRLYRQVLGDVQTILWNGPMGVYEMDRYARGSNKIAH
FT                   FVADSYATSVVGGGDTADLVQRVGLDEEITFISTGGGASLELLEGKILPGVKPLLK"
FT   gene            279853..280572
FT                   /locus_tag="Sulku_0289"
FT   CDS_pept        279853..280572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0289"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR020861: IPR010916: IPR000652; KEGG: tdn:Suden_1752
FT                   triosephosphate isomerase; PFAM: triosephosphate isomerase;
FT                   PRIAM: Triose-phosphate isomerase; SPTR: Triosephosphate
FT                   isomerase; TIGRFAM: triosephosphate isomerase; PFAM:
FT                   Triosephosphate isomerase; TIGRFAM: triosephosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32956"
FT                   /db_xref="GOA:E4TYH9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH9"
FT                   /protein_id="ADR32956.1"
FT                   /translation="MILCANFKANKTRQETRAYMAVVESFVSANDITDTIIVFPPFTAL
FT                   EHDPRNVLIGVQNGYPVKNGAFTGEIALEQLEEFGIKTILIGHSERRHILGETQEQIAA
FT                   KFRFFAEQGFLIVYCVGEPLEIREQGHEALMAYIEKQFEGIDLTYSDLVLAYEPVWAIG
FT                   TGLTPSNSDIELLHGALRMKTTAPLLYGGSVKVDNAGEIMALENVDGVLVGSAALSAND
FT                   FCDMIAQAVELNTEKGE"
FT   gene            280576..281400
FT                   /locus_tag="Sulku_0290"
FT   CDS_pept        280576..281400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0290"
FT                   /product="Enoyl-(acyl-carrier-protein) reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="COGs: COG0623 Enoyl-(acyl-carrier-protein); InterPro
FT                   IPR002347: IPR002198; KEGG: tdn:Suden_1751 enoyl-(acyl
FT                   carrier protein) reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR:
FT                   Enoyl-[acyl-carrier-protein] reductase (NADH); PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32957"
FT                   /db_xref="GOA:E4TYI0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI0"
FT                   /protein_id="ADR32957.1"
FT                   /translation="MLMQGKKGLIVGLANDKSIAYGIAQALHKQGAQMAFTYLNEALQK
FT                   RVEPIAASFDNSPVYKLDVSDEADMEAIAAKVAADFGEIDFLVHSVAFAPKEALTEGFM
FT                   KTSKSAFQIAMDVSVYSLIDLTNRLESVLAPGASIITLSYLGGPKYIPNYNVMGVAKAA
FT                   LESTVRYMAVELGASKGQRVNAISAGPIKTLAASGIGDFKQILNWNESNAPLRKNVTIE
FT                   EVGNSAMYLLSDLSSGVSGEVHYVDAGYNIMGMAAVEKNAEGKSVFVWDANK"
FT   gene            complement(281671..282210)
FT                   /locus_tag="Sulku_0291"
FT   CDS_pept        complement(281671..282210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_4347 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32958"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI1"
FT                   /protein_id="ADR32958.1"
FT                   /translation="MRHSLSLSIALLILSGCAANHMGVTPSQNTNLQAVSPSTTAASEG
FT                   GIMQRSLDIWLKEEWNPMMANEPTVNTKQQSDGTVITTKTEPTKMSVTTQTSDGKTVQK
FT                   MTNATQITTTMKAPDGTVTTKTEVVPLDEDNTPFTLQKYADKWKSYLEKKEKMNEGKPK
FT                   EPSHIEKINGMPVIGK"
FT   sig_peptide     complement(282085..282210)
FT                   /locus_tag="Sulku_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            282461..283801
FT                   /locus_tag="Sulku_0292"
FT   CDS_pept        282461..283801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32959"
FT                   /db_xref="GOA:E4TYI2"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI2"
FT                   /protein_id="ADR32959.1"
FT                   /translation="MKLVKMSLAAAVLLGASAFAIDNVKVSGDAKLYYNTNNADYLDGS
FT                   GNKQSGLFDKAASAADTALTLGVTGDLTKGVSFGVKGIAVSTLGLENNLVSNTWTGAHD
FT                   AKANGSSFGAQVDDQAWISEMWVAATLGKTTAKLGRMELDTPFAFSEKWSIATNTFDAA
FT                   VLINQDIPDTTLVGAWVGKGNGVNAIGAYSLNGVPSNTPAVGIDGIVGAGANFDTFASD
FT                   GAYAAALVNNSFKPLTFQAWYYNVVDVADTYWLQADIDCQLVKGVKIGAQYANMSPKGN
FT                   IESTLDGIGSNDNSSAYAFKLGYEGVQNLKVSAAYSKADSDGVLKIANVATNNLGAAQS
FT                   KLYTEAWWNYGYVGAPDARSWNVTAEYDAGLAKLGAYYTDVSIDDTNVVNQAVGGKDNV
FT                   DMKEIAVTATKSFGPLDATLAYISTDADDQNTGDRYDTVQAYLTLNF"
FT   sig_peptide     282461..282520
FT                   /locus_tag="Sulku_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            283843..284829
FT                   /locus_tag="Sulku_0293"
FT   CDS_pept        283843..284829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0293"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: tdn:Suden_1749 binding-protein dependent transport
FT                   system inner membrane protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32960"
FT                   /db_xref="GOA:E4TYI3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI3"
FT                   /protein_id="ADR32960.1"
FT                   /translation="MYLSLFRYNHFMKYFFHSLLYTFLMLFLISVLSFGAIHMAPNSFM
FT                   GGELNPNMTPEAISQLRAVYGLDKPLLKQYADWVDNLVTLNFGISFVSGAQVSNVVADR
FT                   LPVTLWMNMIALTLTFVLSLGMGIKAALSYGKKTDTIISQFSLLSFAMPSYYLALVAMM
FT                   VLSVALGWFPIAGIHSLEPPEGIGYYSDMAWHLTLPIAVMVFVGVGSLALYIRSLTIEI
FT                   LKSDYIYFARSRGIGEGKIIRYYILPNLLPPIVTMLGLSLPGLIGGSVILESIFGIEGM
FT                   GQLFYLSAMSRDYPVIMGILMMSAFLALIGNQIADAVLLKLNPFVKR"
FT   sig_peptide     283843..284013
FT                   /locus_tag="Sulku_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(285115..286248)
FT                   /locus_tag="Sulku_0294"
FT   CDS_pept        complement(285115..286248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0294"
FT                   /product="NusA antitermination factor"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR010213: IPR003029: IPR013735; KEGG:
FT                   tdn:Suden_1748 transcription elongation factor NusA; PFAM:
FT                   NusA domain-containing protein; SPTR: Transcription
FT                   termination factor NusA; TIGRFAM: transcription termination
FT                   factor NusA; PFAM: NusA N-terminal domain; TIGRFAM:
FT                   transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32961"
FT                   /db_xref="GOA:E4TYI4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI4"
FT                   /protein_id="ADR32961.1"
FT                   /translation="MENILDIIESIANEKGLNPDRVQEAIKTSFIQTAKRIINPTFAFE
FT                   ADIDDRTKQVRLRQIITVVADDAPELEGEEAGAYMGITAALEIDDEAEIGDQLQMEHDI
FT                   ESYGRSAFATLHREIEFHIQRLVENELYDKYKSKINQIVSGRVTRVDSDQNTTIEIDEI
FT                   RAVLPMKSRIKGEKFKVGDVVSAIVRRVHVDKSNGISMELSRTAPKFLEELLALEVPEI
FT                   KDGIVVIEKCARIPGERAKIALYTNRPQIDPIGATVGVRGVRINAVSEELCGENIDCVE
FT                   YSSSPELFISRAMSPAIISAVVVTENEGEEKKAVVTLPSDQKSKAIGKSGINIRLASML
FT                   TGYTIELNEVGGSAQMGEKAQEEKKEGLSSLEALFGN"
FT   gene            286420..286662
FT                   /locus_tag="Sulku_0295"
FT   CDS_pept        286420..286662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1747 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32962"
FT                   /db_xref="InterPro:IPR040748"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI5"
FT                   /protein_id="ADR32962.1"
FT                   /translation="MELKLARSEHDSKPKKIDLKKITEMVEKSNSSILYFDRENSHKDL
FT                   LALQDHFEGEGKSFYMREVKYGLSANEYMYEVHIL"
FT   gene            286778..288079
FT                   /locus_tag="Sulku_0296"
FT   CDS_pept        286778..288079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0296"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterProIPR020612: IPR006463: IPR005839: IPR002792: IPR
FT                   013848: IPR007197: IPR006638; KEGG: tdn:Suden_1746
FT                   (dimethylallyl)adenosine tRNA methylthiotransferase; PFAM:
FT                   protein of unknown function UPF0004; Radical SAM domain
FT                   protein; deoxyribonuclease/rho motif-related TRAM; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; TIGRFAM: tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; RNA modification enzyme, MiaB
FT                   family; PFAM: TRAM domain; Radical SAM superfamily;
FT                   Uncharacterized protein family UPF0004; TIGRFAM:
FT                   tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme
FT                   MiaB; RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32963"
FT                   /db_xref="GOA:E4TYI6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI6"
FT                   /protein_id="ADR32963.1"
FT                   /translation="MSKKLFIETLGCAMNVRDSEHMIAELNAHEGYELTDDAASADLIL
FT                   INTCSVREKPVHKLFSELGVFNKLKKADAKIGVCGCTASHLGKEIIKRAPYVNFVLGAR
FT                   NVSKIADVLHRDRAVEVEIDYDESQFAFKDFRSSPYKAYINISIGCDKQCTFCIVPKTR
FT                   GDEISIPPDLIVAEVRKAVENGAKEVFLLGQNVNNYGRRFSDVNDKMNFTELLRRVSAV
FT                   EGLERIRFTSPHPFHMDDEFLEEFARNPKICKSMHMPLQSGSTDILKAMKRGYTKEWFL
FT                   NRARKLRELVPDVSISTDIIVAFPGESDADFEDTLDVMKEVRFEQVFSFKYSPRPLTEA
FT                   ESFTNVVDSELGSFRLSTLQAYQDTILDSISAGLLGKEYDVYFEELRSDGYVAGRSDNN
FT                   IMIKVKGSEEWLGKIARVKITEVSRSVQYGEIIA"
FT   gene            288072..288695
FT                   /locus_tag="Sulku_0297"
FT   CDS_pept        288072..288695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0297"
FT                   /product="protein of unknown function DUF374"
FT                   /note="COGs: COG2121 conserved hypothetical protein;
FT                   InterPro IPR007172; KEGG: tdn:Suden_1745 hypothetical
FT                   protein; PFAM: protein of unknown function DUF374; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF374)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32964"
FT                   /db_xref="GOA:E4TYI7"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI7"
FT                   /protein_id="ADR32964.1"
FT                   /translation="MRKRFLRALALWLIPPIGTLLIRLIYLTNRKRFHLPMSIPNEPVI
FT                   FAFWHGDLLMQPYLYYQFRRNPKANVLISDHFDGQIIARIMRYFKLGTIHGSTTRGGAK
FT                   VLIQGLKSLSEGYDIGITPDGPKGPRHEMSDGVVVMAQKRNAKVIVYSCVPSTFWQLPS
FT                   WDRFTVPKPFGRLDFYASEPIDLGGLEMEAAKALIKAKLMEHVL"
FT   sig_peptide     288072..288128
FT                   /locus_tag="Sulku_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            288702..289550
FT                   /locus_tag="Sulku_0298"
FT   CDS_pept        288702..289550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0298"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: tdn:Suden_1743 phage
FT                   integrase; PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; SPTR: Phage integrase; PFAM:
FT                   Phage integrase, N-terminal SAM-like domain; Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32965"
FT                   /db_xref="GOA:E4TYI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI8"
FT                   /protein_id="ADR32965.1"
FT                   /translation="MQMNELYRQKEAFLKYLDTIRGYSPLTIRSYNDAIDEMLTFAEMD
FT                   ASSNLLSINLMPLRLKISSLKAKSIAAKLSAIRSFVKYLRSQGKTVELRGDESIKTPKT
FT                   LPKPITHEQILHALQYAEPQAALAITLLYTMGLRISELTHLRLSDISEGWSRIHGKGSK
FT                   ERDIPMMDNIRTMVQEYQKINPSREYVFELKGEKLSENSLRYTIIKAFAKVGLKVTPHQ
FT                   LRHTYATELLNNGARIADVSELLGHASMATTQIYTKLGNALKMEHYLQSHPLCQTHEDS
FT                   K"
FT   gene            289547..290584
FT                   /locus_tag="Sulku_0299"
FT   CDS_pept        289547..290584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1742 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32966"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI9"
FT                   /protein_id="ADR32966.1"
FT                   /translation="MIERFYRKIFVAIVQDGGAHDVRVVVQKKRKLLNKQSRKFEGKSA
FT                   LDEIRSYLGKYLDESPLHYVAVLNPAVKQGALPGCRNHLDEEMEEISGAKTLCQNEDWL
FT                   LYSSMRELDSLQTEYKSIGLDFIFSPFSVLEHFFKDKVHGGFALYALAQKDSFSVAFFE
FT                   DGKLEYAHHYPMQEKNTLTLEDESSTMGFAVGIKEEDEIDKGISLDDIESLDDLDILEE
FT                   LDDLSEIEDLDNLDEIVEFSEDEPTFEEKRIVFPRGSEIKQEMDMFNNDYRRFELIQRT
FT                   LARFYRGEHCNDRFVETIFIADAYGSGAELKQYLEEELFLNVSIRHIDVADEVIALAMA
FT                   EEEEL"
FT   gene            290581..291105
FT                   /locus_tag="Sulku_0300"
FT   CDS_pept        290581..291105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1741 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32967"
FT                   /db_xref="GOA:E4TYJ0"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ0"
FT                   /protein_id="ADR32967.1"
FT                   /translation="MKYSFIAPRKKRLISGELRLVLFFFAVTIAMLVGTYVFLEYKTYD
FT                   FVNERKNVALKEKSIKRSVEVMQEQIKTIEKEAKIVEQVTTSNAVMKESIRNLFDLVPE
FT                   DITLSRAELEEKSLILYGMTPNKDTYEYMLHAPLRSIFNRSYTSFYPIENGWYRFVSSN
FT                   YLDDETVEEIK"
FT   sig_peptide     290581..290670
FT                   /locus_tag="Sulku_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            291102..291617
FT                   /locus_tag="Sulku_0301"
FT   CDS_pept        291102..291617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1740 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32968"
FT                   /db_xref="GOA:E4TYJ1"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ1"
FT                   /protein_id="ADR32968.1"
FT                   /translation="MKRQTLLVVILSLFLLIGVIAFSFLLLIPKGKEYRSLRLESKKEF
FT                   QQLELAQNRFDNTNNRLKDLQAQNRHTIGAFEKTFDPGRFERLYKKEFTDLYLTEVTTK
FT                   DSNGTFRVYEVNATSKITSPQSFYNFLDNINKSEWVIGVNFPIHFERDGDEIRSSFTMK
FT                   VHNKKEEK"
FT   sig_peptide     291102..291170
FT                   /locus_tag="Sulku_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(291623..292381)
FT                   /locus_tag="Sulku_0302"
FT   CDS_pept        complement(291623..292381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0302"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COGs: COG0345 Pyrroline-5-carboxylate reductase;
FT                   InterPro IPR000304: IPR004455; KEGG: sun:SUN_1761
FT                   pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; PRIAM:
FT                   Pyrroline-5-carboxylate reductase; SPTR:
FT                   Pyrroline-5-carboxylate reductase; TIGRFAM:
FT                   pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; TIGRFAM:
FT                   pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32969"
FT                   /db_xref="GOA:E4TYJ2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ2"
FT                   /protein_id="ADR32969.1"
FT                   /translation="MSRSVTFIGNGKMALALAKGLSTTHSIEVIGRTTEAVERFEASLG
FT                   VAITKTLYQNADINNKNIIICVKPANLSEIAPLLKGKAEALYSVLAGTTLESLKSVDAH
FT                   HYCRAMPNLAAETGASMTSLVGDTAIKTFALELFGTIGSVLWLSNEKELDIATALAGSG
FT                   PAYLALIAEALCDGAVREGLKRDDAMTLMRGLFDGFGRLIQTTHPALLKDNVMSPGGTT
FT                   AAGYGALEKGKVREGCMEAIRCAHERAKKL"
FT   gene            complement(292374..292763)
FT                   /locus_tag="Sulku_0303"
FT   CDS_pept        complement(292374..292763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0303"
FT                   /product="protein of unknown function DUF180"
FT                   /note="COGs: COG1699 conserved hypothetical protein;
FT                   InterPro IPR003775; KEGG: hhe:HH0843 flagellar assembly
FT                   protein FliW; PFAM: protein of unknown function DUF180;
FT                   SPTR: Flagellar assembly factor fliW 1; PFAM: FliW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32970"
FT                   /db_xref="GOA:E4TYJ3"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ3"
FT                   /protein_id="ADR32970.1"
FT                   /translation="MQFDLKLPLLGFETVSKMELQKIDEIFFRLESIGEGPSFTLISPF
FT                   ALREYSFDIPSSLQALMGITPESNLLIYNIMILQTPIEKSTINFVAPLIFNTDNQTMAQ
FT                   IIVDNRSDFGIAEPIKNYLKSSTDE"
FT   gene            292897..293673
FT                   /locus_tag="Sulku_0304"
FT   CDS_pept        292897..293673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0304"
FT                   /product="outer membrane assembly lipoprotein YfiO"
FT                   /note="COGs: COG4105 DNA uptake lipoprotein; InterPro
FT                   IPR017689; KEGG: tdn:Suden_0413 DNA uptake
FT                   lipoprotein-like; SPTR: DNA uptake lipoprotein-like
FT                   protein; TIGRFAM: outer membrane assembly lipoprotein YfiO;
FT                   TIGRFAM: outer membrane assembly lipoprotein YfiO"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32971"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ4"
FT                   /protein_id="ADR32971.1"
FT                   /translation="MIRTWLIAITTLILLTGCGSKDLEEFNKPAEYWYEKMVTAVSNGN
FT                   LERADSYFSSLQSEHISSPFLSEATMIMAQAHMAHEEYLLSEHFLDEYIRRYATPEGRE
FT                   YAEFLKIKAKFLALPNPGRDQGLIDETLNSVETFKRSYPNSMYLPLVHSMETQLQLARG
FT                   VLNEQIAELYERLGKPKAAGSYRTIAPVTWIDSKNIVRAEVPWYREMFEGDGTSSWYAF
FT                   MIPKTRSVVSMDDNESTASPKKQDNGSWYDFLIPHF"
FT   sig_peptide     292897..292956
FT                   /locus_tag="Sulku_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            293717..296140
FT                   /locus_tag="Sulku_0305"
FT   CDS_pept        293717..296140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0305"
FT                   /product="ATP-dependent proteinase"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease;
FT                   InterProIPR004815: IPR003111: IPR003959: IPR001984: IPR
FT                   008268: IPR003593; KEGG: tdn:Suden_0414 peptidase S16,
FT                   ATP-dependent protease La; PFAM: AAA ATPase central domain
FT                   protein; peptidase S16 lon domain protein; PRIAM:
FT                   Endopeptidase La; SMART: peptidase S16 lon domain protein;
FT                   AAA ATPase; SPTR: ATP-dependent protease La; TIGRFAM:
FT                   ATP-dependent protease La; PFAM: ATP-dependent protease La
FT                   (LON) domain; ATPase family associated with various
FT                   cellular activities (AAA); Lon protease (S16) C-terminal
FT                   proteolytic domain; TIGRFAM: ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32972"
FT                   /db_xref="GOA:E4TYJ5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ5"
FT                   /protein_id="ADR32972.1"
FT                   /translation="MQLSNYSSFPTNLPVIAEDELFLYPFMISPLFLNDEKNIAAAAEA
FT                   IENNSLVIVCPVKPEHEGEREGDSIYDAGVIGSIMRKVVLPDGRIKVLFQGLARGHITE
FT                   MIHENPLRAHVDLIQSTSVNELKMDAILEVLREKVRALSQVSNYFPPDLLRTIEENHEY
FT                   NRIVDLICSSIKIKKENAYQLFIERDPEKRFLMLIDELIEETEANKLQKEIRSKVHSRI
FT                   EKVNKEYFLKEQLKQIQKELGTDTHRDEEIEEFRKKLEAKKDKMHADAYKEINKQLERF
FT                   ARMHPDSADAGMIQTYLEWVLEIPYGEEAKKALNIHDVENQLNKDHFSLKKPKERILEF
FT                   FSVKELLELRGIADKEGRGAILCFAGPPGVGKTSLANSIATALKRPLVRIALGGLEDVN
FT                   ELRGHRRTYIGAMPGRIVQGVIEAKKMNPVIVLDEIDKVAKSHRGDPTAVLLEILDPEQ
FT                   NTHFRDYYLNFNLDLSKAIFIATANDVGQIPGPLRDRMEFISVSSYTPQEKFQIAKQYL
FT                   IPQELKKHGLKTSELSISKTALAEVIEKHTREAGVRNLRRRVADIVRKAAKKILEEPTT
FT                   QKVTVSLKNLKEFLEKTIFEIDRTDHVDRIGVVNGLAWTAVGGDVLKIEAIRINGKGVL
FT                   QLTGSLGDVMKESARIALSVVKTLIDEGKISVDHSIIPLSPAERESDVPVDASEVYKRF
FT                   DLHVHVPDGATPKDGPSAGIAMSTVIASILTNKKVRADIAMTGEVSLTGNVLPIGGLKE
FT                   KLIAAHRAGMKLALIPQKNYDRDLADIPDEVKGALEIVGVSRIEEVLERLLIDA"
FT   gene            complement(296094..297110)
FT                   /locus_tag="Sulku_0306"
FT   CDS_pept        complement(296094..297110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0306"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR012795: IPR011063; KEGG: tdn:Suden_1738
FT                   tRNA(Ile)-lysidine synthetase-like; PFAM: PP-loop domain
FT                   protein; SPTR: tRNA(Ile)-lysidine synthetase-like protein;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   family; TIGRFAM: tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32973"
FT                   /db_xref="GOA:E4TYJ6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ6"
FT                   /protein_id="ADR32973.1"
FT                   /translation="MSKLLHLDRLREGRVLLAFSGGVDSTALFHLLLENNIAFDIAHVN
FT                   YHTRETSDAEEKNAERLAARHSLQCYAHSCRLGGINFEHRAREERYRFFGYLMKKHGYT
FT                   YLLTAHQLNDRLEWLMMQICRGSGLPEMLGIRSHDSRDGIEILRPLLEWDRDSIEAYLH
FT                   ERKIPHHIDESNADERYTRNFFRHRYSTPIMRDYRDAIRRSFRYLEEDSESLIESMDFK
FT                   TVNEFAYAENPTNIRSLLYGIDRYFKSRSYLLSKHDKEALKGGGDHIIGRRFIVSIEMK
FT                   YTFVAPYEANVVMDKGFKEECRKLKIATKLRGYLFGVPEAMRVMRQLKGAQELLRSD"
FT   gene            complement(297103..298419)
FT                   /locus_tag="Sulku_0307"
FT   CDS_pept        complement(297103..298419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0307"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterProIPR005839: IPR005840: IPR013848: IPR007197: IPR
FT                   020612: IPR006638; KEGG: tdn:Suden_1737 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0004; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: MiaB-like tRNA modifying enzyme YliG, TIGR01125;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme YliG; RNA
FT                   modification enzyme, MiaB family; PFAM: Radical SAM
FT                   superfamily; Uncharacterized protein family UPF0004;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme YliG, TIGR01125;
FT                   RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32974"
FT                   /db_xref="GOA:E4TYJ7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ7"
FT                   /protein_id="ADR32974.1"
FT                   /translation="MSKKLHIVSLGCTKNLVDTEVMLGRLKDFEMTDASGEADVIIVNT
FT                   CGFIDAAKQESLNTIFNLDAGRKKDSVLVMAGCLSERYKEELSKELSEVDIFTGVGDYD
FT                   KIDELLAAKQSRFTPEVYLIDGAERVVTGSTYHAYIKLSEGCNQQCSFCAIPSFKGKLN
FT                   SRNLESIAHEVETLVAKGYYDFSFVSQDSSSYLRDQNIQDGLIHLIKRIELIDGVKSAR
FT                   ILYLYPSTTSLKLIKAIGDSKVFHNYFDMPIQHINDEMLKIMKRGFGKAKTLELLGAMK
FT                   ALPNAFIRTSFIVGHPQETEAMFEEMAEFSATFGFDRLNVFSYSDEEGTSAYTMEEKIP
FT                   SKTINARAKKLGKIASDVELSSLQKLVGTEITLVIDGESDEHEFLLSARALNWAPDVDG
FT                   EIYVNDREIEGELAFGKMYRARITELAEKRPLATVTGNV"
FT   gene            298471..299397
FT                   /locus_tag="Sulku_0308"
FT   CDS_pept        298471..299397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0308"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572;
FT                   KEGG: mca:MCA0844 putative sulfite oxidase subunit YedY;
FT                   PFAM: oxidoreductase molybdopterin binding; SPTR: Sulfoxide
FT                   reductase catalytic subunit yedY; PFAM: Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32975"
FT                   /db_xref="GOA:E4TYJ8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ8"
FT                   /protein_id="ADR32975.1"
FT                   /translation="MLRRDNYDLIHSSEITSEAVYHERRALMKLGASAALLGASPLMAA
FT                   LGFEKSKSKSTLELTPYDQVITYNNFYEYGTDKESPAKLSKNLKTRPWTLSVGGEVQKG
FT                   RTYDIDELIKKIPLEERIYRFRCVEGWSMVVPWVGFSLSSLLKAAGLTSKSKYVEFETL
FT                   FDPAQFPGQKQSFGTIPFPYREGLRIDEAMHPLTILAVGLYGKELLPQNGAPIRLVVPW
FT                   KYGFKSIKSIVKITLSEHQTRSTWNQIAPSEYGFYANVNPLVDHPRWSQKRERVLGKFF
FT                   KQDTLAFNGYANDVAYLYKNMDLKKFY"
FT   sig_peptide     298471..298602
FT                   /locus_tag="Sulku_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            299410..300012
FT                   /locus_tag="Sulku_0309"
FT   CDS_pept        299410..300012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0309"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="COGs: COG2717 membrane protein; InterPro IPR013130;
FT                   KEGG: abu:Abu_0562 hypothetical protein; PFAM: Ferric
FT                   reductase domain protein transmembrane component domain;
FT                   SPTR: Conserved hypothetical membrane protein; PFAM: Ferric
FT                   reductase like transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32976"
FT                   /db_xref="GOA:E4TYJ9"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ9"
FT                   /protein_id="ADR32976.1"
FT                   /translation="MRIIIWIGALLPIVFALFRFSAAFHPVWLNDILLFIEGYVHLSLT
FT                   KFPNDPLKFLINLSGESALWLLALSLTITPLRSYLKINLFSYRRLLGLFAFFYALIHAL
FT                   LFIGIDQQFDFDGLIHEVTTKPFIAFGMGAFLILLLMALTSTKKLFSNFKGWHRLVYIA
FT                   VVLIVVHYLMSHKTITWDNLSTAGVLIFLLVLRLIKR"
FT   sig_peptide     299410..299478
FT                   /locus_tag="Sulku_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            300009..301154
FT                   /locus_tag="Sulku_0310"
FT   CDS_pept        300009..301154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0310"
FT                   /product="HI0933 family protein"
FT                   /note="COGs: COG2081 flavoprotein; InterPro IPR004792:
FT                   IPR013027; KEGG: tdn:Suden_1736 HI0933-like protein; PFAM:
FT                   HI0933 family protein; SPTR: HI0933-like protein; PFAM:
FT                   HI0933-like protein; TIGRFAM: flavoprotein, HI0933 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32977"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK0"
FT                   /protein_id="ADR32977.1"
FT                   /translation="MKHYDVIILGAGASGLMCAAQLRQNSSLSIAIIEGNNRPALKLKA
FT                   SGGGKCNLTNVEVDETHFLGDERLVLSALSTFSQKKLLDYFKAGGLRPVIRKERYYFCP
FT                   KSSDEVISILLGKAAGTDLLLGHKILSVEGKNPFVVTTDKGKFQACRVVVATGGASYKE
FT                   LGASDIGLKIAQHYDIKTIPFSPALVGLTLQPKEFWMKELSGISFPARIHVAGKTLDED
FT                   LLFAHKGISGLVVLSASLYWHRGEIVIDFLPDFELNTLKYEKKSVSTAIPLPKRFMKAF
FT                   LEAVGLEDKACNRLDSQDWEKLIRIRQYAMAPSGTFGFSKAEACRGGVACEEIDPLTME
FT                   STKIKGLYFIGETVDVTGELGGYNFQWAFSSAVVCSISVML"
FT   sig_peptide     300009..300068
FT                   /locus_tag="Sulku_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            301190..302419
FT                   /locus_tag="Sulku_0311"
FT   CDS_pept        301190..302419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0311"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027: IPR000103; KEGG:
FT                   tdn:Suden_1213 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32978"
FT                   /db_xref="GOA:E4TYK1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK1"
FT                   /protein_id="ADR32978.1"
FT                   /translation="MKRQRVVIVGGGYAGVKALQTLAPSGQCDIVLIDQHPYHYLQTEA
FT                   YELIANECSMTRVTIDLVALCLSYGEHVTFIKDTIREIDFEHKCAGGQSSCHPYDYLLL
FT                   CSGSRTAFHTSVPGLREHSHGVKTLPSALAFKHQFEQRLYDRMESEGGWCSEPFNVVIG
FT                   GGGLSGVEIAAEMANYIRVFHLDNTLTCDNIHIFLIIPHENVLEGMEPYLIQKATERLT
FT                   RLGVKIIRHSRITSVEEHTLILNNEESICFDFMIFTGGIIASTLTTTIESEKNKKSQLI
FT                   IDEYLRVPLYEGVFAAGDIAEIRSTDGKILPPTAQIAEQSGTEAGKNILALIEGREMDR
FT                   VSMKIEGMMVALGGKYAAISLFGRIRFSGFAGYLIKTVIMRGYRYLLHRQCTKGMDGLS
FT                   KTKAQCHTGF"
FT   gene            302465..303265
FT                   /locus_tag="Sulku_0312"
FT   CDS_pept        302465..303265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0312"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="COGs: COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
FT                   8-phosphate synthase; InterPro IPR006269: IPR006218; KEGG:
FT                   tdn:Suden_0401 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; SPTR:
FT                   2-dehydro-3-deoxyphosphooctonate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphooctonate aldolase; PFAM: DAHP
FT                   synthetase I family; TIGRFAM: 3-deoxy-8-phosphooctulonate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32979"
FT                   /db_xref="GOA:E4TYK2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK2"
FT                   /protein_id="ADR32979.1"
FT                   /translation="MILLAGPCVIESEESIFKIAKSLERYQNDPRFDFYFKSSFDKANR
FT                   TSLDSYRGPGIEEGLRILQKVKDDFGYKIVTDVHESYQVPIAAEVVDMLQIPAFLCRQT
FT                   DLLVAAGKTDKIVNIKKGQFMTPGDMQYSVMKVLKTRGCDELSFEASQKYGVLLCERGS
FT                   SFGYGNLVVDMRSLVIMRQFAPVIFDATHSVQMPGTGTGKTGGDSSMVPHLARAAAAVG
FT                   VDGFFFETHFDPICALSDGPNMLKLEQLEALSETLLQINSVKGN"
FT   gene            303270..303740
FT                   /locus_tag="Sulku_0313"
FT   CDS_pept        303270..303740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0313"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="COGs: COG0054 Riboflavin synthase beta-chain;
FT                   InterPro IPR002180; KEGG: tdn:Suden_0402
FT                   6,7-dimethyl-8-ribityllumazine synthase; PFAM:
FT                   67-dimethyl-8-ribityllumazine synthase; SPTR:
FT                   6,7-dimethyl-8-ribityllumazine synthase; TIGRFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; PFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; TIGRFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32980"
FT                   /db_xref="GOA:E4TYK3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK3"
FT                   /protein_id="ADR32980.1"
FT                   /translation="MKLIEGQLRVRTDKKVAIVSTRWNHFIVDRLVEGAKDAYSRHGGN
FT                   ADDLTHVLAPGAFELPMVIEQLLSSGKFDAVCALGAVIRGSTPHFDYVSAEATKGIATV
FT                   SLKHKKPVSFGLLTTDTIEQAIERAGTKAGNKGFEAMTVVIEMLDLYAEIGA"
FT   gene            303740..304138
FT                   /locus_tag="Sulku_0314"
FT   CDS_pept        303740..304138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0314"
FT                   /product="NusB antitermination factor"
FT                   /note="COGs: COG0781 Transcription termination factor;
FT                   InterPro IPR011605: IPR006027; KEGG: tdn:Suden_0403
FT                   transcription antitermination protein NusB; PFAM:
FT                   NusB/RsmB/TIM44; SPTR: N utilization substance protein B
FT                   homolog; TIGRFAM: transcription antitermination factor
FT                   NusB; PFAM: NusB family; TIGRFAM: transcription
FT                   antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32981"
FT                   /db_xref="GOA:E4TYK4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK4"
FT                   /protein_id="ADR32981.1"
FT                   /translation="MATRHQARMAVVSLLYAYDLGNQTIADFSDEILEEKKIRNKQRDF
FT                   ALDLFKGVTEHLSEIDEAIVKHLKDWDFDRLGSIERATLRLGGYEIMFGELDSAVIINE
FT                   AIEVAKAFGSEQSPKFINGVLDAISKDK"
FT   sig_peptide     303740..303817
FT                   /locus_tag="Sulku_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            304145..305191
FT                   /locus_tag="Sulku_0315"
FT   CDS_pept        304145..305191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0315"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR020050: IPR007197: IPR005244; KEGG:
FT                   tdn:Suden_0404 hypothetical protein; PFAM: Radical SAM
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: radical SAM domain
FT                   protein, CofH subfamily; menaquinone biosynthesis protein,
FT                   SCO4550 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32982"
FT                   /db_xref="GOA:E4TYK5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK5"
FT                   /protein_id="ADR32982.1"
FT                   /translation="MRLSKEQALELIRHGDLKELGRMATARKKELHPDGITTFVVDRNI
FT                   NYTNVCWVDCKFCAFYRHGKDEDAYVLTFEEIDQKIEELLEIGGTQILFQGGVHPKLKI
FT                   EWYEDLVEHIHTKYPQITIHGFSSIELDFIAKVSHITIQECLSRLHAKGLASIPGAGAE
FT                   ILSDRVRDIIAPKKMDSLDWVDVHRQAHKLGIKSTATMMYGTVETDEEIIEHWNLIRNL
FT                   QDETGGFRAFIMWSFQGQNTQLMEEHPEIEKQSSNRYLRLLAVARLYLDNFPNIQSSWV
FT                   TQGPYIGQMALLFGANDLGSTMMEENVVRSAGAGFRMAKEEMIRLIRDIGETPAIRNTA
FT                   YEILEKFE"
FT   gene            305230..306576
FT                   /locus_tag="Sulku_0316"
FT   CDS_pept        305230..306576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0316"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: tdn:Suden_0405 peptidase
FT                   M16-like; PFAM: peptidase M16 domain protein; SPTR:
FT                   Processing protease; PFAM: Peptidase M16 inactive domain;
FT                   Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32983"
FT                   /db_xref="GOA:E4TYK6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK6"
FT                   /protein_id="ADR32983.1"
FT                   /translation="MGYANAEFSSAESPRTASRAFKKLFLILLLTGQALMASTLDFIDV
FT                   HGTKVPFIYEEDKRLPIVSMQIVFTHSGSIDEGKHFGLARLSAKMLNEGSLKRGSVGFA
FT                   DALDARAIQLSSNAGNETFVIELGSLKEEFDTGLSLLSEQLREPNFTAKSLEKVKTMAL
FT                   SDIARKEADFDTVASDELKAVLFEGTPMAVPNIGTKESIKAIKLSDVEAFKKEHLVLSN
FT                   ALIVMGGDISLNDAKHKAQSLLGILEKGKIGKERHYEPRKEPKESLLKRPQTEQAYLYF
FT                   GAPFAMKEGDPEFYKARVAMFILGSSGFGSRLMEEIRVKRGLAYSAYSRLSVAKTNTYF
FT                   SGYLQTKLESQDEAKKTVVEVIDTFVRDGVTQSELDQARKFLLGSEPLRVETLSQRLGR
FT                   TFSEYYQGKPLGYSLQELELIRTLTLDEVNDFIKRHGEIRDLSYAIVTK"
FT   sig_peptide     305230..305295
FT                   /locus_tag="Sulku_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            306557..308344
FT                   /locus_tag="Sulku_0317"
FT   CDS_pept        306557..308344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0317"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1200 RecG-like helicase; InterPro
FT                   IPR011545: IPR001650: IPR014001: IPR014021; KEGG:
FT                   tdn:Suden_0406 ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; SPTR: ATP-dependent DNA helicase; PFAM: Helicase
FT                   conserved C-terminal domain; DEAD/DEAH box helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32984"
FT                   /db_xref="GOA:E4TYK7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK7"
FT                   /protein_id="ADR32984.1"
FT                   /translation="MLLLPSEDAEKFHRLGVGSVTALSLIAPASFEDRRLSHELFHNAS
FT                   CVIDARVEHVVRTPKTLKITFFAHNLECVIEGVIFHPKPYMLHQFPKHERAFYIGKAQW
FT                   ELGKWTIVHPVKISAVGSLVPIYKTPLRADVMRRLILKYVSVENLIADGLPEKIASELY
FT                   GIHFPDIPKALSEVQTYALKFAELFEYMRRLRLKRRYHKTSYRALGDVKKWIKTLPFAL
FT                   TTDQQNAIADIGSDLRGENAARRMIVGDVGSGKTMVILASVILMHPYRSILMAPTTILA
FT                   AQLYEEAQKYLPNLRIALVTNATKKAPLEEFDFIIGTHALLHRPLPEAGLVMVDEQHRF
FT                   GTAQRHALTRLTDNDTSPHYLQFSATPIPRTQAMIDSAHIDVSLIVQTPFTKNIMTRII
FT                   HKSDFSALLDHIRSEIKQNHQVLIVYPLVEQSEMIDYQSIDEARGYWEKNFENVYVTHG
FT                   KDKEKEAVLMAFREKGAILLATTVVEVGISLPRLSTVVIVGAERLGLSTLHQLRGRVSR
FT                   TGLQGYCYLYTNKSGKNERLESFSRCNSGFEIAALDLKFRSSGDLLDGSIQSGKAFRWA
FT                   DIAEDEKIVREVKSWLDKN"
FT   gene            complement(308463..308999)
FT                   /locus_tag="Sulku_0318"
FT   CDS_pept        complement(308463..308999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0318"
FT                   /product="SSU ribosomal protein S30P;sigma 54 modulation
FT                   protein"
FT                   /note="COGs: COG1544 Ribosome-associated protein Y
FT                   (PSrp-1); InterPro IPR003489; KEGG: tdn:Suden_0407 sigma 54
FT                   modulation protein/ribosomal protein S30EA; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA; SPTR: SSU
FT                   ribosomal protein S30P / sigma 54 modulation protein;
FT                   TIGRFAM: ribosomal subunit interface protein; PFAM: Sigma
FT                   54 modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32985"
FT                   /db_xref="GOA:E4TYK8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK8"
FT                   /protein_id="ADR32985.1"
FT                   /translation="MNISLVGRHIELSDAIKDHLMHSIDTLTKYHLDLISVNAVASANE
FT                   RKKGVTIEFTINVAGKNTIVITQRDDDLYAAIDIAIDRAQKALRRLHDRLSDHKNEGLN
FT                   EAKLAASNSIDLHAATEAMEDEIVPAEPILFKPQEVAEILEKLKESGKVFEVFYDIDGK
FT                   MRVLYKRSDGRFGLY"
FT   gene            309291..313022
FT                   /locus_tag="Sulku_0319"
FT   CDS_pept        309291..313022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0319"
FT                   /product="conserved repeat domain protein"
FT                   /note="InterPro IPR001434; KEGG: sun:SUN_1908 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   conserved repeat domain protein; TIGRFAM: conserved repeat
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32986"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK9"
FT                   /protein_id="ADR32986.1"
FT                   /translation="MKINKLFLRWMTTFGMVMVCTTFGHSAEVAFNTPYYSTNVNGDMT
FT                   TLGNTIVWKDTVAANAYGVDVSTSIPTDRNNAYNMKFIDVLSDGVTTFNSSSSSLDLPA
FT                   GCTVKWAGLYWQGHIVNKNLEGGADNSKIGTGVNNTAVYDDAKSKANTVYFRRPDGTSY
FT                   NLTAQVFYDYPTDISGGKDRRYLYSGFYNVTNYVKAVGSGSYTVGNIRTSEGTIATWGG
FT                   LGGWAMLVIYEDITGTLQLKNVSVFHGYRVLNSGDVQDINVNGFLTPSGGTINASLAIF
FT                   VADGDKLGSNSTGEHLKIWNTSSVLTDIVNGTNPLNNVFNSTITNLGVDNVTRTPNFTD
FT                   NLGIDIDRFDVSSYMNHSQNNTRIQVSTVGDLYTIDLIAFATDIYQPFISIAKSTDSSG
FT                   TVTSNQTITYTANIKNTGNEGASNIVIYDNFDDNNLTKIDGNITNPLVTLGDLLDHNTT
FT                   TILDSVVCNYGPSHTDCKSLCTVGLSPFKIACSIPSMAVGETAFMQFQTKIASNPDTHG
FT                   QSVKVENKMYATYYNALTGAAVDQTSSNLADAGQYLYAQNIPASGFDARETSIAEADND
FT                   RSIKTKIVNKTFQLNIVSLDTAGAIAPYTVPTGNRVYLFPVDSSLCLLSDSEKLTQIES
FT                   LPRNTYVDFANGDTTKPSPAIDLSNALLSAVAGRDKRIALNYVDWGTSFQAASFSCSNS
FT                   NTQAVLLGVPQCLNADHKIGDVFGQLTQDVCAGGAAHGMNPALANPPCQSNSYTAGNLP
FT                   SAPFDNAYGCYQCIAGMAGKVSCSTDNFAIRPDHFSFTAPVAKMKAGEDYSLNVIAYDN
FT                   NGNSAQEYDQSVANLAGAPATWWQRDANVVLNPVNTQGTITISGAGTFSNGAGAVPIRY
FT                   SDVGKFTLELKDSNWAAVDLTDTGITENEYTIQGDRNVTFIPYDFNISVGRIVNNDGAT
FT                   PSFTYLSSDLNMSARIPMTIRAQNKQGALTQNYANNLYERTITITPHVASVVATARGLV
FT                   PKTVGATNADANFVSGSTSIVFNDPLAAKFNFSRDPRVVVSPFDVNSSNGVGNDVNVSI
FT                   VDADNVYGDKNRTLIGNATFVYGRFIPRDIRVFGNVPFSANGWYEVFNAPKINGIILTP
FT                   SKNESMWYINHLHNDVTFGDANITSVLAATHTALPVSSISNGTGMESYQFNAETPPYSS
FT                   KAHIKTKPWLWYGPSASAYADPGTDCSTHPCFNIAVVPSVGATGSSKDQNVGSKTNKST
FT                   SDGAGVWKSTRDYAPAIR"
FT   sig_peptide     309291..309380
FT                   /locus_tag="Sulku_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            313031..313711
FT                   /locus_tag="Sulku_0320"
FT   CDS_pept        313031..313711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0320"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: nam:NAMH_1381 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32987"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL0"
FT                   /protein_id="ADR32987.1"
FT                   /translation="MRFGMTMIELVFAIVIIAISIVTIPSMMSVANNASKGVMIDEDVM
FT                   ERLGGWVLDKFQGRWDRNYLASGSAPLNISGMKDLNCSRTGGYRIGSDENTSSMKCNMA
FT                   ATPSVIPAVAGNNPGQADGNISRGIEQLNNGSETISITAANGTVYNVTATYSVAYVDSI
FT                   VTPLTGSNTQTATWILGSSTNMNPSSPSGNTGNTISHLKRVVTRFNNPDVNITLSFFKS
FT                   NKGN"
FT   sig_peptide     313031..313123
FT                   /locus_tag="Sulku_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            313712..314650
FT                   /locus_tag="Sulku_0321"
FT   CDS_pept        313712..314650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0321"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: sdl:Sdel_0855 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32988"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL1"
FT                   /protein_id="ADR32988.1"
FT                   /translation="MKSKRSAFTMIELLFVIVILGIVGGFALEAVRQYYDGIYRTQQYT
FT                   QRAAEADQILEQISKYFENGISSSIVNLDRGGAAAACYGPPVSGDNNDYTVAFIGVDED
FT                   SIRGIGGRPGWSEETVLGANNTLTALDANYTAADTIIQALSLNNGSDLSHSAIYDAGSV
FT                   DLDTCTRFNWNLLGGTGGYHRMDNVANPISSTVIQLNDDNNATDGHRKYLLRTGYAFRV
FT                   NNGNFTMYSNFRPWLGERYTAAQNQNILGQNVAHFYADYNATDFQNDSNVSDRGLVWRL
FT                   KVCIRGLDSSLNDTDARESQICRERRVHVRY"
FT   sig_peptide     313712..313792
FT                   /locus_tag="Sulku_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            314637..315092
FT                   /locus_tag="Sulku_0322"
FT   CDS_pept        314637..315092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0854 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32989"
FT                   /db_xref="GOA:E4TYL2"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL2"
FT                   /protein_id="ADR32989.1"
FT                   /translation="MYATKRSGFAMILAIVIVVLVALGGVLLLRSSATGSKSVGDNYLK
FT                   VQAELLADSATEFAVMRAQGFDHTGGNCLNNLNITVQDASGISAYDVNVSLAYSFRNPV
FT                   VVGFNDACTRLADNTGKDTMILLDVTVTDHNLSTEPIRVHKRTWQKL"
FT   sig_peptide     314637..314735
FT                   /locus_tag="Sulku_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(315135..315512)
FT                   /locus_tag="Sulku_0323"
FT   CDS_pept        complement(315135..315512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0323"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG3437 Response regulator containing a
FT                   CheY-like receiver domain and an HD-GYP domain; InterPro
FT                   IPR001789; KEGG: tdn:Suden_0415 response regulator receiver
FT                   domain-containing protein; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR:
FT                   Response regulator receiver domain protein; PFAM: Response
FT                   regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32990"
FT                   /db_xref="GOA:E4TYL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL3"
FT                   /protein_id="ADR32990.1"
FT                   /translation="MDEKKLKVLAVDDDLINLKLLKTMLMKTPNVSAVVEAKNGADAIG
FT                   ILKTQNDIDIILLDIIMPVMGGIEMLKVIRADESLRQLPVIVLTTDETKKGEALECGAN
FT                   GFLMKPVREKDVLTKIAQLAF"
FT   gene            complement(315532..318798)
FT                   /locus_tag="Sulku_0324"
FT   CDS_pept        complement(315532..318798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0324"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003661: IPR003594: IPR001789: IPR004358: IPR
FT                   005467; KEGG: tdn:Suden_0416 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SPTR:
FT                   Nitrate and nitrite sensing family; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; Nitrate and
FT                   nitrite sensing; Response regulator receiver domain; His
FT                   Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32991"
FT                   /db_xref="GOA:E4TYL4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL4"
FT                   /protein_id="ADR32991.1"
FT                   /translation="MQLGLRNRLRLISLLPILILFTLASYYVYNAYISYKGAEELQIRL
FT                   EGNKQLNDLINNLSRERGMTVMYMGNASPATLKSLHAQRAIVDQKIGIYQEHLARLEHT
FT                   NGPEAAKAAALSKLIVDLERGITQSRPLVDGGTANFDKIFTDLYSKSEEQLINELTDLA
FT                   TIHFDEEVNSLSSSYLSLVRANEYSSIERDYITYVLSRATPLAEEELNKWVSLIAKADT
FT                   FNLEGMNNKPIQSKLQASLYSEDNTDLFLDITTERTAILQASTTGKYETQSGIWFAMIS
FT                   EKIDAINDAEKILIDAMDERASIVKSQAVQVLAIAISIWILGVIIAILGYFFSAEITTN
FT                   IKNLESVLKRVAEDTHDNEAEALRHTINLDTAAGTAQAYALLERIIEQTLNDKQYAMEA
FT                   SEAKSMFLANMSHEIRTPLNGIVGFTELLKDTELHDEQREFIDIIEKSSENLLEIINNI
FT                   LDLSKIESNKLEIEEIVFNPIDEFESAVEVYGVRASEKHIDLACYVDPSLERPLKGDPT
FT                   KIKEVIINLLSNAVKFTNSGGAISVDIRRIECEILNRTRIRFQVKDNGIGVTSEQRSRI
FT                   FEAFSQADTSITRKYGGTGLGLTISSRFVELMGSKLDLESEPGNGTSFFFTLEFEEIET
FT                   LNESLKGSFSNINAVILENHSKKKLQNTYLKEYLDYFGVSYTTFHEQSELKMLERQVNY
FT                   DLLFVDNDYTNDEEMAAYASSQEQLVLITKSFYMKKIDSMGIDIFKVLYEPLNSSKIRT
FT                   TLDAYDAEAFSNRKIKVSRRKKFDEKNSRFAATALVAEDNIINQKLIRRTLEDLGLEIT
FT                   IANNGLEAFEKRKNGSFDIIFMDIQMPVLDGIEATQEILDFEEDYGQNHIPIIALTANA
FT                   LKGDRERFMSAGMDEYTTKPLVRSEIISLLNNFLSHKIVEINPVPKSIHEIAAPSEESL
FT                   PLSSEPDIQPEVHEEPVHDSEFPILSEEVESSEPAEEEGLVEYDADILIAKQNALESKL
FT                   FCHILNDLGYTYKSVASADQLKDELHNRHYKLVMFDKTLSGLHLKDLYDIIHTKKSDTS
FT                   IVMLIDPNVSEEADDAMYVHEIIKNIINKDLLRLVFEKFI"
FT   sig_peptide     complement(318727..318798)
FT                   /locus_tag="Sulku_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(318824..320602)
FT                   /locus_tag="Sulku_0325"
FT   CDS_pept        complement(318824..320602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0325"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008207; KEGG: nis:NIS_1344 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32992"
FT                   /db_xref="GOA:E4TYL5"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL5"
FT                   /protein_id="ADR32992.1"
FT                   /translation="MLFYNHKQEFIGIDAEGLKLLNYATLEDLLKVCDDVADLFSKEPG
FT                   YIHNFKSFGWIDFLLHADSDARSAIVHGNGRTFSCTLQVNDLFLCDDPSASGYIIDMLH
FT                   IQSLSGDEIKPHSIPPKAKSDSRPPVFETPIPAETAPSVLPNYDHITPTPLSEPGVLDV
FT                   PSYSEQEVEEEPIEDLFTKLSLQHDDEDLETKYVIPESTFSDKSDIKAEQEVPHQISEA
FT                   VSFSKAEKEFIDALKVDKSYRFDPNVAAQELGLPVDLIQEFIGDFIQQAHEFKEELFEV
FT                   VLKGDMNNLKILSHKLKGVAANLRIEDAFETLSNINTSNDPVEIEANLKYFYSIISKLE
FT                   GKESPAAATDETANDEEFLLPPEKAFDFSEDEPSSPPDDDIYAFDFKNDAFAVPEEERT
FT                   PASSADEDFDDISFPSEAVLDQEISAESARDDDIYTFDLKDDHEPFVMEEAVQTSSENK
FT                   EVPTYLLEEKSIEEEPLPIEESNLEESSPAVEPPQTLHFDKISIAGQLGIQLDFFDELI
FT                   EEYKRDSLRAGSEISAAISAFDTHAWKKTAGQLKGISDNLRLNEISDELAILSQTNDAQ
FT                   EANKASKRLNSFLEQL"
FT   gene            complement(320612..321028)
FT                   /locus_tag="Sulku_0326"
FT   CDS_pept        complement(320612..321028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0326"
FT                   /product="PAS sensor protein"
FT                   /note="InterPro IPR000014: IPR013655: IPR001610: IPR000700;
FT                   KEGG: sun:SUN_1902 signal transduction sensor histidine
FT                   kinase; PFAM: PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: Methyl-accepting chemotaxis sensory transducer with
FT                   Pas/Pac sensor; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32993"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL6"
FT                   /protein_id="ADR32993.1"
FT                   /translation="MMQKPTPVDEEYLFDGRAIVSETDLKGVITFANRKFCEISGYTVN
FT                   ELIGEPHNIIRHPDMPKAAFAQMWQTIQSGALWHGLVKNLRKDGRYYWVDTEVTPIYDE
FT                   NGKVKGYMAARKPASRKNIEETAALYQKMIEQEQ"
FT   gene            complement(321096..322904)
FT                   /locus_tag="Sulku_0327"
FT   CDS_pept        complement(321096..322904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0327"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="COGs: COG0322 Nuclease subunit of the excinuclease
FT                   complex; InterPro IPR004791: IPR000305: IPR001943:
FT                   IPR001162; KEGG: tdn:Suden_0418 excinuclease ABC subunit C;
FT                   PFAM: excinuclease ABC C subunit domain protein;
FT                   Excinuclease ABC C subunit domain protein; UvrB/UvrC
FT                   protein; SMART: Excinuclease ABC C subunit domain protein;
FT                   SPTR: UvrABC system protein C; TIGRFAM: excinuclease ABC, C
FT                   subunit; PFAM: UvrB/uvrC motif; UvrC Helix-hairpin-helix
FT                   N-terminal; GIY-YIG catalytic domain; TIGRFAM: excinuclease
FT                   ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32994"
FT                   /db_xref="GOA:E4TYL7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL7"
FT                   /protein_id="ADR32994.1"
FT                   /translation="MIEQIRGLPHQAGIYQYLDEKGRILYIGKAKNLSKRVKSYFNLTP
FT                   SLSPKATLSLRIQKMLSETVGLHYIIVENEHDALILENSLIKQLKPKYNILLRDDKTYP
FT                   YLYVDMDETYPRFELTRKIIKGKSIRYFGPFSVGARDILDSLYELLKLVQKKSCLKGKK
FT                   GCLFYQMEQCLAPCEFPIPHETYLPMVTQGIEWIQNKRKLIKQLEAKMEFYAESLRFEE
FT                   ALVLRDRIDRITKSELTSQIDLASTENYDVFAIALNEVRACILRLFIREGKVASSTHDF
FT                   IPITPYFSIDEAYERTLIGFYGNEKPPIIAPILTAHPFESNDWVQEHLTELFGKKAKIE
FT                   TPQRGAKKELIDLALTNAKELLRTPQPTNEHLLHSIQELLALDSLPRRIEVFDNSHHGG
FT                   SATVGAMIVYENGRFDKKAYRTYHLHERDEYGQMREMLTRRIEAFEKNPPPDLWVLDGG
FT                   ATLRSLATDLLGSHGIHLDVIAISKEKIDAKAHRAKGSARDILHFAEEPLRLESSDKRL
FT                   QFIQMLRDEAHRSAITFHKKTKLKIDQTSKLLAIHGISTPKIHRLLDYFGTFDAIAKSD
FT                   FKTLSELIGAKDAENIQKYYRGNISK"
FT   gene            322974..323099
FT                   /locus_tag="Sulku_0328"
FT   CDS_pept        322974..323099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0328"
FT                   /product="LemA family protein"
FT                   /note="KEGG: mct:MCR_0559 LemA family protein; SPTR: LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32995"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL8"
FT                   /protein_id="ADR32995.1"
FT                   /translation="MSKMYLFSVIVAVILFLNGCGYKAPPYYEKQTAAKESTVAL"
FT   sig_peptide     322974..323045
FT                   /locus_tag="Sulku_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            323089..324531
FT                   /locus_tag="Sulku_0329"
FT   CDS_pept        323089..324531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0329"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COGs: COG0029 Aspartate oxidase; InterPro IPR005288:
FT                   IPR003953: IPR004112; KEGG: tdn:Suden_0420 L-aspartate
FT                   oxidase; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; SPTR: L-aspartate oxidase;
FT                   TIGRFAM: L-aspartate oxidase; PFAM: domain; FAD binding
FT                   domain; TIGRFAM: L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32996"
FT                   /db_xref="GOA:E4TYL9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYL9"
FT                   /protein_id="ADR32996.1"
FT                   /translation="MRYDVVIIGSGVAGLYAAIALPKNLKVLIINKSNPWECNTYYAQG
FT                   GVTTAYNDQDIPSHVQDTLDAGAGMCNATAVQFMSESSQGVIRDLIERGFEFDKDDEGH
FT                   LLYTKEAAHSRSRILHAGGDATGRHLHFFLLNQNSHPMLSDATVVDLLIENNQCCGVEV
FT                   FSEGKRKTILSDNVIIASGGVGSLYEFHTNASTISGDLHGICIEKGIELESMEMMQFHP
FT                   TVFVANDWARKQLLSEALRGEGAHVVDENGYRFLFEYDPRGELAPRDIVSRAIFDYRQR
FT                   SGKQVYLSCEDFESEYFKERFPNIYKSLNDLGFHLPKERVPISPAFHYAVGGIKTNLDG
FT                   SVPGISGLYAAGEAASTGVHGANRLASNSLLEGLVFSKKAAESILEHPLHSCSGDFCIG
FT                   DEPLEIEGDKEKKDRLRRIMWENVSIKRTPDGLNAAYEAINEMLEGEVGRLLKLRLLTA
FT                   QSIVASAQKRTESIGVHYIVEG"
FT   gene            complement(324711..326036)
FT                   /locus_tag="Sulku_0330"
FT   CDS_pept        complement(324711..326036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0330"
FT                   /product="sodium/proton antiporter, NhaD family"
FT                   /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
FT                   arsenite permease; InterPro IPR004680; KEGG: pin:Ping_2676
FT                   transporter, putative; PFAM: Citrate transporter; SPTR:
FT                   Na+/H+ antiporter; PFAM: Citrate transporter; TC 2.A.62"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32997"
FT                   /db_xref="GOA:E4TYM0"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYM0"
FT                   /protein_id="ADR32997.1"
FT                   /translation="MPTPIPLDGIDLSTHPFGWLLLFIFIVGYYFIATEEKYHIDKAKP
FT                   ALFIGTLMYIMIGGFYAFYGLDFIPFKNEITHLVFEIAQIFFFLYVAMTFVEALIERGV
FT                   FNALKGKLIAKGYNYRELFWITGFLAFFLSPIADNLTTALILSTVLVTIEKKNRAFLIP
FT                   GAINVVVASNAGGAWSPFGDITTLMAWTAQKGEFSDFLYLFPASFLGWIVTAYLLSRYV
FT                   PDFGPNKEGNPGTADKIEILKGGKIVIAIGIATIAISVIAKQMMQLPPMWGMLFGLSVL
FT                   QLYMYSLKRYHKQDVNIFRSISKIENNTLLFFFGILAAVGALYFAGFLGYVTKLYDTVN
FT                   PTYINIGVGFVSAVIDNVPVMSAILKSNPAIDFSQWMLLTLTVGVGGSLISFGSAAGVG
FT                   VMGRMHGIYTFASHMKLAWTVLIGYIVSIAVWYLQFIVLGID"
FT   sig_peptide     complement(325935..326036)
FT                   /locus_tag="Sulku_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            326266..327810
FT                   /locus_tag="Sulku_0331"
FT   CDS_pept        326266..327810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0331"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="COGs: COG0519 GMP synthase PP-ATPase domain/subunit;
FT                   InterProIPR004739: IPR001674: IPR000991: IPR011702: IPR
FT                   001317: IPR006220: IPR017926; KEGG: tdn:Suden_0422 GMP
FT                   synthase; PFAM: GMP synthase domain protein; glutamine
FT                   amidotransferase class-I; SPTR: GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit;
FT                   manually curated; PFAM: Glutamine amidotransferase class-I;
FT                   GMP synthase C terminal domain; tRNA methyl transferase;
FT                   TIGRFAM: GMP synthase (glutamine-hydrolyzing), C-terminal
FT                   domain or B subunit; GMP synthase (glutamine-hydrolyzing),
FT                   N-terminal domain or A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32998"
FT                   /db_xref="GOA:E4TYM1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYM1"
FT                   /protein_id="ADR32998.1"
FT                   /translation="MKDVNIIVLDFGSQYTQLIARRLREDKVYCEVLPYHTKIDAIKAK
FT                   NPKGIILSGGPSSVYNKDAYEVDQGVYALGIPVLGICYGMQRIAVDFGGSVIRSDHHEY
FT                   GKAELTIDMTQHSVLFEGCEDERTVWMSHSDKVDVLPEGFVPIAYSPNSPYAAIANEEK
FT                   MVYAMQYHPEVNHSEEGYLMLRNFARKICGITEKWDMGHFLKEQIVKIRAQVGEGKVLC
FT                   ALSGGVDSSVVAALLYEAIGDQLIPVFVDNGLLRKGERESVENIFKVHLKVPLVVADAS
FT                   EIFLGKLAGVTDPETKRKIIGHTFIEVFEAEAKKHDGIKFLAQGTLYPDVIESVSVNGP
FT                   SVTIKSHHNVGGLPDWMDFELIEPLRDLFKDEVRKLGLELGLPDSLVNRHPFPGPGLGI
FT                   RIMGEVNKPDLNLLREADAILLDELKASGYYTKTWQAFAVLLNVKSVGVMGDNRTYDNT
FT                   VCVRVVEAVDGMTATFAHLPHTLLERISRRIINEVDGINRVVYDISSKPPATIEWE"
FT   gene            327822..328463
FT                   /locus_tag="Sulku_0332"
FT   CDS_pept        327822..328463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0332"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="COGs: COG1587 Uroporphyrinogen-III synthase;
FT                   InterPro IPR003754; KEGG: tdn:Suden_0423
FT                   uroporphyrinogen-III synthase; PFAM: Uroporphyrinogen III
FT                   synthase HEM4; SPTR: Uroporphyrinogen-III synthase; PFAM:
FT                   Uroporphyrinogen-III synthase HemD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32999"
FT                   /db_xref="GOA:E4TYM2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYM2"
FT                   /protein_id="ADR32999.1"
FT                   /translation="MRPIYLISKTPYEGVIHIPILTIRFLSPDINFSDYEGVVFTSKQG
FT                   VLSLQNYLPDWNRLKCICVSESTAKNAREAGAIDVEVANGYGDSIPDILGAKKRRGKWL
FT                   YLRPKVVASDWVESARHRGITIDEAIVYESVCNEEMSNFPVSQEGVLIFTSPSAIRCFL
FT                   QNHKILPTHDVIVIGETTKNALPAGTLSYLSEVPSIEATVDLARQIAVEG"
FT   gene            328811..330079
FT                   /locus_tag="Sulku_0333"
FT   CDS_pept        328811..330079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0333"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COGs: COG0151 Phosphoribosylamine-glycine ligase;
FT                   InterProIPR000115: IPR020562: IPR020561: IPR020560: IPR
FT                   020559: IPR011761; KEGG: tdn:Suden_0424
FT                   phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain; PRIAM:
FT                   Phosphoribosylamine--glycine ligase; SPTR:
FT                   Phosphoribosylamine--glycine ligase; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33000"
FT                   /db_xref="GOA:E4TZ01"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ01"
FT                   /protein_id="ADR33000.1"
FT                   /translation="MRVMVIGSGGREFAIGRVLKQDSAVTELFFAPGNGATTMLGQNVA
FT                   IKDYGELAQFALDNKIDLTIVGPEGPLSDGVVDVFKAKGLVIFGPSKAAAQLEGSKVYM
FT                   KNFLAKYNIPTARYIETDHIGDAFKFIESLTPPIVVKADGLCAGKGVIIAMSYEEAKVA
FT                   VSEMLSGKSFGDAGKRVVVEEFLDGYELSMFALCDGKDFILLPAAQDHKRLLDNDEGPN
FT                   TGGMGAYAPTPLVDDVIYEKVKDRIVRPTLKGMQEEGAPFEGVLFIGLMIVNGEPITLE
FT                   FNVRFGDPECEILMPLLKTPASELFYKAATKQLDTLNVEFYDKYAVGVVMASRNYPYDN
FT                   SEPAEIIVDEIHHAEIAQNTHIAYAGVAAEDGKLYATGGRVLVCVGVGESIKEARDRAY
FT                   MLCGQVHFAGKKLRSDIAYQALR"
FT   gene            330079..330528
FT                   /locus_tag="Sulku_0334"
FT   CDS_pept        330079..330528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0334"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tdn:Suden_0425 RDD
FT                   protein; PFAM: RDD domain containing protein; SPTR: RDD
FT                   protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33001"
FT                   /db_xref="GOA:E4TZ02"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ02"
FT                   /protein_id="ADR33001.1"
FT                   /translation="MDESLDSLIQREHLQLASIRQRAAAFGIDETLLSIIMIVILWDSI
FT                   AAAHTLENMIAVTNSFLLEYMSIKIIYQTFFTMQYGASIGKIIMKIRVIEISTLSNPNF
FT                   LSAFNRSVFRIVSEILFYLGFIWAMLDPYHRSWHDRTGRTLVINA"
FT   gene            330521..332659
FT                   /locus_tag="Sulku_0335"
FT   CDS_pept        330521..332659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0335"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="COGs: COG1452 Organic solvent tolerance protein
FT                   OstA; InterPro IPR007543; KEGG: tdn:Suden_0426 organic
FT                   solvent tolerance protein, putative; PFAM: Organic solvent
FT                   tolerance protein; SPTR: Organic solvent tolerance protein,
FT                   putative; PFAM: Organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33002"
FT                   /db_xref="GOA:E4TZ03"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ03"
FT                   /protein_id="ADR33002.1"
FT                   /translation="MHKFYWISLIASTALLGNERVELFGTNMDSNGSVATAQGNPIALY
FT                   QDQIMSADKVTYDRNTSIMEAKGSVNVFKDGQHVMSEYSRINFLDETRYSVPYFAIDQS
FT                   TGLWVSTSEAQACKNLIDLSSGAISGCDSSDPLWKIRFSSADYDTDKMWVNLYNPRLEI
FT                   GDISVFYLPYFGYPTDSTRRSGLLIPTFGWSSSEGFYYQQPIYFAPQNWWDLELRPQIR
FT                   TARGSGLYTDFRFVDTPSSQGSIRMGYFKEQSRYAIENDLAHAKHYGYDVKYRHSAPLR
FT                   EWFDSTLEGESGIYIDGSWMNDVDYLNLQQSDETRNITANQVMSRINGYYSSEDNYFGA
FT                   YFKHYQYLNSASNGTTIQTLPTLQYHRYLESFLDNYLLISADAAATHYYRPNGKRAVEG
FT                   NFNIPATLQTSILDDYIDISYTANASAKVIGFYANERNGESGSTYEQGKYAQLDHTLSI
FT                   GSTLVKSYDNNITHVFNPLVSYTAAGSRYYSGYYETYRNSCNMSESYAGYPCEFYNLSA
FT                   PSDTLSLGINNYLFENGKQLLVDRLSQNFRYDDQRSYYGELQNELELEIAGAISYYNQT
FT                   AYNYDRDRITKEQNTIRYNDGVFLAGISHYYTDQLRNDTPVYASYWTADAAYQYSRNYR
FT                   FFGQVAYDYREALLKRSEVGLLYSQRCFDFGVRYVQNRRPILTNTNGSDSINDSYIFIT
FT                   VVLKPIGGSEFNYKLTDN"
FT   sig_peptide     330521..330571
FT                   /locus_tag="Sulku_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            332674..334053
FT                   /locus_tag="Sulku_0336"
FT   CDS_pept        332674..334053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0336"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="COGs: COG1463 ABC-type transport system involved in
FT                   resistance to organic solvents periplasmic component;
FT                   InterPro IPR003399; KEGG: nis:NIS_1335 hypothetical
FT                   protein; PFAM: Mammalian cell entry related domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: mce related
FT                   protein; TIGRFAM: virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33003"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ04"
FT                   /protein_id="ADR33003.1"
FT                   /translation="MKLEAKIGLFVVMALGALLFLSTQVTSLGKWGSEGYVIQAYINDA
FT                   SGIEKHTHVLMNGVTIGDVEEITIEGKRVKLQLMIDKGVKIPVDSSVIVAQESLLGSKV
FT                   LNITVGDSASSIADGGTLSQSKQFASFDQTSDSVNAAAKELESLLRDFHAILDDEHRQA
FT                   IQEAIIAFRNVGVNLDGVIVENRDDLHAAIANFRAMGAGFTQTADTVNKDLPEIMARIN
FT                   SLTAQLDSKLPTAVDKFTNIEDNVSTILAENRSTLKTTLESAGSFFKSGEEAFGKVDSM
FT                   LSSFTTSELQVAMHTDYMMRDQYGKVYLGVNYLPNPETYYMFDLISTDDYSDANNPPKK
FT                   HQKSDTLYSLQYGKRFDNTLLRFGAIESTGGIGVDYFMNHDKLKLSAEAFDFNSVNDYR
FT                   SERAHLKAQVRYQMLKHLELYGGWDDFLNPKSQNIFLGLGLRFIDNDLKYVVGGASSMK
FT                   R"
FT   sig_peptide     332674..332754
FT                   /locus_tag="Sulku_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            334069..336246
FT                   /locus_tag="Sulku_0337"
FT   CDS_pept        334069..336246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0337"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="COGs: COG1185 Polyribonucleotide
FT                   nucleotidyltransferase (polynucleotide phosphorylase);
FT                   InterProIPR012162: IPR001247: IPR015847: IPR015848: IPR
FT                   018111: IPR003029: IPR004087: IPR004088; KEGG:
FT                   tdn:Suden_0428 polynucleotide phosphorylase/polyadenylase;
FT                   PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
FT                   domain 2; Polynucleotide phosphorylase, phosphorolytic
FT                   RNA-binding; K Homology, type 1, subgroup; RNA binding S1
FT                   domain protein; PRIAM: Polyribonucleotide
FT                   nucleotidyltransferase; SMART: KH domain protein; SPTR:
FT                   Polyribonucleotide nucleotidyltransferase; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase; PFAM: KH domain;
FT                   S1 RNA binding domain; 3' exoribonuclease family, domain 1;
FT                   3' exoribonuclease family, domain 2; Polyribonucleotide
FT                   nucleotidyltransferase, RNA binding domain; TIGRFAM:
FT                   polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33004"
FT                   /db_xref="GOA:E4TZ05"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ05"
FT                   /protein_id="ADR33004.1"
FT                   /translation="MKYNVELTLQNKTEAYAFNQVAAQANGAAWLKCGDTVILATVVID
FT                   ETDFVDEDFLPLTVQYIEKSYAAGKFPGGFIKRETKPSDFETLTSRIVDRSLRPLFPKG
FT                   FANPVQITVMVLSADREADLQVLALNAASAALYVSDIDIFNSVSAVRVGKIDGEIVFNP
FT                   TLSQLQKSTLDLYLAGSKEDMLMIEMQTLGSDEVEILDIGIIDPLVDPAMSTPSVAVRR
FT                   SNAMSEDELIRILASAQIALSEANSAYESAFKSYAKPPFELQTIVSEISGEMIEYVRSV
FT                   HTDDLKRGINQMAKTERSTALRTIRKTILKEKPEWNEHELKKAIESVKRSMVRAQILDE
FT                   KVRADGRALNEVRPISIETNVLPSAHASALFTRGQTQALVVLTLGGAKDAQMFENLTDS
FT                   GTQNEGFMVHYNFPGFSVGEPSPIGAPRRRELGHGNLAKRALEGACVRNGQTIRLVSEV
FT                   LESNGSSSMATVCGGYMALRAGDIEVADPIAGVAMGMVQEGSRHAILTDIMGLEDHDGD
FT                   LDFKVAGSKGGITAMQMDIKLGGIHLDVLKEALYQAKEARSHIIDIMISSEDKIELNEG
FT                   TLPSTDLFHIDPSFIGDIIGQAGKTIREIIERFDVTIDIDKKKGSVKLTGKNRDGLRGA
FT                   RDHIEGIVSGATPVEKVEYKVGDVVKGKVKKIVDFGAFIELPGGVDGLIHISKLSDGHV
FT                   SRVSDVVNEGDELMVEIVEFKGNKIGLGRAK"
FT   gene            336339..336716
FT                   /locus_tag="Sulku_0338"
FT   CDS_pept        336339..336716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0338"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="InterPro IPR005953: IPR002379: IPR000454: IPR020537;
FT                   KEGG: tdn:Suden_0429 F0F1 ATP synthase subunit C; PFAM:
FT                   H+transporting two-sector ATPase C subunit; SPTR: ATP
FT                   synthase C chain; TIGRFAM: ATP synthase F0, C subunit;
FT                   PFAM: ATP synthase subunit C; TIGRFAM: ATP synthase, F0
FT                   subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33005"
FT                   /db_xref="GOA:E4TZ06"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ06"
FT                   /protein_id="ADR33005.1"
FT                   /translation="MKKVFFLMLALVASVFGADEAVAAVETAVEAAPAVAAASADVANQ
FT                   TLKAYSMIAAGVGLGLAALGGAIGMGSTAAATIAGTARNPGLGGKLMTTMFIALAMIEA
FT                   QVIYTLVIALIALYANPYLAA"
FT   sig_peptide     336339..336410
FT                   /locus_tag="Sulku_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            336764..336848
FT                   /locus_tag="Sulku_R0011"
FT   tRNA            336764..336848
FT                   /locus_tag="Sulku_R0011"
FT                   /product="tRNA-Leu"
FT   gene            336975..337322
FT                   /locus_tag="Sulku_0339"
FT   CDS_pept        336975..337322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1089 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33006"
FT                   /db_xref="InterPro:IPR013502"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ07"
FT                   /protein_id="ADR33006.1"
FT                   /translation="MAYITQLKHLIQNELIPDVEEHIDDIFESIASQKDATVEERAQLE
FT                   DMQALRDEYKDLLKELNSGDIDEEEAEQLYTELTSMREGEGDEDDDYFDEEDEDEDDYD
FT                   EFDLEDEDNQY"
FT   gene            337322..338065
FT                   /locus_tag="Sulku_0340"
FT   CDS_pept        337322..338065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0340"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG0847 DNA polymerase III epsilon subunit and
FT                   related 3'-5' exonuclease; InterPro IPR013520: IPR006055;
FT                   KEGG: tdn:Suden_1790 exonuclease; PFAM: Exonuclease RNase T
FT                   and DNA polymerase III; SMART: Exonuclease; SPTR:
FT                   Exonuclease; PFAM: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33007"
FT                   /db_xref="GOA:E4TZ08"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ08"
FT                   /protein_id="ADR33007.1"
FT                   /translation="MAKYILLDTETTGAGDDDRIIQLGYMVLDGKNVEVYNEMCSTEVA
FT                   ISYGAMEVHGITPEMIEGKPSCRETSAFQKLCELNTSDNVLIIHNAPFDLGMLTKENFS
FT                   SQMRLIDTLRCARHLFDEEESHRLQYFRYRLGLYKIEQDEAESLGIEVKAHDAIGDVLV
FT                   LKLFLTELRKRLQERYEGANPIDKMVELTKTPVFYTRALKFGKYKGKTLTEIADMDKGY
FT                   LNWMLGNMDSLDEDMRYSIERVLTS"
FT   gene            complement(338079..338513)
FT                   /locus_tag="Sulku_0341"
FT   CDS_pept        complement(338079..338513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC13293 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33008"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ09"
FT                   /protein_id="ADR33008.1"
FT                   /translation="MIDALQEHRLHYQETLFNAVNPYHYRFTRYHANYSVVLAYISEES
FT                   GDLTACGDYLRGSDSIIYFRSNFCAIIFDSTNEEQGIKAANNVFSRVQARFFSKHFYMT
FT                   VITATDEKSEFQMIHDLFDLMSYALEHNMDNLVLDSSQVI"
FT   gene            complement(338588..338848)
FT                   /locus_tag="Sulku_0342"
FT   CDS_pept        complement(338588..338848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0342"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="InterPro IPR006597; KEGG: sun:SUN_2411 hypothetical
FT                   protein; PFAM: Sel1 domain protein repeat-containing
FT                   protein; SMART: Sel1 domain protein repeat-containing
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: Sel1
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33009"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ10"
FT                   /protein_id="ADR33009.1"
FT                   /translation="MDDLFAGIAAYDAGDYTKAHEILYPLAAYKRDPEAQFHMGMIYFY
FT                   GEGVEKDIDKAMEWWKKAMRNGHVDAAYRLSEIATSTKTTF"
FT   gene            338918..340174
FT                   /locus_tag="Sulku_0343"
FT   CDS_pept        338918..340174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1783 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ11"
FT                   /protein_id="ADR33010.1"
FT                   /translation="MRAMNYNELSGKSILLLGKTRALNAEEFDTLLKLHKIERAEHCNH
FT                   DVALIIEGRMMNPYEQEELAHLYETQQIPIVELSTIEEWLCRSIEPNRLLMSLKLSRNQ
FT                   ERLVDFLQNPYISDTLFFKLLKLYDWQNEGLFDNDMNRDVTASIIGRFYEDLDRNHNVQ
FT                   YAMSGLAHLIERYGNADLIDAIADISPISRELKNPSDRSLTGILDAMALHSDTSEPILR
FT                   LLMSGRAKLLAHREPLGLENELLMLGDEEVNTILSQNRTLSKEGADVLEASHPHLIASN
FT                   TVLCDTRFDRLIGKYASYLASNPSLSPAMQQRLFESKDGNVLDVLASNPIIQREILDRL
FT                   FESGRFSMQLAKNSALSQENIKILFLRGESEVLSALAANVSTPIEILYQLSLDQRFERR
FT                   VKTNPAFGKYIQTHNIGWS"
FT   gene            340174..341166
FT                   /locus_tag="Sulku_0344"
FT   CDS_pept        340174..341166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0344"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011703;
FT                   KEGG: tdn:Suden_1782 ATPase; PFAM: ATPase associated with
FT                   various cellular activities AAA_3; SPTR: ATPase associated
FT                   with various cellular activities, AAA_3; PFAM: ATPase
FT                   family associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33011"
FT                   /db_xref="GOA:E4TZ12"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ12"
FT                   /protein_id="ADR33011.1"
FT                   /translation="MRTKDTIETMRSLIDSKIPTFLWGAPGIGKSSIIKQIAHENGIEC
FT                   IDLRLSLMDPTDLKGIPFYERDTHSALWAPPSFLPRDGRGILFLDELNSAAPAVQASAY
FT                   QLILDRKVGEYTLPEGWAIVAAGNREGDRGVVYRLPSPLANRFVHIEMEVNAADWRDWA
FT                   LSRGIDERVVAYIGFKNSALFGFDPLKNERSFATPRSWEAVHTIVNSSLSKTLWLEAIG
FT                   GAVGEDAAVDFLGFCQVMDKLPDVDAILKGEDAEVSEDLSTLYALSSALVSRVLVSSSD
FT                   EALSNLLRYSLKLKNEFAVMIIQDLQRQGVAMEHLDAFGEWVEAYAYLL"
FT   gene            341163..342239
FT                   /locus_tag="Sulku_0345"
FT   CDS_pept        341163..342239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0345"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3864 conserved hypothetical protein; KEGG:
FT                   tdn:Suden_1781 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted metallopeptidase
FT                   (DUF2201)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33012"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ13"
FT                   /protein_id="ADR33012.1"
FT                   /translation="MIDFSPLKAKLLLEYPFFGTIASGMEMVLNDNIESFAVRDNTIEY
FT                   REGYIEPLSSNERLFILCNGALHEALSHTLRRGNRSPWLWSMACDYAINALLIDNGFTP
FT                   PAKITYDKRFGNLSAEEIYAELAMEFLDQEQNDRDSDDRRDGESADEKLSRAQRERRTR
FT                   EAMEKDDPLCEAFTRQFGIHSKSRIDWRSELRDCIGGHYISDYTLVPPSKKLLYEGIYL
FT                   PGSSSRHLELAIAIDSSGSVDEVLLSCFIAEVESIMETFGSYTIDLLVCDDRIRSHTRF
FT                   ENGEHIEYVLNGGGGTDFRAVFELIESWMQRPKVLLYFTDLDGKFPLYEPPYEVLWIAP
FT                   QLADVPFGRVVVLKDENG"
FT   gene            342232..343470
FT                   /locus_tag="Sulku_0346"
FT   CDS_pept        342232..343470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0346"
FT                   /product="AAA ATPase"
FT                   /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease V)
FT                   alpha subunit - helicase superfamily I member; InterPro
FT                   IPR003593; KEGG: tdn:Suden_1779 ATPase; SMART: AAA ATPase;
FT                   SPTR: ATPase; PFAM: PIF1 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33013"
FT                   /db_xref="GOA:E4TZ14"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ14"
FT                   /protein_id="ADR33013.1"
FT                   /translation="MVENALKILETSNLFITGGAGSGKTTLTRALIDDAVQKGKSVARL
FT                   ASTGMAATLIGGQTLHSFFDLGIANSQQELERNGKLEPAKKIIKLIRSMQIIVIDEISM
FT                   VGAQLLDMIRLRLLQAEFSGRLIVVGDFLQLPPVTRGIEPIYFAFESPSWERFGFETIH
FT                   LEGSYRTHEAEFLSLLEQVRHARIDEAAINALDELVKPLSEDMSSVTLLFGKNISAQNH
FT                   NRSQLEHLHGDIVELSTYVTIHDKKMQERDIERFMVESRIEPALALKVGAPILFTRNAW
FT                   NYYNGERGMITSIEEDVIWVKKSDGVSVKVERVDTIKTRWVEKGNTASEEKLISLSQFP
FT                   ITLAFAITIHKSQGMSLADYVIETNEIFAPSQFYVALSRSVSAHRVTLIRPNRGWEKLC
FT                   FVHPKAKRFSDSV"
FT   gene            complement(343727..344473)
FT                   /locus_tag="Sulku_0347"
FT   CDS_pept        complement(343727..344473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0347"
FT                   /product="Conserved hypothetical protein CHP00245"
FT                   /note="COGs: COG0390 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR005226; KEGG:
FT                   pmx:PERMA_1353 hypothetical protein; PFAM: Conserved
FT                   hypothetical protein CHP00245; SPTR: Putative membrane
FT                   protein; PFAM: Uncharacterised protein family (UPF0014);
FT                   TIGRFAM: conserved hypothetical protein TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33014"
FT                   /db_xref="GOA:E4TZ15"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ15"
FT                   /protein_id="ADR33014.1"
FT                   /translation="MQYSFLASYLLIVFALWYSRREQFGLEKMILTNSILAMVQLGLLG
FT                   YALVYLFQMQHPALLFFVLLGMVTFGAYTAKKRAPLGEHSFKIALFSLGASSGIVFLSM
FT                   MAFGVIHIVPHEMIPIGGMIIGNALNVYSQSIERFRAEVKNTIETIEGMVALGAPLKEA
FT                   LSFASKASVKASMIPTLNMLQTVGIIHIPGITTGMLLAGADPLKAISYQLAVMYMMVAV
FT                   ALLSAVFSVMFSYRLIVGAAFDKSKS"
FT   sig_peptide     complement(344429..344473)
FT                   /locus_tag="Sulku_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(344650..345246)
FT                   /locus_tag="Sulku_0348"
FT   CDS_pept        complement(344650..345246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0348"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="COGs: COG0450 Peroxiredoxin; InterPro IPR000866:
FT                   IPR019479: IPR017936; KEGG: sdl:Sdel_0223 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen; PFAM: alkyl hydroperoxide reductase/ Thiol
FT                   specific antioxidant/ Mal allergen; Peroxiredoxin-like;
FT                   SPTR: Alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; PFAM: C-terminal domain of 1-Cys
FT                   peroxiredoxin; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33015"
FT                   /db_xref="GOA:E4TZ16"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ16"
FT                   /protein_id="ADR33015.1"
FT                   /translation="MLVTKKAPDFTATTVLGNNQIVDNFNLYENLGEKGAVLFFYPLDF
FT                   TFVCPSEIIAFDHRLEEFTARGINVIGVSVDSQFSHFAWKNTPVKEGGIGQVRYPLVAD
FT                   LNKQISRDYDVLLGDSVALRGSFLLDKDGTIRHAVINDLPLGRNIDEMLRMIDAMLFTN
FT                   EHGEVCPAGWAKGDAGMKASTEGVAEYLSAHAETL"
FT   gene            345409..347175
FT                   /locus_tag="Sulku_0349"
FT   CDS_pept        345409..347175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0349"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1132 ABC-type multidrug transport system
FT                   ATPase and permease components; InterProIPR001140:
FT                   IPR003439: IPR017871: IPR003593: IPR 017940; KEGG:
FT                   abu:Abu_1106 ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase; SPTR: ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter transmembrane
FT                   region; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33016"
FT                   /db_xref="GOA:E4TZ17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ17"
FT                   /protein_id="ADR33016.1"
FT                   /translation="MITFKTLFGMMLRYKRSLFWGNVIAIIATLVSIPIPLLIPLMVDE
FT                   VLLEKGGTVTGVIDQLSSAHDPLIYIGIVLAVTITLRFLFFILSVVSQKFFITLSQELS
FT                   FTIRVRALEHLKHVSMSSYERLGSGKVITHLITDIDTIEQFLGSALSKLIVSVATLIGV
FT                   AVVLIWINPLFGILILIFQPLIMLVTRKISGRVGMLKKEQNRTIGELSDTLTQMCDLFG
FT                   QIRASNKEERFIDNAIDHSKRLRQSASEYGIKALMGERYSYTLFLSGFEIFRALGLVMV
FT                   LYSHLSIGLMFGIFGYLWFMMTPVQDLLSLQYSFANAKNALQRLNELLSLPTEPTANVS
FT                   AQSISASGPLSIHTENLVFGYDEKEPVLRGVNLDIHAGSTVAIIGASGSGKSTLSQLLV
FT                   GFYPPTSGDIFYNGVSVRDIGFPNVRDAVFVVLQQPLMFNDTLRFNLTMGDEIRDDEIQ
FT                   KALEIAQLSEFVSTLPDGLNTQVGKFGIRLSGGQRQRLSIARMVLAKPKAVIFDESTSA
FT                   LDVHTESKLFEALEAFLKDKTVIIIAHRLSTVTRADYIYVLENGIILEEGTRDVLEAID
FT                   GSYKRFINSQHG"
FT   sig_peptide     345409..345483
FT                   /locus_tag="Sulku_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            347185..348252
FT                   /locus_tag="Sulku_0350"
FT   CDS_pept        347185..348252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0350"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549:
FT                   IPR020606; KEGG: sdl:Sdel_1219 protein of unknown function
FT                   UPF0118; PFAM: protein of unknown function UPF0118; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33017"
FT                   /db_xref="GOA:E4TZ18"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ18"
FT                   /protein_id="ADR33017.1"
FT                   /translation="MQQNNFLRWMSFGIFVLILWLFSPFLKSFFVALLLAMAVSPLYRS
FT                   IKSRIDRYPALVSVASLVSASIVSIGLSLIIFLPIAIFLYQILDNPAKTLDMIRMIGNK
FT                   IDSPYLNLPTFLQWLSDPLYNLLTQIRNHKDEIIAFLAGWFGSGIKTFASMLGEMAMIV
FT                   IFFFFLTWYGRRLLLFLLPIIPLPRSIKRDFLDEMTIMSAVVFYTLVGVMIAQGLAFGI
FT                   FIAFFEGYNPLLLGFLTGISAIIPVVGTALVWIPVAVHEYMSGNIVNAFIISLYSWAMM
FT                   AFFIDNIVKLVILNFVNRSLSIGKRRINEFVIFFAIVGGLATFGFWGFILGPAIVAFAM
FT                   TTLRTLRKTNRVLLP"
FT   sig_peptide     347185..347298
FT                   /locus_tag="Sulku_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(348272..348580)
FT                   /locus_tag="Sulku_0351"
FT   CDS_pept        complement(348272..348580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saf:SULAZ_1614 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33018"
FT                   /db_xref="GOA:E4TZ19"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ19"
FT                   /protein_id="ADR33018.1"
FT                   /translation="MNQDNTLSFIVGAALGGIAGYFLFKHQDQIVDKIHELEGNLNIDH
FT                   NALIDKAKHKLDALTQNVQSTIERYTHGSEDKSTDEITSIMAELAKLREEVRELKAI"
FT   gene            complement(348590..348994)
FT                   /locus_tag="Sulku_0352"
FT   CDS_pept        complement(348590..348994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sga:GALLO_1534 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33019"
FT                   /db_xref="GOA:E4TZ20"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ20"
FT                   /protein_id="ADR33019.1"
FT                   /translation="MSEIGLLTVFVGIIALCMVIITSVVIFIGIQSSKTMQKSQELMAH
FT                   LQNELSFLATKAALTLHEVNELIGHLKEETKALSDKSKLSLHELHDLISYLHDETKTLA
FT                   LKASNGIAKVTIGSLAIGAISQFFKKKNNS"
FT   sig_peptide     complement(348896..348994)
FT                   /locus_tag="Sulku_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            349133..349777
FT                   /locus_tag="Sulku_0353"
FT   CDS_pept        349133..349777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0353"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: seh:SeHA_A0032 ParA protein homolog;
FT                   SPTR: Partitioning protein, putative; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33020"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ21"
FT                   /protein_id="ADR33020.1"
FT                   /translation="MILTLSHQKGGVGKSTVAWNLAVYFSGIMDTRIVDLDTQRSLTVT
FT                   NALRKEHNLPSIKMIHFNTAEELAEYAAADSDDVLTIIDSGGFDSAFNRIAIIASDLLI
FT                   TPVSDKPFDLMGLQKYEEILKSLSVIQGETIKTHVLFNNINPAMKRFGELVDFICTSEH
FT                   FELMVSILRQRVDIAHSVGEGKSIKEYRIFSKADQEMDDLIVEVKSILNIK"
FT   gene            349818..350039
FT                   /locus_tag="Sulku_0354"
FT   CDS_pept        349818..350039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cro:ROD_p1521 hypothetical protein; SPTR:
FT                   Merozoite surface protein 3b"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33021"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ22"
FT                   /protein_id="ADR33021.1"
FT                   /translation="MAKKSFLQNIEKVKSSAAMSEREESAKSDKEKKKKLITIPTQWEE
FT                   KIREYHGGTVSAYILIALQERMQRDGLI"
FT   gene            350483..351859
FT                   /locus_tag="Sulku_0355"
FT   CDS_pept        350483..351859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0355"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterProIPR000014:
FT                   IPR000160: IPR013655: IPR001610: IPR 000700; KEGG:
FT                   abu:Abu_0739 GGDEF/PAS domain-containing protein; PFAM:
FT                   GGDEF domain containing protein; PAS fold-3 domain protein;
FT                   SMART: GGDEF domain containing protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: GGDEF/PAS domain protein; TIGRFAM: diguanylate
FT                   cyclase; PAS sensor protein; PFAM: GGDEF domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box; diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33022"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ23"
FT                   /protein_id="ADR33022.1"
FT                   /translation="MIKIINSEEFSYFLRVHRNKIIKIWMEKSEVQNVLHRHSLPIIDK
FT                   NTYLFYQFCDCFISVIEWRSTISECQIKIDFLQLLNNYNVTVADLFTLVFKLKNAIEQV
FT                   IFENGNLSYALQSEIDSLTLQMAIDLELNFETIINSNQNYKSENSNLLTEYKKAVDLSN
FT                   IVSKTNPKGIITYVNDKFCEISGYSRDELIGKPHNIIRHPDMPREAFKELWDTIKAKKS
FT                   WSGVVTNMKKDGGQYIVDTTVIPILDVDGDVVEYIAIRHDITELEQTKQQLRNINKAMK
FT                   NKVDELYSMTNTLEQKAYKDKLTGINNRENFEDIFALEIATAKQNNIPLSLVIFDVDNF
FT                   KLVNDTYGHQAGDTILIDLVKLIEDNIKNGDIFARWGGEEFVILTPSTDINGACNLAEN
FT                   LRKLVQLHPFSYVENQMTLSFGVAQLSDDDNKKTLFEKADGALYEAKKNGRNRVEGCKV
FT                   "
FT   gene            complement(351862..352392)
FT                   /locus_tag="Sulku_0356"
FT   CDS_pept        complement(351862..352392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_0519 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33023"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ24"
FT                   /protein_id="ADR33023.1"
FT                   /translation="MNKIVLILLIPLLLYGTTYDATLLQIGAKIFPKVALMEKGTKERI
FT                   QSTVNFVIVASPSNKAAAQRLSEIIEHQYNGILADHPLALFVVSPKEALEIKNAHSFVL
FT                   LMDPDDSILPMVLEHAAKTKTLTFSFDPLLLQKGAAVSLYIGRSVKPYINLATLKQVPF
FT                   TFEYGFLKLSQPY"
FT   sig_peptide     complement(352339..352392)
FT                   /locus_tag="Sulku_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(352389..353819)
FT                   /locus_tag="Sulku_0357"
FT   CDS_pept        complement(352389..353819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0357"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR003594: IPR004358: IPR005467; KEGG: abu:Abu_0455
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33024"
FT                   /db_xref="GOA:E4TZ25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ25"
FT                   /protein_id="ADR33024.1"
FT                   /translation="MTQTLIGKFAWVFWLLYIAVIAPIYIFVQVNVSSVLNESEKAKIE
FT                   LIIQTLKPIISTYLTFDQTDMLNDTMRTFFQNPNIKDVSLVDVNQNIIFERHYPHSNIH
FT                   KTITLTTPVIDSITHQTQATLIISYSNNFVHDLQYKLFTQLIVLSLFALLIFTITYIYF
FT                   RKQFFVLRLLANWMGDYSIHKASEPFKSDNNNTEILTITSSANKMVETIEDYRVQMEEI
FT                   NNELEMRVENEIIQRREKEQLLIHQSRLAAMGEMIESIAHQWRQPLNIIGLAVADMNMK
FT                   RALGSLGEQELEKNTAIIDNNLQFMSNTIDDFRNFFNMDKESLNFSPVQPIHEIFSLLD
FT                   EQLRYANITYLIHENCNQEIFGVVNEFKQVILNIINNAQDAIKSRKNQIGGKIEITLRC
FT                   DINYLYIDISDTGGGVPIKIVERIFEPYFTTKLHNKGTGIGLYMSKVIIEQHFEGSLSV
FT                   SNTDDGALFTITMPLKHT"
FT   sig_peptide     complement(353751..353819)
FT                   /locus_tag="Sulku_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(353962..356094)
FT                   /locus_tag="Sulku_0358"
FT   CDS_pept        complement(353962..356094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0358"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG4206 Outer membrane cobalamin receptor
FT                   protein; InterPro IPR012910: IPR000531: IPR006162; KEGG:
FT                   alv:Alvin_0601 TonB-dependent receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   SPTR: TonB-dependent receptor; PFAM: TonB-dependent
FT                   Receptor Plug Domain; TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33025"
FT                   /db_xref="GOA:E4TZ26"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ26"
FT                   /protein_id="ADR33025.1"
FT                   /translation="MNITLILILFQYGAKLKHLSVFCISLLFSHSLLLAESSDDLDKVL
FT                   EEATTIATKTKLNADYVPGTVTVISSEKLKSLGITNLAEQNAFDMIVGFDSSTLSLRGS
FT                   GSIYGAEGNKIKWMINDKPISAEIWGIPKLGVGQIVFPIPTDAIDRIEIIRGPGSAIYG
FT                   GNAIYGVVNIITKKETGTLFTTLSQMQSNKFGKALGGYTSFRQNDLEASAIISAEKSDG
FT                   WDLPITTQAPAGSGNLPNAYGNSLIMADVSYKNFDFWAYKLKAKNDYARLQWDPSNFLP
FT                   QDNTEPVQSNTYTMLGVQGKFEITSNLLLTAKAGINQYENNADVMFFPSYLLGSNPSNL
FT                   DGVRKIDYRESTKYLEGMVETTIGSNRLLGGAYAGFLSVDQDDVTQMWSRVSGRTVYNP
FT                   SGTSTHLLTTNNPKRINRALYLQDEIQLDEQSTVTVGARYDTYSDGREALSPRIALVYQ
FT                   YDESNILKAQYSRAFRPPSFSEQYSPNNQASHTDYESETTDTIELSYIFKTKGSSLKTT
FT                   VFNTRTANMITYHDFTYETINLESPTTVNGLEIELSQNYESLALGANLSFYKSRRGDVE
FT                   LTRAGSTLNYDSSEFALSAKFIGNLFATLNSDTPYPTTVWYHYTGNKHRVNNETLDENG
FT                   NVKGIYTTNGSTPVQDYVNITQKINGIAKDLDLEFGVKNLFGKTLKTLYFPLNPPNTSD
FT                   IPYMKQTFWVNLLYRF"
FT   sig_peptide     complement(355984..356094)
FT                   /locus_tag="Sulku_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(356324..356647)
FT                   /locus_tag="Sulku_0359"
FT   CDS_pept        complement(356324..356647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_02386 hypothetical protein; SPTR:
FT                   Binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ27"
FT                   /protein_id="ADR33026.1"
FT                   /translation="MNTRGTSIRQVALMSFGSDEVEAMESLNTLWVQTMDLKHENALVY
FT                   PLDIMVEHIGELYPLKYIDKDNFSTYEAENGSEWLISKSLHINDIDAFFKVYLHLSDEE
FT                   AAA"
FT   sig_peptide     complement(356579..356647)
FT                   /locus_tag="Sulku_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(356835..356910)
FT                   /locus_tag="Sulku_R0012"
FT   tRNA            complement(356835..356910)
FT                   /locus_tag="Sulku_R0012"
FT                   /product="tRNA-Phe"
FT   gene            complement(356966..358174)
FT                   /locus_tag="Sulku_0360"
FT   CDS_pept        complement(356966..358174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0360"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR005762: IPR013221: IPR004101: IPR018109; KEGG:
FT                   tdn:Suden_1616 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase; PFAM: Mur ligase middle domain protein;
FT                   cytoplasmic peptidoglycan synthetase domain protein; PRIAM:
FT                   UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase; SPTR:
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33027"
FT                   /db_xref="GOA:E4TZ28"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ28"
FT                   /protein_id="ADR33027.1"
FT                   /translation="MKNQNIACFGYGKTTRAIAKLLGPCTFFDDKITVPSVDEDGNALK
FT                   PVSEFDTRLFTHEIPSPGFPPSHPLIQKAQHLISEYDFFAPNIPFSIWISGTNGKTTTT
FT                   QMVEHLLADKGSISGGNIGTPLAEMSPDAPIWILETSSFSMHYTDIARPNIYALLPVTP
FT                   DHVSWHGSMQAYYDAKLKPLSMMKEGEAVILPKMFADTPTKAFKIIYEDEKDLAKYFGF
FT                   DANKIKFKGAFLMDAMIAMGIDKILYDRCDYDRINAFVLDPHRQEEFRDSRDRLWINDS
FT                   KATNIDATLAALRTYGSYPIHLVLGGDDKGVELEELFTPLKRYDVSVYAIGSNALRLEA
FT                   LCKQYDIPCTLCHTLDVAVEEISKKHNRHSIAMLSPAAASLDQFTSYAQRGNLFRDLAK
FT                   ATK"
FT   gene            complement(358174..359232)
FT                   /locus_tag="Sulku_0361"
FT   CDS_pept        complement(358174..359232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0361"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR003524: IPR018480: IPR018481;
FT                   KEGG: tdn:Suden_1615
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region;
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase,
FT                   conserved site;
FT                   SPTR:Phospho-N-acetylmuramoyl-pentapeptide-transfer ase;
FT                   TIGRFAM:phospho-N-acetylmuramoyl-pentapeptide-trans ferase;
FT                   PFAM: Glycosyl transferase family 4;
FT                   Phospho-N-acetylmuramoyl-pentapeptide-transferase signature
FT                   1; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33028"
FT                   /db_xref="GOA:E4TZ29"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ29"
FT                   /protein_id="ADR33028.1"
FT                   /translation="MLYWFHKALGINLFQYITLRAGVAFFIGLLLTLFFMPRFIAWAQR
FT                   SARVQPINEYVSAHQGKAKTPTMGGIVFVASTIIASLLTVNIMNPFVIGALLTLVFYAY
FT                   IGFTDDWGKIRGGHNLAGLSARAKMALQLIFGLAIGVFLIHYAKLETGFYVPFIKSSLF
FT                   DMGWGSIIFWVLVMIATSNAVNLTDGLDGLATVPSIFALLSLSIIVYIVGNAALAHYLL
FT                   MPKIPAGEVVIIAMALIGSLLGFLWFNCHPAQVFMGDSGSLTIGAFIAYMAIIGKSEIL
FT                   LILIGLIFVIETVSVILQVGSYKLRKKRVFLMAPIHHHFEMKQWAENKIIVRFWIISLL
FT                   SNIFALITLKIR"
FT   sig_peptide     complement(359104..359232)
FT                   /locus_tag="Sulku_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            359328..360803
FT                   /locus_tag="Sulku_0362"
FT   CDS_pept        359328..360803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0362"
FT                   /product="phosphoglycerate mutase"
FT                   /note="COGs: COG0696 Phosphoglyceromutase; InterPro
FT                   IPR005995: IPR011258: IPR006124; KEGG: tdn:Suden_1614
FT                   phosphoglyceromutase; PFAM: BPG-independent PGAM domain
FT                   protein; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: Metalloenzyme
FT                   superfamily; BPG-independent PGAM N-terminus (iPGM_N);
FT                   TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33029"
FT                   /db_xref="GOA:E4TZ30"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ30"
FT                   /protein_id="ADR33029.1"
FT                   /translation="MSKKTVLVITDGIGYSPKHDFNAFHAAKKPTYDRLFSEVPHSLID
FT                   TFGLSVGLPEGQMGNSEVGHMSIGSGRVLYQDLVKISLALEEGTFEHNEVFTSLLKTSK
FT                   RLHLIALMSDGGVHSHIDHLIGVSEIAADMGKEVWLHLITDGRDVAPTSAKLFLNTIEA
FT                   HGSANIKIGSLGGRFFAMDRDNRWDRVQKGYEAIMSALPQSEQSVADYIENAYASGETD
FT                   EFITPTSFYGYEGVKEGDAVLMLNFRSDRMRELTTAIGDPEFNGFKRVFVPTHLATVTQ
FT                   YDKSFPYPVLFPKDAPVNTLAEVISKAGLRQLHTAETEKYAHVTFFFNGGIEEPYENET
FT                   RVLIPSPQVKTYDMQPQMSAPEVGSAVVKAMDEGIDFVVVNFANGDMVGHTGNFEAAIS
FT                   AVEAVDHELGRIVEAAQKNGYSMVLTSDHGNCEEMRDDAGNILTNHTVGKVWCFVMAEG
FT                   VSEVHPGALNNVAPTVLKLMELDIPSEMDTPLI"
FT   gene            360874..361617
FT                   /locus_tag="Sulku_0363"
FT   CDS_pept        360874..361617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0363"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR011284: IPR002198: IPR002347:
FT                   IPR020904; KEGG: tdn:Suden_1613
FT                   3-ketoacyl-(acyl-carrier-protein) reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR:
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33030"
FT                   /db_xref="GOA:E4TZ31"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ31"
FT                   /protein_id="ADR33030.1"
FT                   /translation="MKFSGKNVLVTGSSRGIGAEVAKVLALYGLKVWINYRSGAAAADA
FT                   VKAQIEAAGGQAAVIGFDVADEAAFVDAIKTIIDADGELSYLVNNAGITKDALALRMKS
FT                   DDFMAVINANLLSAFVGCREAFKAMRKQKFGAIVNIASIVGETGNAGQTNYAASKGGVI
FT                   AMTKSFAQEAASSGIRYNTVTPGFIATDMTDVLSEEIKASFTSKIPMGRFGNAAEVAEA
FT                   TAFLLSDHSSYITGETLKVNGGMFM"
FT   gene            361699..361929
FT                   /locus_tag="Sulku_0364"
FT   CDS_pept        361699..361929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0364"
FT                   /product="acyl carrier protein"
FT                   /note="InterPro IPR003231: IPR006163: IPR006162: IPR009081;
FT                   KEGG: tdn:Suden_1610 acyl carrier protein (ACP); PFAM:
FT                   phosphopantetheine-binding; SPTR: Acyl carrier protein;
FT                   TIGRFAM: acyl carrier protein; PFAM: Phosphopantetheine
FT                   attachment site; TIGRFAM: acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33031"
FT                   /db_xref="GOA:E4TZ32"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ32"
FT                   /protein_id="ADR33031.1"
FT                   /translation="MALLEDIKEVVVEQLSVNPDEVKENSKFVEDLGADSLDVVELVMA
FT                   LEEKFDIEIPDDEAEKIQTVQDVINYIESKN"
FT   gene            362041..363258
FT                   /locus_tag="Sulku_0365"
FT   CDS_pept        362041..363258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0365"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase; InterProIPR017568: IPR014030: IPR014031:
FT                   IPR017441: IPR 018201; KEGG: tdn:Suden_1609 3-oxoacyl-(acyl
FT                   carrier protein) synthase II; PFAM: Beta-ketoacyl synthase;
FT                   SPTR: 3-oxoacyl-(Acyl-carrier-protein) synthase 2; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2; PFAM:
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain; TIGRFAM:
FT                   beta-ketoacyl-acyl-carrier-protein synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33032"
FT                   /db_xref="GOA:E4TZ33"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ33"
FT                   /protein_id="ADR33032.1"
FT                   /translation="MRRVVVTGMGMINALGHDKESSFKAICDGECGIDMITIFDASTQS
FT                   AQIAGEVKNFDPETVMDAREVKKADRFIHLGIKAAQEAMADANFPEGFDKERFGIDAAA
FT                   GIGGLPSIEKNSIILETKGARRISPFFIPGALVNMLGGFISIDHGLQGPNLSAVTACAA
FT                   GTHAISEAAKTIMVGGADQMLVVAAESAITGVGIGGFASMKALSTRNDDPKHASRPFDA
FT                   DRDGFVMGEGAAALVLEEYDAAVARGARIYAEVIGFGESGDANHITTPSLEGPLRAMKA
FT                   ALKMAGNPKVDYVNAHGTSTPTNDKNETAALKIAFGSKENCPPVSSTKGQTGHCLGAAG
FT                   GIEAVISIMAMRDGIIPPTINYVNPDENCDLDIVPNTARKAELNIVMSNSFGFGGTNGV
FT                   VIFKKI"
FT   gene            363271..364206
FT                   /locus_tag="Sulku_0366"
FT   CDS_pept        363271..364206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0366"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR001095: IPR020582: IPR011763; KEGG:
FT                   tdn:Suden_1608 acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha; PFAM: Acetyl-CoA carboxylase, alpha subunit,
FT                   conserved region; PRIAM: Acetyl-CoA carboxylase; SPTR:
FT                   Acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   alpha; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: Acetyl co-enzyme A
FT                   carboxylase carboxyltransferase alpha subunit; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33033"
FT                   /db_xref="GOA:E4TZ34"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ34"
FT                   /protein_id="ADR33033.1"
FT                   /translation="MATYLDFEQNIRQIQEEIIAAEVRYDHHAVEILKQDLDKEVQKTY
FT                   ANLSPYQELQLARHQDRPYALDYINLILDKKYEIHGDRHFRDDLSIICYIGTIGDERVM
FT                   VIGEQKGRGTKNKLKRNFGMPHPEGYRKALRAAKMAEKFNIPLLMLIDTPGAYPGLGAE
FT                   ERNQSEAIARNLLELSNLNTITVSVVIGEGGSGGALAIGVADRLAMMRYSVFSVISPEG
FT                   CSAILWNDPTKVEAATKALKITSADLKELDLIDDIIDEPLIGAHRDKEGSANALKSYFM
FT                   TQVNTLRKLSDSERLDKRYNRLVGMGRFSE"
FT   gene            complement(364247..365050)
FT                   /locus_tag="Sulku_0367"
FT   CDS_pept        complement(364247..365050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0367"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="COGs: COG2176 DNA polymerase III alpha subunit
FT                   (gram-positive type); InterPro IPR013520: IPR006055; KEGG:
FT                   tdn:Suden_1607 DNA polymerase III subunit epsilon; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease; SPTR: Exonuclease; PFAM: Exonuclease; TIGRFAM:
FT                   exonuclease, DNA polymerase III, epsilon subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33034"
FT                   /db_xref="GOA:E4TZ35"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ35"
FT                   /protein_id="ADR33034.1"
FT                   /translation="MKLFDPKILSRLSKNGIPKEEFELLLGSDADLRLELLKSQGMNII
FT                   LHEEMYCFQSAITSVKDTLFCIVDVESNGSKPAHHQIIEIGAVKLQNGKIIDTYESLVY
FT                   CTDISDQIQEITGIKTEQTLKAPAMSKVMREFRLFLGDAIFVGHDAKFDYNFVSAMMER
FT                   VGLSKLLNRSLCTIDLAERTIESERYGLAYLNTALELYKEATHHRALSDAMTTTKLLKR
FT                   VLNLLPSSITNSEELIAFSKEAKRLKRPKPKKEEKKETEEKEAVK"
FT   gene            complement(365047..365634)
FT                   /locus_tag="Sulku_0368"
FT   CDS_pept        complement(365047..365634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0368"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="COGs: COG0135 Phosphoribosylanthranilate isomerase;
FT                   InterPro IPR001240; KEGG: tdn:Suden_1606
FT                   phosphoribosylanthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI); PRIAM:
FT                   Phosphoribosylanthranilate isomerase; SPTR:
FT                   N-(5'-phosphoribosyl)anthranilate isomerase; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate (PRA) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33035"
FT                   /db_xref="GOA:E4TZ36"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ36"
FT                   /protein_id="ADR33035.1"
FT                   /translation="MRVKICGITNIEDALLAINAGADALGFVFYPESPRYIAPENAKAV
FT                   IAALPPFVEKVALFVNETPDVIRSVCLSTGCTLAQIHFDVQDDFFSDVHFPTLRVIRAQ
FT                   KKEDILTYTDEYRLIDAYCEAYGGSGKRLNIEWFEGIDCSKIILAGGLDPENVASLKPY
FT                   GFYGVDVSSGVEASYGKKDHKLVETFIQKAKV"
FT   gene            complement(365631..366272)
FT                   /locus_tag="Sulku_0369"
FT   CDS_pept        complement(365631..366272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0369"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="COGs: COG0036 Pentose-5-phosphate-3-epimerase;
FT                   InterPro IPR000056; KEGG: tdn:Suden_1605 ribulose-phosphate
FT                   3-epimerase; PFAM: ribulose-phosphate 3-epimerase; PRIAM:
FT                   Ribulose-phosphate 3-epimerase; SPTR: Ribulose-5-phosphate
FT                   3-epimerase; TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   Ribulose-phosphate 3 epimerase family; TIGRFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33036"
FT                   /db_xref="GOA:E4TZ37"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ37"
FT                   /protein_id="ADR33036.1"
FT                   /translation="MLVAPSVLSADFGNLARDVRAICDAGCDLVHVDVMDGHFVPNLTI
FT                   GPVVVSAIAKAATKPLDIHLMVQNNTFFVDLFAPLKPEYISFHIEEEKNPHRLIQHIRS
FT                   LGIKPAIVLNPHTPAEAIEYLLGDLDMVLVMSVNPGFGGQKFIPTVVEKIKRLKALRDR
FT                   INPECMIEIDGGVGSSNIAVLKEAGVDICVAGSYVFGADDYKTAIDSLRV"
FT   gene            complement(366339..367733)
FT                   /locus_tag="Sulku_0370"
FT   CDS_pept        complement(366339..367733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0370"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="KEGG: tdn:Suden_1604 CheC, inhibitor of MCP
FT                   methylation; SPTR: CheC, inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33037"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ38"
FT                   /protein_id="ADR33037.1"
FT                   /translation="MRATVKGRIAIFHPQGFLDGNNAPSFLTIDDIHATEALNIDMLLV
FT                   SLKKVIFFNKNGLDVFIRLLDSIRSHKHIAVGLCDYDSAKFVTINKFYGSNLTFSLFRT
FT                   EKIAELFVPTNKNESKTVLLYNEDASQRSAMAIELFDYGHNPVIAQTKKEFEEKKRNPD
FT                   LYYAIIEETYLGLFGQKIATRVTGNAIIYTIANFLDAGITDTFNIAYHNNSLNVGFRLF
FT                   IFDAYKVVSMNVHALNFFTKLASSAAEYNASICFVGMTFEKTPQSFKNDLEDAGIMFFD
FT                   QMEDILKNKELLQELGGSSGTSSKSTRTLTKALIHELPGFIDATVSTIAMMTNAQAIKE
FT                   SMNIQTLEIKNSKEQYASSIGFYGDLDGMIILIFPKKVATKACELLIGEENNDEEAILD
FT                   SLAEFVNIIGGRAKALLGEKKHRVDITLPRTYADVDSLLEMAQNRKGVQVDLRFEGSSF
FT                   IFFLTR"
FT   gene            complement(367717..368526)
FT                   /locus_tag="Sulku_0371"
FT   CDS_pept        complement(367717..368526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0371"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: tdn:Suden_1603 putative signal transduction
FT                   protein; SPTR: Putative signal transduction protein; PFAM:
FT                   HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33038"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ39"
FT                   /protein_id="ADR33038.1"
FT                   /translation="MVTQEQITSYIQNIPPAPFVVKQTLDYVRVGDLTKAAKCAEEDPA
FT                   LKFYLKTLVNRPIYGFRNEVSDLAQIFTILGISTAQQILYNYLLSLLAPKEWGLFKLTS
FT                   QEFYDLQASLSRKWVKILTHLNLHNHDTESAITLLPASIIVCDALFGEYKSEVAQLRSV
FT                   KALDYNTILYRLTKMSLFNICTEIGEKWELSPMISRIVHASSGLDQNLEENEKTLAKWM
FT                   HLLLFYELSQNAYVEAGLNEFIEFQIEFVQDIYESFMQVVEYDESDR"
FT   gene            368688..368876
FT                   /locus_tag="Sulku_0372"
FT   CDS_pept        368688..368876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0372"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="COGs: COG0227 Ribosomal protein L28; InterPro
FT                   IPR001383; KEGG: ant:Arnit_2237 50S ribosomal protein L28;
FT                   PFAM: ribosomal protein L28; SPTR: 50S ribosomal protein
FT                   L28; TIGRFAM: ribosomal protein L28; PFAM: Ribosomal L28
FT                   family; TIGRFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33039"
FT                   /db_xref="GOA:E4TZ40"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ40"
FT                   /protein_id="ADR33039.1"
FT                   /translation="MARKCAISGKGPMSGNNVSHAKNRTKRRFLPNLRTVRVTLEDGTT
FT                   KKLKIAASELRTLKKDS"
FT   gene            369030..370217
FT                   /locus_tag="Sulku_0373"
FT   CDS_pept        369030..370217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0373"
FT                   /product="N-acetylglutamate synthase; glutamate
FT                   N-acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="COGs: COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase); InterPro IPR002813;
FT                   KEGG: tdn:Suden_1600 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein; PFAM:
FT                   arginine biosynthesis protein ArgJ; PRIAM: Amino-acid
FT                   N-acetyltransferase; SPTR: N-acetylglutamate synthase /
FT                   glutamate N-acetyltransferase; TIGRFAM: arginine
FT                   biosynthesis bifunctional protein ArgJ; PFAM: ArgJ family;
FT                   TIGRFAM: glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33040"
FT                   /db_xref="GOA:E4TZ41"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ41"
FT                   /protein_id="ADR33040.1"
FT                   /translation="MAILNTIEGGVCAAKGFFADGIHIGLKKEGAKDLAFIYSEKPCAI
FT                   ASVFTTNKMTAAPIRHFRSLGEFEGNFVLINSKNANAMTGRAGIDDITEVLGELKSKFP
FT                   QIQNPVMSSTGVIGVRLPKAKIIEGAMKFDLTRREGINASEAIMTTDTFSKRLAYEVTL
FT                   ENGQSFRIGAMAKGAGMINPAMATMLCFITTDAAVDKTTMQDILDECVHTTFNAASVDG
FT                   DTSTNDTVVVMANGLSGAFHAGAFKEALESIMLFLAKEMVRDGEGATKLVTYKVTGAIN
FT                   HKEAEIAAKALSNSLLVKTALFGQDPNWGRIASTVGASGIMCDEAFLSIWFDDICVYKK
FT                   GELLFDEKLEPLAAAVMQKSSFTIHCDIGLQDGEFTAYGCDLGHEYVKINADYRT"
FT   gene            370403..371332
FT                   /locus_tag="Sulku_0374"
FT   CDS_pept        370403..371332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0374"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COGs: COG0462 Phosphoribosylpyrophosphate
FT                   synthetase; InterPro IPR005946: IPR000836: IPR000842; KEGG:
FT                   tdn:Suden_1636 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; PRIAM: Ribose-phosphate
FT                   diphosphokinase; SPTR: Ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM:
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33041"
FT                   /db_xref="GOA:E4TZ42"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ42"
FT                   /protein_id="ADR33041.1"
FT                   /translation="MRGYKIFSGSACTEFAAEVCRTLDVPLSKASVKRFSDGEINVQIS
FT                   ESVRGRDVFIIQSTGAPSNDNLMELLIMTDALRRSSANSITAVVPYFGYARQDRKAAPR
FT                   VPITAKLVADMFETAGIDRVVTIDLHAGQIQGFFDIPVDNLYGAIIFEEYIRSKNLANP
FT                   VIASPDIGGVARARYFAEKLGLEMVIVDKRREKANESEVMNIIGDVAGKDIIMIDDMVD
FT                   TAGTMVKAAAALKKRGATSVMACATHGVLSGKAYENLNNGELDELVISNTLVLSGQSDK
FT                   IKVLSVAPLFAEVIRRVYHNESVNSLFS"
FT   gene            371417..373207
FT                   /locus_tag="Sulku_0375"
FT   CDS_pept        371417..373207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0375"
FT                   /product="GTP-binding protein LepA"
FT                   /note="COGs: COG0481 Membrane GTPase LepA;
FT                   InterProIPR005225: IPR006297: IPR000795: IPR004161: IPR
FT                   000640: IPR013842; KEGG: tdn:Suden_1637 GTP-binding protein
FT                   LepA; PFAM: GTP-binding protein LepA domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; elongation factor G domain-containing
FT                   protein; SPTR: GTP-binding protein lepA; TIGRFAM:
FT                   GTP-binding protein LepA; small GTP-binding protein; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   GTP-binding protein LepA C-terminus; TIGRFAM: GTP-binding
FT                   protein LepA; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33042"
FT                   /db_xref="GOA:E4TZ43"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ43"
FT                   /protein_id="ADR33042.1"
FT                   /translation="MDNIRNFSIIAHIDHGKSTLADRIIQECGAVSDRELTKQMMDTMD
FT                   IEQERGITIKAQSVRLDYVKDGKHYILNLIDTPGHVDFSYEVSKSLASSDGALLIVDAA
FT                   QGVEAQTIANVYMAMENNLTLIPVINKIDLPAAEPERVAEEIETTIGIDATDAVMISAK
FT                   TGVGIRELIDAIVDRIPAPVGDPSATTKAIIYDSWFDSYQGAMALVRVFDGEIKTGQMV
FT                   KLMHNNENHQVLELLYPHPLRRQKTQSIKSGEIGIVILGVKEVGSIRVGDTITDARNPA
FT                   KEPVGEYAPAKPFVFAGIYPIDTDEFESVRDALDKLKLNDSSLSYEPETSIALGFGFRV
FT                   GFLGMLHMEVVKERLEREFNLDLIATAPSVVYKVYKTDGTMVEVQNPSELPEPQNIERI
FT                   EEPYVRATVIVPTDYLGNVITLLTAKRGMQEKMEYLNETRVMLIYVMPMNEIVVDFYDK
FT                   LKSTSKGYASFDYDPIEFRQGDLVKLDVRVAGDVVDALSVIVPRSSAESRGRALVTNMK
FT                   EIVPRQLFEVAIQASIGNRVIARETVKSMGKNVTAKCYGGDISRKRKLLDKQKEGKKRM
FT                   KAIGKVQLPQEAFMSVLKMD"
FT   gene            373209..373784
FT                   /locus_tag="Sulku_0376"
FT   CDS_pept        373209..373784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0376"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG1040 amidophosphoribosyltransferase;
FT                   InterPro IPR000836; KEGG: tdn:Suden_1638 transformation
FT                   system protein; PFAM: phosphoribosyltransferase; SPTR:
FT                   Transformation system protein; PFAM: Phosphoribosyl
FT                   transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33043"
FT                   /db_xref="GOA:E4TZ44"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ44"
FT                   /protein_id="ADR33043.1"
FT                   /translation="MRCMICERFSLSHICSSCQSSLLTPILHKRKILGSIPVYSFYPYN
FT                   EIEPLLLTKHTDLGYYIYTILAKRSLGAFAREWQYENTVASVGIDDRSESGYSHTAVLN
FT                   RALKSNNIVPQYGKLRASQHYKYAGKSVEDRLMNPRRFIYTPFSENEVILVDDIVTTGT
FT                   TLSEAAEVLHTQGKKVILCLTLSDAENK"
FT   gene            complement(373785..375278)
FT                   /locus_tag="Sulku_0377"
FT   CDS_pept        complement(373785..375278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_2350 hypothetical protein; SPTR:
FT                   Nitroreductase; PFAM: Nitroreductase family; TIGRFAM:
FT                   SagB-type dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33044"
FT                   /db_xref="GOA:E4TZ45"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ45"
FT                   /protein_id="ADR33044.1"
FT                   /translation="MKNVSSVLEYHDRTKHRPSRYAASLGYMDWETQPNPFRRYENAPL
FT                   IPLPFSEATPPYHLLFQPDSLPYAPLCIESLAQLLRYALGLAAIKSHGGSEWALRCNAS
FT                   SGNLHPSECYIIAPPLKGLSDSPTLSHYAPRKHALELLHTYREPIGEETLLIALSSVIW
FT                   REAWKYGERCWRYCQLDAGHAAESIRISAAMLGWECSVLSIDTADIASLCGLDQLHRYD
FT                   PNERESPDMLLQIRKGSFTLPKTPELLYNANRLSHSHHLWPILEIIDTATQGEYPRPVI
FT                   MKESRHTPSPTKSSGEIVLKRRSAQMMDGLGITLEQFRQLLDASLFCRDASDVNLVIFV
FT                   HRVEGLEKGLYAYIRDLKELLSLQNSMDSTFEWAEFTEGLYRLRSGDYRGAAQMVSCNQ
FT                   EIAKDGAFSFGMLCNFSSSLERHGAIGYKNLFHQCGMIGQMLYLEATSLGLSATGIGCF
FT                   LDDEFHALLGLRDQKYQSLYHFTIGRAIVDTRITSRQPY"
FT   gene            complement(375326..376573)
FT                   /locus_tag="Sulku_0378"
FT   CDS_pept        complement(375326..376573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1642 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33045"
FT                   /db_xref="GOA:E4TZ46"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ46"
FT                   /protein_id="ADR33045.1"
FT                   /translation="MKRIRYFHHTLIGKIFFSFLGVILAAAAVIFSPWGNRLTAPLIEK
FT                   SLTSAFSTPITLQEYGLTPNQFQLLFQDQYGNTFSTQGGFSLLTLRMYAHYRLSCFQHG
FT                   GINPLFSPFKTEGSLSGGIASLLIQGNGDMFGGDLIYKIELHRFHLASLNLKADKIAYT
FT                   PLMQLLKYPSDTDTLLTGGIDLRGFDQRYVEGSILLNSKTRRFNPTPIAKDNNESVTLK
FT                   SLLADKYGDVKPFNVKVTINTSLDHAGILEQFVGMPLGGALELNATLTGDQKLLRLKGN
FT                   SDVARSDTSISLTIADLEPSKLSFDCKHADLEQTFKLFALTPPISGSGDLYGELNTTGG
FT                   SVNVIITEASTVPKVLFQEYQITQPLIRFDAEVHADLSKKGVHYRGSFQSDLSRMETDN
FT                   TTTHEQMLRDLLKSLH"
FT   sig_peptide     complement(376424..376573)
FT                   /locus_tag="Sulku_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(376570..377973)
FT                   /locus_tag="Sulku_0379"
FT   CDS_pept        complement(376570..377973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0379"
FT                   /product="anion transporter"
FT                   /note="COGs: COG0471 Di- and tricarboxylate transporter;
FT                   InterPro IPR001898; KEGG: sun:SUN_0974 oxoglutarate:malate
FT                   translocator; PFAM: sodium/sulphate symporter; SPTR:
FT                   2-oxoglutarate/malate translocator; TIGRFAM: anion
FT                   transporter; PFAM: Sodium:sulfate symporter transmembrane
FT                   region; TIGRFAM: anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33046"
FT                   /db_xref="GOA:E4TZ47"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ47"
FT                   /protein_id="ADR33046.1"
FT                   /translation="MSLRVKHLYPVVLLGMFALTLWLTPPPLAISPKAWQLFTIFLTTI
FT                   IAILGNVLPIIAASVIALAISVLFGVIEPVKAYAGFSESFILMIIAAFLVSHAVHKSGL
FT                   GKRLSLHIIRRFGHSTLGLGYSLIATDILIAPAFPSNTARSGVLYPIVYGLAHDCGSKV
FT                   GDNTQRRAGSYLMMTSMAGLTISSGLWLTAMAVNPVGVGIAETMGIHITFGSWLLYAIV
FT                   PTLIAFALIPWMLYRIYPPELRSTPDAPQKAKEALEHMGRISRNEWITAGVFISMLTFW
FT                   ALSGVLGIDKAAVAFGGLGILMATRVFGVEDFRSQGEALSTLIWFAILFALSTQLAEMG
FT                   FMGAVASHFTLYLVGLSWMWVYILLIAVYVLIHYLFVSQSAHLLALFGIFLAVGVGAGV
FT                   PGELMAMMLLFATNFNATITPQGSSCNAIYLSSGYISAREIYIYGGAVTLLTFLVFMII
FT                   GTPWILALL"
FT   sig_peptide     complement(377887..377973)
FT                   /locus_tag="Sulku_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            378140..378679
FT                   /locus_tag="Sulku_0380"
FT   CDS_pept        378140..378679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0380"
FT                   /product="GrpE protein"
FT                   /note="COGs: COG0576 Molecular chaperone GrpE (heat shock
FT                   protein); InterPro IPR000740; KEGG: tdn:Suden_1643 GrpE
FT                   protein; PFAM: GrpE protein; SPTR: Protein grpE; PFAM:
FT                   GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33047"
FT                   /db_xref="GOA:E4TZ48"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ48"
FT                   /protein_id="ADR33047.1"
FT                   /translation="MSNEVNEDVISDEQTSQNTGEEVIAESMNELETIQAELASFKDKY
FT                   ARVHADFDNIKKRLEREKYQALEYANEKFAKDLIPVVDSLGMAIGAAEIEAEPAVLLEK
FT                   LKEGVELTMKQLLGVLEKHGVTPVDESEPFDPNIHNAVQRVDSPDHESGAIVNTFQKGF
FT                   RYKERTLRDAMVVIAN"
FT   gene            378801..380678
FT                   /locus_tag="Sulku_0381"
FT   CDS_pept        378801..380678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0381"
FT                   /product="chaperone protein DnaK"
FT                   /note="COGs: COG0443 Molecular chaperone; InterPro
FT                   IPR012725: IPR013126: IPR001023: IPR018181; KEGG:
FT                   tdn:Suden_1644 molecular chaperone DnaK; PFAM: Heat shock
FT                   protein 70; SPTR: Chaperone protein dnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Hsp70 protein; TIGRFAM:
FT                   chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33048"
FT                   /db_xref="GOA:E4TZ49"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ49"
FT                   /protein_id="ADR33048.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVYEGGEAKIIPNKEGKNTTPSVVAFTDK
FT                   GEILVGDPAKRQAITNPDKTIYSVKRIMGLMMNEEKAKEAHDKVTYKIVDKNGMAAVDV
FT                   AGKVYTPQEISAKILSKLKADAESYLGQSVTDAVITVPAYFNDAQRKATKEAGTIAGLN
FT                   VLRIINEPTASALAYGLDSKGDEKVLVYDLGGGTFDVTVLEISEGTFEVLSTDGNAFLG
FT                   GDDFDNKIVDFLASEFKSDHGIDLKADKMALQRLKDAAENAKKELSSAEETEINLPFIT
FT                   ADATGPKHLVVKLTRAKFEGMIDTLVKETISHIKTAMKDAGLSKNEINEIIMVGGSTRL
FT                   PIAQKMVSDEFGGKTLNKGVNPDEVVAAGAAIQGGVLRGDVKDVLLLDVTPLSLGIETL
FT                   GGIATKIIEKGTTIPVKKSQVFSTAEDNQPAVSISVVQGEREFARDNKSLGLFELNGIP
FT                   AAPRGVPQIEVTFDIDANGILTVSSTDKGTGKSQSITISGSSGLSEEEINKMVQDAENH
FT                   KAEDAKRKEIVDLRNQADALASQTEKSLKEMEDKIDASEKAAIESALEELKAVLKNTDA
FT                   SKEEIEAATKKLADASHKMAEQMYKQNEGGEAASSSAKKDDDVIDAEIE"
FT   gene            380783..381079
FT                   /locus_tag="Sulku_0382"
FT   CDS_pept        380783..381079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0382"
FT                   /product="plasmid maintenance system killer"
FT                   /note="COGs: COG3549 Plasmid maintenance system killer
FT                   protein; InterPro IPR007711; KEGG: cja:CJA_3612 plasmid
FT                   maintenance system killer protein; PFAM: plasmid
FT                   maintenance system killer; SPTR: Plasmid maintenance system
FT                   killer protein; PFAM: Plasmid maintenance system killer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33049"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ50"
FT                   /protein_id="ADR33049.1"
FT                   /translation="MIISFADQATSDIFNGIESKQARKALPMELWKSASRKLDQIDSVI
FT                   MLDELKVPPGNRLEKLRGSRENQMSIRINDQYRICFTWSDTGAVNVEITDYHS"
FT   gene            381090..381389
FT                   /locus_tag="Sulku_0383"
FT   CDS_pept        381090..381389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0383"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="COGs: COG3093 Plasmid maintenance system antidote
FT                   protein; InterPro IPR013430: IPR001387; KEGG: pph:Ppha_2031
FT                   XRE family plasmid maintenance system antidote protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Plasmid maintenance
FT                   system antidote protein, XRE family; TIGRFAM: addiction
FT                   module antidote protein, HigA family; PFAM:
FT                   Helix-turn-helix; TIGRFAM: addiction module antidote
FT                   protein, HigA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33050"
FT                   /db_xref="GOA:E4TZ51"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ51"
FT                   /protein_id="ADR33050.1"
FT                   /translation="MNIPTHRAPTHPGEMLLTEFLEPMGITQRTLADAIHVPYQRVNEI
FT                   INQKRGITPATALRLAKYFGMSADFWLNLQIRWDLYRSMQSEAKEIEAIQPLAS"
FT   gene            381401..382633
FT                   /locus_tag="Sulku_0384"
FT   CDS_pept        381401..382633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0384"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COGs: COG0014 Gamma-glutamyl phosphate reductase;
FT                   InterPro IPR000965: IPR020593: IPR012134; KEGG:
FT                   sun:SUN_1760 gamma-glutamyl phosphate reductase; SPTR:
FT                   Gamma-glutamyl phosphate reductase; TIGRFAM: gamma-glutamyl
FT                   phosphate reductase; PFAM: Aldehyde dehydrogenase family;
FT                   TIGRFAM: gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33051"
FT                   /db_xref="GOA:E4TZ52"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ52"
FT                   /protein_id="ADR33051.1"
FT                   /translation="MEHFLEKAKSASRVLATLSGSERNRILREMAEALRANTMNIIEAN
FT                   AIDMKKADVDNLSSSLKDRLMLDEKRINAMAVAIEEIAALKDPIGKVIEGWITETGLKI
FT                   EKVSIPIGMIGIIYESRPNVTSDTAALCFKSSNGCVLKGGKEAEESNKIIADVLQQVLI
FT                   RNDLPKELIALLPDSSREGVAKLIKMDRYVDLIVPRGGEALIRFVSQNASVPVVKHDKG
FT                   QCHLYIDRDANIEDALKIAVNAKVQRPSACNSIETLLVDESIASAVLPMFKAVFDRENT
FT                   QLKGCALTREIIEVSEASDEDFDTEYLANILNIRVVDGVDGAISHIVRFGSGHSESIIT
FT                   ENITTAERFMESIDAAAVYVNASTRFTDGGEFGFGAEVGISTNKLHARGPMGVEGLTTY
FT                   KYKVYGKGQIR"
FT   gene            382630..383202
FT                   /locus_tag="Sulku_0385"
FT   CDS_pept        382630..383202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0385"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1124 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR003593; KEGG: tdn:Suden_0485 ABC transporter-related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter-related protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33052"
FT                   /db_xref="GOA:E4TZ53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ53"
FT                   /protein_id="ADR33052.1"
FT                   /translation="MNTVLDIENISFGYTKDILLFDNFSLSLKAGEIKAIVGPSGVGKS
FT                   TLFELILGHRKPLSGFIRSSSFSQVFQDPYSSFHPTYTVREQIKEVTSMEGYELLLEKM
FT                   GLEEAFLDSLPHKLSGGQLQRCSILRALLMKPKLLLLDEPTSALDNLNQLDIMKLIVDN
FT                   LEGMGVLLITHDGDLAAWCADEIVTLS"
FT   gene            complement(383195..383842)
FT                   /locus_tag="Sulku_0386"
FT   CDS_pept        complement(383195..383842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0386"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: tdn:Suden_0487
FT                   phospholipid/glycerol acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33053"
FT                   /db_xref="GOA:E4TZ54"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ54"
FT                   /protein_id="ADR33053.1"
FT                   /translation="MITTFYLLPKPYAVKFSAWFIRFLVFIPVEVRGNPDPDAQMFLIN
FT                   HQSDIDIGVMETITDKDLAWVAKKELFNVPFFGLVVRLPKDIALERESKTSLVKLIKEC
FT                   KDRLDHGRVITIFPEGTRTESGKMKPFKAGAKMVADKFNLKVQPVVLVATAWHFSNKRK
FT                   DFKPGTITAIYLDSFVADKSNPEWLNETHDAMQHAYDEALSNLPKYHKRRIS"
FT   sig_peptide     complement(383744..383842)
FT                   /locus_tag="Sulku_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(383886..385040)
FT                   /locus_tag="Sulku_0387"
FT   CDS_pept        complement(383886..385040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0488 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33054"
FT                   /db_xref="GOA:E4TZ55"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ55"
FT                   /protein_id="ADR33054.1"
FT                   /translation="MKALAFLFFFLGQILLAEPSVLTDPAPAPVTATEETTAAPTVETD
FT                   VNALFSGVSTTAGLTLQFSDLPSHPYVGEIIPVTVKLTPVDIASGNIEYTLQNEEGIRI
FT                   FSDTPRRSVKEDGVYDTFYFLVQSSSIRFPDITATLTSTGSVTEPLIGTALNAIPLSPP
FT                   SGFANVLADKFEVINYKTTPYNNESNVVIFTVKASRCNIGDFSIPNAIKQGFESKFSNV
FT                   GESQMTYYAIIPNTEQNLNFSFFNLKKQRYESIVIPIVVDDDTVSTQSDLSPTDARHTE
FT                   LKISAAAVVVAVLFGLFYWRRDKWYLYASSLPMFYIVYALLPNPTICVKKDAPIYLLPI
FT                   KNGTIFEMTLQEEHLEAEKEVGEFIKVHLDDKVGWVNKRDLCSN"
FT   sig_peptide     complement(384972..385040)
FT                   /locus_tag="Sulku_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(385037..385711)
FT                   /locus_tag="Sulku_0388"
FT   CDS_pept        complement(385037..385711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0388"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0047 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase glutamine amidotransferase domain; InterPro
FT                   IPR010075: IPR017926; KEGG: tdn:Suden_0489
FT                   phosphoribosylformylglycinamidine synthase I; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR:
FT                   Phosphoribosylformylglycinamidine (FGAM) synthase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33055"
FT                   /db_xref="GOA:E4TZ56"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ56"
FT                   /protein_id="ADR33055.1"
FT                   /translation="MKVGIIQFPGTNCEYDTQHAFAALGCETQILWHKEDTIPSDMDLV
FT                   VAAGGFSYGDYLRSGAIAKMSPIMKALKVYAENGGKVLGICNGFQVLTETGLLPGALKR
FT                   NEGLHFISRHHHLKVINNDNIFLRHCNVDQVLNIPIAHHDGNFYIDEHGLQELYANGQV
FT                   LLKYTDEKGNIDNPNGSVDSIAGICNKSKNVFGLMPHPERAMETLLGSDDGKAMLEGFI
FT                   NA"
FT   gene            complement(385708..385950)
FT                   /locus_tag="Sulku_0389"
FT   CDS_pept        complement(385708..385950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0389"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="COGs: COG1828 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase PurS component; InterPro IPR003850; KEGG:
FT                   tdn:Suden_0490 phosphoribosylformylglycinamidine synthetase
FT                   PurS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; SPTR: Phosphoribosylformylglycinamidine synthetase
FT                   PurS; TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase, purS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33056"
FT                   /db_xref="GOA:E4TZ57"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ57"
FT                   /protein_id="ADR33056.1"
FT                   /translation="MKAIVNVFLKNGVLDSQGKAVQHALSGHGFETVKDVRVGKQIIIE
FT                   MNENDADAAKEKVAHMCEELLANTVIEDYEIEIQA"
FT   gene            complement(385955..386665)
FT                   /locus_tag="Sulku_0390"
FT   CDS_pept        complement(385955..386665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0390"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COGs: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase; InterPro IPR001636: IPR018236; KEGG:
FT                   tdn:Suden_0491
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; PRIAM:
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide synthase;
FT                   SPTR: Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33057"
FT                   /db_xref="GOA:E4TZ58"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ58"
FT                   /protein_id="ADR33057.1"
FT                   /translation="MEKRDLIYEGKAKRLFSTDDANLVIAEFKDDLTAFNGAKKDNESG
FT                   KGALNNKISTELFKMLAKNGVESHFVEMLDDTHMLCKKVDIILIEVIVRNIATGSLSKN
FT                   LGIPDGKVLPFTLVEFDYKNDALGDPKLNDQHCLILELVKNEAELDQLRAMAREVNSIL
FT                   RPYFHDKGLNLVDFKLEFGRDKDGKIILADEISPDNCRFWDLETGEKMDKDRFRQGLGG
FT                   LKVAYEEVLNRILG"
FT   gene            complement(386668..387990)
FT                   /locus_tag="Sulku_0391"
FT   CDS_pept        complement(386668..387990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0391"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR004447: IPR001478: IPR005151; KEGG: tdn:Suden_0492
FT                   peptidase S41A, C-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Periplasmic protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: Peptidase family
FT                   S41; PDZ domain (Also known as DHR or GLGF); TIGRFAM:
FT                   C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33058"
FT                   /db_xref="GOA:E4TZ59"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ59"
FT                   /protein_id="ADR33058.1"
FT                   /translation="MKNTKMMVVGFVSAVAVSLILSTSLFAKNTVAAPTEASVEASRLQ
FT                   SLAKFTKVLSIVEQYNVDGLTVDQLIDKSLQGMLSNLDAHSTYMDKKSYDNLKTQTDGE
FT                   FGGLGITVGMRDNALTVIAPIEGTPADKAGIKAGDIILKINDKSTLSMTIDDAVSIMRG
FT                   APKTPIDLTIVRKGLADPLKIHIIRDIITVQSVYTRNISGNILYIRVTSFDKKVAADVK
FT                   KAIKKYSGKSKGIILDLRNNPGGLLDQAVDLTDLFVDEGIIVSQKGRNKADDMTYKATK
FT                   SNTITDLPLVVLVNEGSASASEIVSGALQDLKRAVIVGEKTFGKGSVQVVMPITETEGI
FT                   KLTVARYYLPSGRTIQAVGVTPDIEVAAGEIKKHEKSFNIKEADLKEHLVSELEKSDGM
FT                   IDVTEANATNKTVITPEQMNRDIQLKEGVDIIKALIIVKGK"
FT   sig_peptide     complement(387895..387990)
FT                   /locus_tag="Sulku_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(388069..388272)
FT                   /locus_tag="Sulku_0392"
FT   CDS_pept        complement(388069..388272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0392"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG2501 conserved hypothetical protein;
FT                   InterPro IPR002942; KEGG: tdn:Suden_1502 RNA-binding S4;
FT                   PFAM: RNA-binding S4 domain protein; SPTR: RNA-binding S4;
FT                   PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33059"
FT                   /db_xref="GOA:E4TZ60"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ60"
FT                   /protein_id="ADR33059.1"
FT                   /translation="MTYTLTEPFIELHKLIKLLDLVDTGGQAKMLIENGHVLRNGEVET
FT                   RKRAKITKGETIQIGDVVIEVV"
FT   gene            complement(388365..388637)
FT                   /locus_tag="Sulku_0393"
FT   CDS_pept        complement(388365..388637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0393"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="COGs: COG0724 RNA-binding protein (RRM domain);
FT                   InterPro IPR000504; KEGG: nis:NIS_0278 RNA-binding protein
FT                   RNP-1; PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; SPTR: RNA-binding protein RNP-1;
FT                   PFAM: RNA recognition motif. (a.k.a. RRM, RBD, or RNP
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33060"
FT                   /db_xref="GOA:E4TZ61"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ61"
FT                   /protein_id="ADR33060.1"
FT                   /translation="MTQIYVGNIPYGKDENDLKDLFGQYGEVSSVKFVNDKETGRFRGF
FT                   GFVEMANKDEADKAITALEGNDFGGRTLRVNEARPRAPRPPRDRW"
FT   gene            complement(388778..390880)
FT                   /locus_tag="Sulku_0394"
FT   CDS_pept        complement(388778..390880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0394"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain;
FT                   InterProIPR000014: IPR000160: IPR013767: IPR013655: IPR
FT                   001633: IPR000215; KEGG: cyt:cce_2032 hypothetical protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold-3 domain protein; PAS fold domain protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein; SPTR: Diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(S); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain;
FT                   GGDEF domain; PAS fold; TIGRFAM: PAS domain S-box;
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33061"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ62"
FT                   /protein_id="ADR33061.1"
FT                   /translation="MQTEAPLYDVLNYLPDGIIMLDERGVILFANDAFSEMVGYKSDLL
FT                   LGLNMLSLLADITVFTECIAKVMKEGQSLDAETDFLHRDGHIVQAVKSVRMIRHNDHTR
FT                   FFVNVRNLTDLIQFNKELRASKELIELQAAELSFLLNSKHQEIEDILSSIDEVIWYIHN
FT                   QTLSLQYVNKAVETIFGFTKETFLSDTTLWQQQIHPEDRSLVQMFFETLAPGQSQEIRF
FT                   RILHCDGEVRWLNSRIHNHPKLNLFIGITSDITCSKAQSEEIAFLAYHDPLTHLPNRAK
FT                   LKLQLENRFEHAPNSPFALMFLDLDNFKNINDTMGHKIGDKILIEVSRRIRETVGKYDF
FT                   YARFGGDEFVILLQDADSASIDLTAQKLIQVFKEPCTLNETEFFLSASIGIVLYPDDAL
FT                   NGDDLIKHADTAMYEAKKKGKNQFAYYHTSMERAIHHFMYIESLIREGLTQNLFELYFQ
FT                   PLIDSKTLRMEGYEALLRLKHPHKGFIPPDTIIPVAEANGDIHLIGDKVLSQACDFIDA
FT                   LRALQDEPFFVAINVSAKQLQRNKFVQELFDYLALRSIPSSYLKVEVTESTVMENIAVV
FT                   SQQLSQLKAGGIRISLDDFGTGYSSFAYLAQLPIDTLKIDKSFILALFKDNSNRHIVEA
FT                   ISNLAHALGMNVTAEGVEEAQHYDFLLENNIDTLQGYHLCRPLPKDEILNNMQKILPVL
FT                   REYTRQ"
FT   gene            391022..392626
FT                   /locus_tag="Sulku_0395"
FT   CDS_pept        391022..392626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0395"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG0488 ATPase components of ABC transporter
FT                   with duplicated ATPase domains; InterPro IPR003439:
FT                   IPR003593; KEGG: tdn:Suden_1507 ABC transporter-related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33062"
FT                   /db_xref="GOA:E4TZ63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ63"
FT                   /protein_id="ADR33062.1"
FT                   /translation="MVQVTKLTMRFGSRVLFEGINLKLDRNKRYGLIGANGAGKTTFLK
FT                   ILSGEIKEYEGDISIEPGLKVGVLGQNQFAFEDFTIADAVLWGNKRLYDAIKEKEHLYA
FT                   TGDFEDEAVNNRLADLEMICVEEDPTYEYDVQIAKILENVGIPAEHHHDLMSTLPSSEK
FT                   FKVLLAQVLYPKPDVLFLDEPTNNLDIDTIGWLEHELQRHEGTMVVISHDRHFINAVVT
FT                   NILDVDFQKIREFTGNYDDWYLASTVMANQAQLERDKKLKEKEQLEAFVRRFSANASKA
FT                   KQATSRQKQLDKLTIDDIKPSSRRDPSIVFKAKRQMGDEALDVIDVSHSYGDLNVLHDI
FT                   NLKIVPGEKIAVIGGNGVGKSTLLKIIMEEIKPTSGSVKWGATIEPTYFPQDTADRIKG
FT                   TETLYDWLRAFDPKREISEIRNCLGRMLFNGEQQEKSIEKISGGEKHRMMLSKMMLEGG
FT                   NFLVLDEPTNHLDLEAIIALGEALYEFEGNVICVSHDRELLDAFAGRIIELHADGSYID
FT                   FKGTYEEFAEAKASGSL"
FT   gene            392651..393484
FT                   /locus_tag="Sulku_0396"
FT   CDS_pept        392651..393484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1508 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ64"
FT                   /protein_id="ADR33063.1"
FT                   /translation="MDSYKNFVGLGVAGNFALHLEQAGESADFKDVVSEDPNGPKGVFP
FT                   FYIPGREGQLGVYPLSCDTIILPKEACNVQPEPEVALICELTYDAEGNVSAITPKFFGA
FT                   YNDCSLRKEGAAKISHKKNWGEGTKGLSRTLIPIDSFEQGGIMDRYRIASFVRREGMMM
FT                   RYGEDVELTGYSYFHGKLIEWLKNQLNTQEDFGPLEPIKNYLMEAGSPAQAIISIGATR
FT                   YTHFGETNFLQDGDEVIVVVYDNDKYCMNPILSMANRGALEGEGISALIQKVVRG"
FT   sig_peptide     392651..392737
FT                   /locus_tag="Sulku_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            393477..393683
FT                   /locus_tag="Sulku_0397"
FT   CDS_pept        393477..393683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0397"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="COGs: COG4728 conserved hypothetical protein;
FT                   InterPro IPR012868; KEGG: pag:PLES_20501 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1653; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1653)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33064"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ65"
FT                   /protein_id="ADR33064.1"
FT                   /translation="MVKSGLYRHYKGKYYEVIGVAKHSETEELLVVYRPLYGEQGLWVR
FT                   PLEMFDEILPNGTKRFTYSGEVK"
FT   gene            393680..394012
FT                   /locus_tag="Sulku_0398"
FT   CDS_pept        393680..394012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0398"
FT                   /product="translation initiation factor SUI1"
FT                   /note="InterPro IPR001950: IPR017228; KEGG: tdn:Suden_1509
FT                   translation initiation factor SUI1; PFAM: translation
FT                   initiation factor SUI1; SPTR: Translation initiation factor
FT                   SUI1; PFAM: Translation initiation factor SUI1; TIGRFAM:
FT                   translation initation factor SUI1, putative, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33065"
FT                   /db_xref="GOA:E4TZ66"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ66"
FT                   /protein_id="ADR33065.1"
FT                   /translation="MSRGTKLSLDLGASWGEGWSMEEEKTSKVLALLDPSAHRLVFQKE
FT                   KRRGKIVTLVGPFSLDEAEAQKTLSSLKKSLACGGAYKEGWMEFQGDISSKVREALEKL
FT                   TFKFKK"
FT   gene            complement(394013..395221)
FT                   /locus_tag="Sulku_0399"
FT   CDS_pept        complement(394013..395221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0399"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: tdn:Suden_1511 diguanylate cyclase; PFAM: GGDEF
FT                   domain containing protein; SMART: GGDEF domain containing
FT                   protein; SPTR: Diguanylate cyclase; TIGRFAM: diguanylate
FT                   cyclase; PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33066"
FT                   /db_xref="GOA:E4TZ67"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ67"
FT                   /protein_id="ADR33066.1"
FT                   /translation="MKALKLKTKLLYLLLLVGFGLVVIGLIGYINIQNIKRNMDTLYFG
FT                   SLIPLNELNTITATYHNDLGSSVYRWSHQLLSDEQAATNILQGLDRINHLWTSYLSHDK
FT                   HPEEMAYINYTEAQIRSIENYFMQVHSTVSDPSRSHPISLMTMDENIQSIQKTIAQLIT
FT                   YEYENAKYEHAMLLAQYENALMQLILFLGVILALVMGLAWVIFSRIEIQQQQLIASSET
FT                   LKHLNLKLEQASYTDSLTSLFNRRYFNIVYDREFKRALRSNKPFVFMMLDIDFFKQYND
FT                   TYGHIQGDVALQTVAKILKSTLQRPGDYPFRLGGEEFGIILCDIDCKNAHIMGEKVRAA
FT                   IDSLKIEHKGSKILPTLSVSIGGICITPTLDMSDDALIHAADTNLYAAKERGRNQVVFG
FT                   NKL"
FT   sig_peptide     complement(395147..395221)
FT                   /locus_tag="Sulku_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            395316..395630
FT                   /locus_tag="Sulku_0400"
FT   CDS_pept        395316..395630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO0669 ATP phosphoribosyltransferase
FT                   catalytic subunit; SPTR: ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33067"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ68"
FT                   /protein_id="ADR33067.1"
FT                   /translation="MAKRLIKDERIKTIIHNIAEDFRFSHETGDYALLFYKADTEGAVR
FT                   GADIEAMIEYLSTGLSELQDNIQWRREFLSENPGVDEIRMLENLGVIEKEYIDLLEFLR
FT                   "
FT   gene            complement(395730..396131)
FT                   /locus_tag="Sulku_0401"
FT   CDS_pept        complement(395730..396131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0401"
FT                   /product="rhodanese-like domain-containing protein"
FT                   /note="InterPro IPR001763; KEGG: tdn:Suden_1498
FT                   rhodanese-like domain-containing protein; SPTR:
FT                   Rhodanese-like domain protein; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33068"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI0"
FT                   /protein_id="ADR33068.1"
FT                   /translation="MRILLIALLLSATALMADYSHQPIDQKLIDSKIKIIDIRTPNEWK
FT                   TTGVVKGSLPIMFFDENGNYDMNGFLAELNTKVKKNERFALICNSGNRSKVLGTYLGKQ
FT                   LGYNVIDLDGGIQYAIAKKMPLEPYQPKK"
FT   sig_peptide     complement(396063..396131)
FT                   /locus_tag="Sulku_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            396194..396556
FT                   /locus_tag="Sulku_0402"
FT   CDS_pept        396194..396556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1497 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33069"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI1"
FT                   /protein_id="ADR33069.1"
FT                   /translation="MNASKEENSKRLRYIRLLGRFISGIISWLSKAQSPTKEQYDQKVD
FT                   MNFRFLEKNEAVKLYKDEYTELEALGQKILDFRASENDIETIKEELFYAQNQLEKRINA
FT                   RRYKKSKHDNHTTDGW"
FT   sig_peptide     396194..396289
FT                   /locus_tag="Sulku_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(396557..397114)
FT                   /locus_tag="Sulku_0403"
FT   CDS_pept        complement(396557..397114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0403"
FT                   /product="protein of unknown function DUF204"
FT                   /note="COGs: COG1971 membrane protein; InterPro IPR003810;
FT                   KEGG: ccv:CCV52592_0090 membrane protein; PFAM: protein of
FT                   unknown function DUF204; SPTR: Putative membrane protein;
FT                   PFAM: Domain of unknown function DUF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33070"
FT                   /db_xref="GOA:E4TZI2"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI2"
FT                   /protein_id="ADR33070.1"
FT                   /translation="MNETLLILAVALAMDSVAVSIAIGSKYKRLLLSKVLFVAAVFGFF
FT                   QGIMPLAGYFIGISFAQYVQDYDHWIAFALLTALGGKMLYEAYKNEFDEEVTDLSTKTL
FT                   ITLGIATSIDAMAIGVTFAFLQTDIYTAAGVIALVTFLLCIAAVYIGKKLGSLLESKAE
FT                   MLGGLILIGLGFKILLEHLGVI"
FT   sig_peptide     complement(397061..397114)
FT                   /locus_tag="Sulku_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(397190..398254)
FT                   /locus_tag="Sulku_0404"
FT   CDS_pept        complement(397190..398254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0404"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   nis:NIS_0906 hypothetical protein; PFAM: permease; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33071"
FT                   /db_xref="GOA:E4TZI3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI3"
FT                   /protein_id="ADR33071.1"
FT                   /translation="MNLIWEAFWDLSVAMGIYILFGLLAAGVLHQLIREEWIQKHLGSD
FT                   THGSVYKAALFGTPLPLCSCSVIPFAASLRRNGASKGATLSFLISTPITGIDSILATFG
FT                   MFGWVFTFYRVFTSVILAITAGMLMNIFDPKEVAKKGVAFSATPPNAPSPIIQSAKEEK
FT                   KPPFSVSGVFQYGLVTLLGSFSKPLLFGLLLGAFITAAIPSNLQELFNDNRILGYLLAV
FT                   AIAAPMYVCATESLPIAASLIIAGVSPGAAFIFLSAGPATNTVTMGAVKSMLGTRALVI
FT                   YLSVIAIGSITFGALVDIVFDTLSINMGINLHEHRGIVEEAAAVLMLGLIGWHLIRGLF
FT                   QQKEKGCNGGSCCS"
FT   sig_peptide     complement(398207..398254)
FT                   /locus_tag="Sulku_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(398348..399274)
FT                   /locus_tag="Sulku_0405"
FT   CDS_pept        complement(398348..399274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0405"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG1230 Co/Zn/Cd efflux system component;
FT                   InterPro IPR002524; KEGG: net:Neut_0043 cation diffusion
FT                   facilitator family transporter; PFAM: cation efflux
FT                   protein; SPTR: Probable metal transporter; TIGRFAM: cation
FT                   diffusion facilitator family transporter; PFAM: Cation
FT                   efflux family; TIGRFAM: cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33072"
FT                   /db_xref="GOA:E4TZI4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI4"
FT                   /protein_id="ADR33072.1"
FT                   /translation="MSTSAEKWYHSHIFDEGNPLAERNTRIAVALTAFMMVAEIIGGWA
FT                   YNSMALLADGWHMGTHALALGLSVMAYGAARRYENDKRFAFGTWKIEVLGGYTSAIFLV
FT                   GVAALMFYESAQRLISPTPIHYGEAIQIAVIGLVVNLICAWLLKDGHHHDHDHHHGHDH
FT                   SHDHHHDLNLRSAYMHVIADAATSVLAIIALFCGMLWGAAWLDPIMGIVGAGLVAVWAY
FT                   GLLRDSGRILLDAEMDAPVVDEIYDVIEASPIKATITDLHVWRVGKGKYSCILSLHTTE
FT                   EVSPDFFKQQLSIHEELVHITVEVNQA"
FT   gene            399351..399623
FT                   /locus_tag="Sulku_0406"
FT   CDS_pept        399351..399623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0406"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein;
FT                   InterPro IPR003735; KEGG: pag:PLES_38841 hypothetical
FT                   protein; PFAM: protein of unknown function DUF156; SPTR:
FT                   Protein of hypothetical function DUF156; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33073"
FT                   /db_xref="GOA:E4TZI5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI5"
FT                   /protein_id="ADR33073.1"
FT                   /translation="MAHTIHSKKQLLTRVRRIKGQAEALERALDDEKECSAVLQQIAAI
FT                   RGAINGLMSEVMEGYIREHLSPDVPEQQRNEDLEKLVSVIRSYLK"
FT   gene            complement(399633..399818)
FT                   /locus_tag="Sulku_0407"
FT   CDS_pept        complement(399633..399818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33074"
FT                   /db_xref="GOA:E4TZI6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI6"
FT                   /protein_id="ADR33074.1"
FT                   /translation="MCLIITFAFIVATFSFFSQGLIPHAIISGLLASVSLFFFIRKLIF
FT                   NGRCIFGKDTDCNTPK"
FT   sig_peptide     complement(399744..399818)
FT                   /locus_tag="Sulku_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(399868..400611)
FT                   /locus_tag="Sulku_0408"
FT   CDS_pept        complement(399868..400611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0408"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: glo:Glov_1064 polysaccharide deacetylase;
FT                   PFAM: polysaccharide deacetylase; SPTR: Polysaccharide
FT                   deacetylase; PFAM: Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33075"
FT                   /db_xref="GOA:E4TZI7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI7"
FT                   /protein_id="ADR33075.1"
FT                   /translation="MIKKLVILLLTTVLSLTADEPVQWGENVTGVVTTFKTSQKEVALT
FT                   FDACGGSAKSSQFDAGLIDFLIENRIPATLFINSRWIQSNPETFMYLAANPLFEIANHG
FT                   TAHRPLSVSGKSIYNIPGTASPEEVKHEINGNGDLIEKLTGRRPKFFRSGTAYYDELSV
FT                   AIARQNGVEIAGFSILGDAGATFSAPKVVQQIESARSGDILIFHMNHPEGGTREGIMEG
FT                   VVKLKAQGYSFVRLSDVKERLNHFP"
FT   sig_peptide     complement(400558..400611)
FT                   /locus_tag="Sulku_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            400772..402745
FT                   /locus_tag="Sulku_0409"
FT   CDS_pept        400772..402745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0409"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR000160:
FT                   IPR003660: IPR001633; KEGG: cbe:Cbei_2527 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; histidine kinase HAMP region
FT                   domain protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; SPTR: Ggdef family protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain; GGDEF domain;
FT                   TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33076"
FT                   /db_xref="GOA:E4TZI8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI8"
FT                   /protein_id="ADR33076.1"
FT                   /translation="MSHKTTYTKIAAKIIFITMLVTLVATYIYGEYMKRDAITNLAHVD
FT                   AKKTSMLVFEALYSAMQRGWNKNDLEEIISRLNRVDSHMKVNVYRSEVVADLFGEIEKD
FT                   KVARESNTEIKKAIRGEEVLNISDKELIEYYYPVIAKENCLKCHVNASSGDVLGVIDIS
FT                   YPVENLKVPLTDMINFFIIFIIVFSIIVYLSIFIELNQYLIKPIKNFSNLIKNITASQD
FT                   MRKRIELNENIEEIDSIKDVFNSMLDSIEHQFYFDTLTGLENRRRLTEKLEERHSVFLM
FT                   IINIDSFQEINDLYGEPAGDLILKEFAQYLKEIMPKEEGLYRLHSDEFAHICTSGMDLN
FT                   EFRNFAALISEKISQKSFNIDERSEVSLSATIGVSYGSELLLVNADIALKLAKKTKKNF
FT                   LIYDNTMAMTKEYEKNFDWTKRLKKAIEEDKIVPLFQPIVDTKTQVIVKYEALMRMVDD
FT                   QGFYIAPVHFLELAKKNKLYHQLTKIMIQKTFEKFQSLTYFVSINISVEDILNKEINHF
FT                   IVKTLEESGIGHQIVFEIIESEGIENFDQVLEFINEVKQYGAKISIDDFGTGYSNFEYL
FT                   MKLKVDYIKIDGSMIKNIDSDKNSQMITTSIVSFAKNMNIKTVAEFVHSKNVFEKINEL
FT                   GVDYSQGYYFGEPTELVTPSSP"
FT   sig_peptide     400772..400861
FT                   /locus_tag="Sulku_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(402726..402881)
FT                   /locus_tag="Sulku_0410"
FT   CDS_pept        complement(402726..402881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_2099 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33077"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI9"
FT                   /protein_id="ADR33077.1"
FT                   /translation="MKYILLIATVLTVFSGCSATWSGVKEDTSKAADWTKEKVNQGAAY
FT                   VKEKTE"
FT   sig_peptide     complement(402789..402881)
FT                   /locus_tag="Sulku_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(402957..403196)
FT                   /locus_tag="Sulku_0411"
FT   CDS_pept        complement(402957..403196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phu:Phum_PHUM424130 zinc finger and cchc
FT                   domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33078"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ0"
FT                   /protein_id="ADR33078.1"
FT                   /translation="MSLEITEWQRIQHTLNNIVNLTSIEALIMAHKAKITVNEMLKCQT
FT                   ISELKKIPIEHVFKKMAHFKESSAYLIYKQEFTY"
FT   gene            complement(403355..404803)
FT                   /locus_tag="Sulku_0412"
FT   CDS_pept        complement(403355..404803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0412"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: pin:Ping_1880 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   SPTR: Diguanylate cyclase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33079"
FT                   /db_xref="GOA:E4TZJ1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ1"
FT                   /protein_id="ADR33079.1"
FT                   /translation="MKFKNNLYIVVTISVMMIVLSISISLINFMVSLRSTETDLKTRSL
FT                   PLTVDNIYTEIQKHVIEPNLVASMMAHDTFLKDWLIKDEQNSDKITRYLDTIKNKYGMF
FT                   VAFLVSEKTQSYYTQNGFLEHLSPTKSDNEWYYKFKTLQEDHEINLDFNNNLDNSLIMF
FT                   INHKIYDSDYHFVGATGIGLKISYINDMLKRFRQEYNFTVLFVNEEGKIILSERTDAKI
FT                   KSLYDAPELRNLADQIIIKDSKILEYQKDGVNYLLKTKYIPELDLYLLVEAKLDDFTQN
FT                   VRRTFYLNLAASLLVTVIITFIIIMMIRGYNEKLEFMARNDALTGLMNRHAFDDSFNDF
FT                   LLLSQRNNDPLSLIFFDIDNFKTINDTLGHQAGDNVLIRISELLKTRLRRTDIIGRWGG
FT                   EEFIIGLINTDYKNAEVIAETLRKAIEEDSRLIHLAPFPVTASFGVATVRTGDTIETIL
FT                   TRADSAMYRAKELGKNRIETELGT"
FT   sig_peptide     complement(404699..404803)
FT                   /locus_tag="Sulku_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(404822..405304)
FT                   /locus_tag="Sulku_0413"
FT   CDS_pept        complement(404822..405304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1827 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33080"
FT                   /db_xref="GOA:E4TZJ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ2"
FT                   /protein_id="ADR33080.1"
FT                   /translation="MIIPLSSETLSDFFTFFDFTCESDALQAFIGLLRETASHHQNIIH
FT                   AGYADQTPFGFVSLKITNDVDNIPGLLIEFLYIKPEYRQKMLGGTPRYSFSMLDDVIML
FT                   AFELQKIVAINHIFLIPVDENKRAMYLEYGFENIPGSGKNPFEDFMVFNLLSEEII"
FT   gene            complement(405312..405455)
FT                   /locus_tag="Sulku_0414"
FT   CDS_pept        complement(405312..405455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33081"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ3"
FT                   /protein_id="ADR33081.1"
FT                   /translation="MSYVIRDGKVETAKPIKNLNEEQKKVLKVTTAKQADKIKALKAKL
FT                   AS"
FT   gene            complement(405522..405596)
FT                   /locus_tag="Sulku_R0013"
FT   tRNA            complement(405522..405596)
FT                   /locus_tag="Sulku_R0013"
FT                   /product="tRNA-Glu"
FT   gene            complement(405618..405693)
FT                   /locus_tag="Sulku_R0014"
FT   tRNA            complement(405618..405693)
FT                   /locus_tag="Sulku_R0014"
FT                   /product="tRNA-Lys"
FT   gene            405885..406277
FT                   /locus_tag="Sulku_0415"
FT   CDS_pept        405885..406277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0692 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33082"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ4"
FT                   /protein_id="ADR33082.1"
FT                   /translation="MKKLLILICMMVLNLSAHSIHNDDQFKAAVASMGADNKLVLMIYT
FT                   TDDCPECAYMKQKVFHDKGVEDYMNRHFVVIEKNVHKNKLPDGYDFFGIPTMFFIDKAG
FT                   NRKETVVGSKRAQPFLAELHRIRGMK"
FT   sig_peptide     405885..405941
FT                   /locus_tag="Sulku_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            406274..406870
FT                   /locus_tag="Sulku_0416"
FT   CDS_pept        406274..406870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0416"
FT                   /product="pentapeptide repeat protein"
FT                   /note="COGs: COG1357 Uncharacterized low-complexity
FT                   protein; InterPro IPR001646; KEGG: tbd:Tbd_0916
FT                   hypothetical protein; PFAM: pentapeptide repeat protein;
FT                   SPTR: Pentapeptide repeat protein; PFAM: Pentapeptide
FT                   repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33083"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ5"
FT                   /protein_id="ADR33083.1"
FT                   /translation="MKLAWLAFWIGVSLSAYDAAHLKKALEDKECIGCDLRGADLSQND
FT                   FSGGDFHGSDLSEADLHESIFEMGDLSDCNLSGANAENALFWKGTMERADLTRIHARGA
FT                   NFKGVHLNRSRLNSADLRGTKSWKADFTDASFSKTDFTDAELGDAKFIRNDLRTVKMKR
FT                   ALLWQTRFSDTVLTKAQCAHAKKEEAILDANVTCR"
FT   sig_peptide     406274..406318
FT                   /locus_tag="Sulku_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(406867..408015)
FT                   /locus_tag="Sulku_0417"
FT   CDS_pept        complement(406867..408015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0417"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="COGs: COG2059 Chromate transport protein ChrA;
FT                   InterPro IPR014047: IPR003370; KEGG: vsa:VSAL_I0672
FT                   putative chromate transporter; PFAM: Chromate transporter;
FT                   SPTR: Chromate transport protein; TIGRFAM: chromate
FT                   transporter, chromate ion transporter (CHR) family; PFAM:
FT                   Chromate transporter; TIGRFAM: chromate transporter,
FT                   chromate ion transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33084"
FT                   /db_xref="GOA:E4TZJ6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ6"
FT                   /protein_id="ADR33084.1"
FT                   /translation="MKIWELFWRFLLLGLVSFGGPAAHIGYFRTTFVDKLRWLDNASYA
FT                   RLVALSQFLPGPGSSQVGFAIGIERAGLLGGIAAFIGFTIPSFIFMATLAIVPFEPTPI
FT                   FTGMIHGLKLFAVIVVADAVLSMYRSFCTSTAASAIAIASAASLWLFPSLSTQMILLII
FT                   SAVIGLMFLHIPIATSAVPIRISYIPLILFLALFILVPFFVDVSKWIALFNTFFQSGAL
FT                   VFGGGHVVLPLLQHALGDSITTERFLFGYAAAQAVPGPMFSLAAFLGTDLSPSSPLLGA
FT                   LVATLSIFLPGFLLLLGLYRGWEILAQRPRIAAVAAGLNAAVVGILLAALYNPVFTSGV
FT                   TSTIDMALVVTGFFLLRMLKIPVVGLLPIFALSGVIISVKFV"
FT   sig_peptide     complement(407941..408015)
FT                   /locus_tag="Sulku_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(408035..408475)
FT                   /locus_tag="Sulku_0418"
FT   CDS_pept        complement(408035..408475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr6985 hypothetical protein; SPTR:
FT                   Blr6985 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33085"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ7"
FT                   /protein_id="ADR33085.1"
FT                   /translation="MKRIGISVLILIAQLHANEPQSYTPGLGDMMGAVQIRHAKLWFAG
FT                   QNQNWKLATYELDEIKEGLEDAAVYHPIFKGKPIAKMMKISIAPALDQVEESIKQKNSS
FT                   QFIKAFETLSNACTSCHKNSGYGFIVIERPSTPPFSNQRFKP"
FT   sig_peptide     complement(408425..408475)
FT                   /locus_tag="Sulku_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            408595..409230
FT                   /locus_tag="Sulku_0419"
FT   CDS_pept        408595..409230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0419"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: ant:Arnit_2164
FT                   response regulator receiver protein; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Response regulator receiver protein; PFAM:
FT                   Response regulator receiver domain; Transcriptional
FT                   regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33086"
FT                   /db_xref="GOA:E4TZJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ8"
FT                   /protein_id="ADR33086.1"
FT                   /translation="MGRILLLEDDEILSQTIMTILRSEGYEVYKAVNGREAYDLTFEHP
FT                   FDLYLFDVNVPESNGFEVLRELRKSGDETPTFFITALSDIQSVSQGFEAGANDYIKKPF
FT                   DLDEFVIRIRAALKRKYRTILYRDIAFEPNTQHVFINGLECDLSPVERMVFSLLVQNMD
FT                   RTVPKESFYEIMEKPSDAALRVHIAHLKQKLDLQIANIRSVGYRLELS"
FT   gene            409217..410260
FT                   /locus_tag="Sulku_0420"
FT   CDS_pept        409217..410260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0420"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661: IPR003594: IPR004358: IPR005467; KEGG:
FT                   ant:Arnit_2163 integral membrane sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SPTR: Integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33087"
FT                   /db_xref="GOA:E4TZJ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ9"
FT                   /protein_id="ADR33087.1"
FT                   /translation="MNYREKESFIKSFSLFFVALFSMGAIALWLYHEEQQRFYQLQLLT
FT                   EMDAFSYVLQGEEFAYAIMNLDKDQPIHELIVKDTEVYALFPWVRNPDNEMVKVTYPHQ
FT                   EYLKYMDAESRKIWMLFLSLGFITVLLSAFFARYTLTPMRRSLLLMENFLKDIIHDLNT
FT                   PVSSILLNSQLLKRKYTDEEIDRIYISGQTITGLYKNLEVLYRQLPIEQDEVRLDTFLH
FT                   ERIRYFQTLYPSLSLTLEGEREMSISINRDILMRIVDNLLSNACKYNRSNGQVTVRYDQ
FT                   TSIEIIDTGIGIKHLDKVFHRFYKETERGLGMGLHIVKTLADRVGIAIEIESQKGIGTH
FT                   VTIHFLR"
FT   gene            410324..411550
FT                   /locus_tag="Sulku_0421"
FT   CDS_pept        410324..411550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0421"
FT                   /product="sulfite dehydrogenase (cytochrome) subunit SorA
FT                   apoprotein"
FT                   /EC_number="1.8.2.1"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572:
FT                   IPR005066: IPR008335: IPR017909; KEGG: sun:SUN_1104
FT                   sulfite:cytochrome c oxidoreductase subunit A; PFAM:
FT                   oxidoreductase molybdopterin binding; Mo-co oxidoreductase
FT                   dimerisation domain; SPTR: Sulfite oxidase, putative; PFAM:
FT                   Mo-co oxidoreductase dimerisation domain; Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33088"
FT                   /db_xref="GOA:E4TZK0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK0"
FT                   /protein_id="ADR33088.1"
FT                   /translation="MKKINRRDFLGAGLILGASTLLGQETSKNLLPQGEEFIPPVIAFP
FT                   EKMPMKTISDRPPLLGSARGRELFTQAITPNNQFFVRWHLPDIPTYINLNEFRLEVKGS
FT                   VSTPLSLSIDDLKSKFEPAEVTAVLQCGGNSRKYYAVTGQATHGVQWDHDAMGCAIWRG
FT                   VRLKDILNRAGVKSSAKWIGLNGLEKPAMDETPDFFREMEIEEALEDQIIVAYAMNGED
FT                   LPYLNGFPIRLVIPGHFSDSWVKMLSEVMVMDTYRESFFMDVAYTVPDNDCECVISGND
FT                   FEYKRKPIAAMKVKSVIGYPLPGTAIKKGSRVKIAGVAFDQGKGIKEVMISLDSGKNWS
FT                   AAKLGEDHGKFAFRPWSYEWEPKTKGEYTIMVRAINRIGNIQPMPHEIGWNAGGYQYNA
FT                   VDSVSVQIV"
FT   sig_peptide     410324..410452
FT                   /locus_tag="Sulku_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            411560..411877
FT                   /locus_tag="Sulku_0422"
FT   CDS_pept        411560..411877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0422"
FT                   /product="sulfite:cytochrome c oxidoreductase subunit B"
FT                   /note="KEGG: sun:SUN_1103 sulfite:cytochrome c
FT                   oxidoreductase subunit B; SPTR: Sulfite:cytochrome c
FT                   oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33089"
FT                   /db_xref="GOA:E4TZK1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK1"
FT                   /protein_id="ADR33089.1"
FT                   /translation="MKKIILLSALLISISFAQVAQPIEIPYVDYPMVKGDHDEVAQQYC
FT                   LICHSWGYILNQGKKSRPYWSGTVQKMVNEFKAPISKEEQQTIINYLVKHYGYENSVSG
FT                   H"
FT   sig_peptide     411560..411610
FT                   /locus_tag="Sulku_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            411951..412886
FT                   /locus_tag="Sulku_0423"
FT   CDS_pept        411951..412886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0423"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: tdn:Suden_0648 von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33090"
FT                   /db_xref="GOA:E4TZK2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK2"
FT                   /protein_id="ADR33090.1"
FT                   /translation="MLIGNISAMNIWSFDFAWAFLALPPILYCLYRCKVIPQKRYFPHL
FT                   QFFGNPGKWRNLEWLFKALAVTLMVGALATPVVVDYSDPRNRNGIDIVLSLDGSGSMNA
FT                   SGFSKEEPRLSRFEVVQKIASDFVMKRIEDNVGVVLFGDFAFIATPVTYEKEIVSEMIG
FT                   YLSHGMAGQNTAIGEGIAMGVRALRDSKAKSKVIILLTDGEHNSGSISPKEAVAMVGKE
FT                   HIRLYTIGIGQKGEFDNALLKQLAHDGHGKFFAAANEKELQSVYDEIDMLERSKIKSKQ
FT                   HTFEEHYYQWFGAAALGVLLILMWRRRIGS"
FT   sig_peptide     411951..412037
FT                   /locus_tag="Sulku_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            412883..414406
FT                   /locus_tag="Sulku_0424"
FT   CDS_pept        412883..414406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0424"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035: IPR001440: IPR019734: IPR013026;
FT                   KEGG: tdn:Suden_0649 von Willebrand factor, type A; PFAM:
FT                   von Willebrand factor type A; Tetratricopeptide TPR_1
FT                   repeat-containing protein; SMART: von Willebrand factor
FT                   type A; Tetratricopeptide repeat; SPTR: von Willebrand
FT                   factor, type A; PFAM: von Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33091"
FT                   /db_xref="GOA:E4TZK3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK3"
FT                   /protein_id="ADR33091.1"
FT                   /translation="MMFLTPLWLGALVIVPLYVWQVKRSGWSKQGWLLASIALLILSLA
FT                   RPVLPQKPVTAEEAGSDVIFAVDLSYSMRGTDLAPSRLEVAKKLLYDVVRSDQKDRFGV
FT                   IGFTTSAIVLSPLTKDTEMLEHLFSSLDESQIITKGTNVMSALELSRKMSHSARPIVIL
FT                   LTDGGDEASYEKESSFVRDNNLALSVVMLATNNGSTLPTSEGSSLKDENGHIVVSARND
FT                   AIEEIVNKGKVIRNTRAGEILSLIDSARENDFTGKTSVMRYQELFYVPLMLSLIAFVAA
FT                   FTTVGKKISRLFIPALALIGVSAQGGMLDFGYIYLAEINYTHGNFERSAELYRHVEGER
FT                   ARYNRANALYKAGKYADALGLYRSIRSNNASFKANIFYNMGNCHIRLQEFGEARESFLK
FT                   SLTLRYTRAADQNLRAITEVKEHQTLNVRKEKNDSFASEENKPTGAKKTSKEGGGSNMK
FT                   TDTASGGGGDEGKRAQSDPRFSMSQGKAALSSRQYELINQRSVHETKPW"
FT   sig_peptide     412883..413032
FT                   /locus_tag="Sulku_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            414387..415502
FT                   /locus_tag="Sulku_0425"
FT   CDS_pept        414387..415502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0650 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33092"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK4"
FT                   /protein_id="ADR33092.1"
FT                   /translation="MRRSLGRAVILMVLCPLLGWGAMYQWSVLKSPQSLYVNQSGVIRY
FT                   ECTFSTSAADYTITFNPISNESYKVSILTQRDQIIGGKRVQTFDVLITPKKEGNIDVSL
FT                   EALIRHTTFASIENASIGRDNVKKYDFDDEKAHLPKVVIEAKPNSAALSGELSLEVKVD
FT                   KRNALAHEPVHLSLYIRGRGNLDQYTPYELNISGVNIFGEEPIRDISPDPAGFAGEIRQ
FT                   EFAIVSDKSYVIPSITLDVFDSTTQKIKRLQSDSIAIEVAQGFERSDLLDPPGLRDWSN
FT                   LARYSLYAALVIAGAVLGEIARRLWRLRPRRKSKQFWDEAKNPKELAMFLALSGDKRYD
FT                   EIIGLLESGAVGLGEAKKKLSTLTTDKEEIA"
FT   sig_peptide     414387..414458
FT                   /locus_tag="Sulku_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            415499..416446
FT                   /locus_tag="Sulku_0426"
FT   CDS_pept        415499..416446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0426"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011703:
FT                   IPR016366; KEGG: tdn:Suden_0653 ATPase; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SPTR:
FT                   ATPase associated with various cellular activities, AAA_3;
FT                   PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33093"
FT                   /db_xref="GOA:E4TZK5"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK5"
FT                   /protein_id="ADR33093.1"
FT                   /translation="MIETINTIRSEVSKVVVGQEKMIDGLLIGLLCDGHILIEGIPGLA
FT                   KTTTVKALSQSLGLEFKRVQFTPDLLPSDILGAEVYDPKNNAFKIKKGPIFTNLLLADE
FT                   INRAPAKVQSALLEVMQERQVTLGDESFKLESPFLVMATQNPIENEGVYPLPEAQLDRF
FT                   MLKITVGYNTAEEELAIARRIASSTAEAIYAVIDADTLHALKERVKTIHIDEEVERYMI
FT                   ALVTATREPEKFGLESIKRYLQFGASPRVSIDMFKAVRAVAFLRGKEFVSPSDIASIIK
FT                   ELMRHRIVLSYEAEAEEVKVDDLIEQIIKAVPIP"
FT   gene            416449..417282
FT                   /locus_tag="Sulku_0427"
FT   CDS_pept        416449..417282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0427"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: tdn:Suden_0654
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33094"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK6"
FT                   /protein_id="ADR33094.1"
FT                   /translation="MKNSRHILLKARRQIIGDRIGNNPSMFRGEGYDFIELREYVSGDD
FT                   TRHIDWNITAKMQRPFIKVFREERELSVVTVAMLGGSLHFGQERFKIDALAEAVALIGY
FT                   SALANGDLFTHIDFSETLRNEVRASKKRFAVAQSVEGIMDTPILQHRADYNAMASSLYR
FT                   RLKRRSLIVVIGDFFEIPDLRLLAKKHEVVAVVVRDRFEEKPSPMGFSALIDPQSGAVL
FT                   EGDFNARSVRKYHEKVREHDAGLFDRLRRDGIRAAKLYTDASVSVVLRRLFEGRV"
FT   gene            417279..417677
FT                   /locus_tag="Sulku_0428"
FT   CDS_pept        417279..417677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0655 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33095"
FT                   /db_xref="GOA:E4TZK7"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK7"
FT                   /protein_id="ADR33095.1"
FT                   /translation="MSQMADIPVNDIAPLVQVHDYSIYLFGGSVTIAFVITLSLILFVL
FT                   KKWRARRLSERKRLYHLLGSIDLSDSKRAAYKISELGRIFSADNERTERAYHNLFERLE
FT                   PYKYAPKVEPFTEEVVGYYRLYLEIIDV"
FT   gene            417670..418410
FT                   /locus_tag="Sulku_0429"
FT   CDS_pept        417670..418410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0656 von Willebrand factor, type A;
FT                   SPTR: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33096"
FT                   /db_xref="GOA:E4TZK8"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK8"
FT                   /protein_id="ADR33096.1"
FT                   /translation="MFEGIYFQFPKLAFLLFFFLACEALCPLRSNPLYFPRPILFGEVG
FT                   VKPPIWLWIAKWAMIAFLVIALMSPVRDREAARHERGWDILLIVDPLLTGTAAIPQIIS
FT                   FMNRRMDERIALWVPENTIVPLTYEHKALISILKQTPVPESSGEATLNISRFFATSQEG
FT                   HKVAIIFSENPKSFLTTLPIGIQTAMISPLKEPQWADTLNRTYPSYKVKQSHRYFDYYY
FT                   VYPLFLGFLSMLAYLYGRNQKGIR"
FT   sig_peptide     417670..417741
FT                   /locus_tag="Sulku_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            418407..419543
FT                   /locus_tag="Sulku_0430"
FT   CDS_pept        418407..419543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0657 von Willebrand factor, type A;
FT                   SPTR: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33097"
FT                   /db_xref="GOA:E4TZK9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK9"
FT                   /protein_id="ADR33097.1"
FT                   /translation="MSFLHAEFFVWMVLPVLVLFYFWQTQKSPHSAVFGEAVFNRLHAP
FT                   EITMGLRTRNILFLIAALLLIAAMAQPVILQDEAASEGRADVLIALDLSKKSLEAFEEE
FT                   KRTAINTIRRLKGENIAVFGYDTRPYRITPYTTDSEMAAALVSGLDSEVMRQFKSDSSA
FT                   LDKFRSDEGMIIIIGDPTNEHNTRLSGIIERIEKIKTAQRLYVHVPLFYYPLGLAMVLI
FT                   WIALSSMSKRRSVPAAAILMALSIGNVSGHAGILDFQILNSGYRAYEKGDYLQSAHYFK
FT                   SYQNAHDSPEIRYNIANALYKAGAYREALYWYRQVHTSNPLLAQKAAYNLSLCEAKIHI
FT                   GSKSGENQKRDRDEPISHEIQPLPKKSPNEIKTRLYPM"
FT   gene            complement(419536..420372)
FT                   /locus_tag="Sulku_0431"
FT   CDS_pept        complement(419536..420372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0431"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="COGs: COG0287 Prephenate dehydrogenase; InterPro
FT                   IPR003099; KEGG: tdn:Suden_0659 prephenate dehydrogenase;
FT                   PFAM: Prephenate dehydrogenase; SPTR: Prephenate
FT                   dehydrogenase; PFAM: Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33098"
FT                   /db_xref="GOA:E4TZL0"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL0"
FT                   /protein_id="ADR33098.1"
FT                   /translation="MKIGIVGLGLMGGSMALALKHLSFISSIVGCDHNEEHQKIALQRK
FT                   LVESFMSFEELKQECDVIFLAIPVNGVIEFLQKSTDLAGSDKTLIDLGSTKALIVDAIP
FT                   PVIRSNVVAAHPMTGTEQFGPSAALEGLYAEKVVVLCDLEHSGATQRDTALRIFQAIGM
FT                   QIRTMGAAQHDRHAAFISHMPHVISYALANTVLAQEEKENILTLAAGGFRSMSRLAKSS
FT                   PAMWEDIFRQNRENVLEAVELFEVELQTLKTALKNEDYAELRREMKGANKLYEIFT"
FT   sig_peptide     complement(420313..420372)
FT                   /locus_tag="Sulku_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            420488..422728
FT                   /locus_tag="Sulku_0432"
FT   CDS_pept        420488..422728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0432"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="COGs: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; InterPro IPR016474: IPR010827: IPR000184:
FT                   IPR020785; KEGG: tdn:Suden_0660 surface antigen (D15);
FT                   PFAM: surface antigen (D15); surface antigen variable
FT                   number repeat-containing protein; SPTR: Outer membrane
FT                   protein assembly complex, YaeT protein; TIGRFAM: outer
FT                   membrane protein assembly complex, YaeT protein; PFAM:
FT                   Surface antigen variable number repeat; Surface antigen;
FT                   TIGRFAM: outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33099"
FT                   /db_xref="GOA:E4TZL1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL1"
FT                   /protein_id="ADR33099.1"
FT                   /translation="MKTITLSLIVASALVHASAQNVQSIHYDGMVHISEAVAKRLNEVK
FT                   VGEPLNAAAVDKTVKNFFEQGYFEDVWAEEEEGKVTFHFKEKPTISKIELKGYKENDEE
FT                   AKKALLQIDKGSLYDPKRVEEAKKRIVDALSQDGKIDSVVEIETEKLENGSMRVTFIAN
FT                   EGQEIIIKKLTYAGVLTQDSEEFDSMIANKEEQFMGWMWGRNDGKMKVAELQYDPLRIR
FT                   DFYMQRGFLDAKIDEPFVAVDFDHYTAQMSYNIFEGDVYRVSDILLFQDTKVIDDQALL
FT                   DVITLEKNKPFNIKTFREDAERIKTKIADLGYAYVQVQPDLKKDKEGKSVDVVYRIIPG
FT                   KKVHIRKVIISGNNRTLDRVVRRELFLAPGDLYSLTNLKDSRNAIGRTGYFESNTIEEK
FT                   RIDDETMDLIVQTKEAPTGNIQLGGGYGSFGGILVSVAVSDRNIFGSGINVGLNLEKSQ
FT                   RTSNYSFNISNPRLNDSDFSGNFSVYNSSTEYDSYSTDSKGISVGTGHRFNRFVNGYVG
FT                   YNYSQNSYSDIDLNTTTLDPRYYESYSKSSVVVSATFDNTDDYYVPREGMTLSESIEMA
FT                   GVGGDAEFWKSRTTFGVYQGLQKWTDFDLILRYKARFNYASEGGGYLPLGEKFYMGGIG
FT                   SVRGYQAYSISPTKGVDRNGDPYKIGGTQTFSNNLEFSVPLVPEAKMRATAFIDYGMIG
FT                   ESSISEIKRGGYGVSLEWFSPVGPLQLVFANPIGDKEHDDIAHFEFTIGQRF"
FT   sig_peptide     420488..420559
FT                   /locus_tag="Sulku_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(422882..424348)
FT                   /locus_tag="Sulku_0433"
FT   CDS_pept        complement(422882..424348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0433"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="COGs: COG0248 Exopolyphosphatase; InterPro
FT                   IPR003695; KEGG: tdn:Suden_0661 Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase; SPTR: Ppx/GppA phosphatase; PFAM:
FT                   Ppx/GppA phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33100"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL2"
FT                   /protein_id="ADR33100.1"
FT                   /translation="MAKCTAVIDIGSNSMRLAVFQKTSRFAFHILHEVKSSVRISENAY
FT                   KNGGYLQSDAMDRTALALGEFLSIAKSFDARKILCVATSAVRDAPNANIFLSRIRREYS
FT                   LSIKVISGEKEAYFGGVACANLLPPTLEALSVDVGGGSSEFALLRNGKVEQLYSLNIGT
FT                   VRIKELFFDTDNIPGAIAYIDEALKQLPSSLSTEALIGVGGTFRALSRALMKKESYPLN
FT                   KLHAYTTDSTAFLRFAGQIMEAAPKKLKSLFIKPDRFDTIKPGTLILDRIIRHIQAKTL
FT                   ICSGVGVREGVFLSDMLRNSGDTFPANYNPSVRYLLDTYAQHSTHAQQCAHLSKRLFAL
FT                   LHIPLEIDPSYRYELAIAAKLLSIGIGIRYYAYQRHSHYLAMSALDYGLSHPQLALISH
FT                   LLLFKKGASSSSLIPKDGYGKLLPDNATLDTLSSLLWLSHILLAARVDASEIELSLEGN
FT                   QLIIGGKSTYLAREQLKNIVLPKNLSVVFA"
FT   gene            complement(424349..424603)
FT                   /locus_tag="Sulku_0434"
FT   CDS_pept        complement(424349..424603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0434"
FT                   /product="4Fe-4S ferredoxin"
FT                   /note="InterPro IPR017900: IPR017896; KEGG: nis:NIS_0409
FT                   4Fe-4S ferredoxin; SPTR: 4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33101"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL3"
FT                   /protein_id="ADR33101.1"
FT                   /translation="MPLLIVDECIACDACREECPMDAIEEGDPIYIIDPDRCTECVGTY
FT                   DEPACIAVCPVDCIIPDKDNVETMQELLYKHKQLMEEEE"
FT   gene            complement(424687..425988)
FT                   /locus_tag="Sulku_0435"
FT   CDS_pept        complement(424687..425988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0435"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003660: IPR003661: IPR003594: IPR004358: IPR
FT                   005467; KEGG: tdn:Suden_0663 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SPTR: Histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33102"
FT                   /db_xref="GOA:E4TZL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL4"
FT                   /protein_id="ADR33102.1"
FT                   /translation="MFSKRSIRRRFLFQLIVASAALVILFSSFLYLFIKQSIYDEKQAE
FT                   LIGYAENISSYKSLLSTQQNNADTMMGLTVELITLSQNDEHLDFYETTHKDKSTTLTLI
FT                   YPFDFEHSSYLKVSRDITPTKRLLRKIMNSIYLINAVGFVVIILYAIAFSKMLIAPISA
FT                   LSRRLANMNEHLIRPIKVEQLPDEFEPLGETLNRLIARIQNFVKYQKELFIGAAHELKT
FT                   PLAVIKLKNQVTLIKKRTPEEYIEAIKITNQSVDEMNKIVADILNIGRQEGAQLEIPVQ
FT                   TDIIQILKKWEGDFKLLANSENKTLLTRFEPDAFSAVLQVTLLNQILQNFLQNALKFTP
FT                   EGKTILFQSHMNGVGIVIEVIDEGCGIDESVDLFAPFKRQGNKSGVGLGLFLAKSAAEA
FT                   IGATITLTNREDGIDGTCARLILPSKLCCVIPQR"
FT   sig_peptide     complement(425908..425988)
FT                   /locus_tag="Sulku_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(425967..426638)
FT                   /locus_tag="Sulku_0436"
FT   CDS_pept        complement(425967..426638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0436"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_0664
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33103"
FT                   /db_xref="GOA:E4TZL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL5"
FT                   /protein_id="ADR33103.1"
FT                   /translation="MRILIIEDEVTLNKTLAEGLKEFGYQSDVVETLKDGEYYLDIRNY
FT                   DLILMDWMLPDGNSVDIIPDIKSNTPKTVVVVLSARDDNESEIEALKSGADDYIRKPFD
FT                   FDVLVARIEARLRFGGSNIIEIDDLTINPEEEKIIYKEKEIELKGKPFEVLTHLARHRD
FT                   QIVSKEQLLDAIWEEPELVTPNVIEVAINQIRQKMDKPLGITTIETVRRRGYRFCFPKE
FT                   A"
FT   gene            complement(426717..427043)
FT                   /locus_tag="Sulku_0437"
FT   CDS_pept        complement(426717..427043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0437"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="COGs: COG1539 Dihydroneopterin aldolase; InterPro
FT                   IPR006157; KEGG: sun:SUN_1982 hypothetical protein; PFAM:
FT                   dihydroneopterin aldolase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Dihydroneopterin aldolase; TIGRFAM:
FT                   dihydroneopterin aldolase; FolB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33104"
FT                   /db_xref="GOA:E4TZL6"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL6"
FT                   /protein_id="ADR33104.1"
FT                   /translation="MKILIENLTFDAIIGILDFERTDPQQVQIDCTIDYTYTGDNFINY
FT                   ADIACMIETTVQTEQFELIETALEVLAAKLKLSFPLIDALSLTFRKPNILPNCTVGVQK
FT                   NFIF"
FT   gene            complement(427040..427654)
FT                   /locus_tag="Sulku_0438"
FT   CDS_pept        complement(427040..427654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0438"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="COGs: COG0344 membrane protein; InterPro IPR020788:
FT                   IPR003811; KEGG: tdn:Suden_0666 putative
FT                   glycerol-3-phosphate acyltransferase PlsY; PFAM: protein of
FT                   unknown function DUF205; SPTR: Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF205);
FT                   TIGRFAM: acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33105"
FT                   /db_xref="GOA:E4TZL7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL7"
FT                   /protein_id="ADR33105.1"
FT                   /translation="MDFLFNLNVQFYLAAYLLGGIPFGLILAKVFAGVNITEAGSQSIG
FT                   ATNVLRVVKETNPSLAKKLGAATLALDALKGIIVVLAAKYFELSDSAQWLVAVLAVVGH
FT                   CFSPYMWFEGGKGVATGMGVMAVMLPVPTVIALVVWAVAAKTIRISSLSSMLGLAALVV
FT                   SSFILYPAMFHAPVLFIAFILFYKHIPNFVRLVKGEEKRVA"
FT   sig_peptide     complement(427559..427654)
FT                   /locus_tag="Sulku_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            427808..428800
FT                   /locus_tag="Sulku_0439"
FT   CDS_pept        427808..428800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0439"
FT                   /product="quinolinate synthetase A"
FT                   /EC_number="2.5.1.72"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: tdn:Suden_0667 quinolinate synthetase;
FT                   PFAM: Quinolinate synthetase A; PRIAM: Quinolinate
FT                   synthase; SPTR: Quinolinate synthetase complex, A subunit;
FT                   TIGRFAM: quinolinate synthetase complex, A subunit; PFAM:
FT                   Quinolinate synthetase A protein; TIGRFAM: quinolinate
FT                   synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33106"
FT                   /db_xref="GOA:E4TZL8"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL8"
FT                   /protein_id="ADR33106.1"
FT                   /translation="MNTEELKQKIIDLKNRLSVTVVAHFYQRDEVFEMGDITGDSLELA
FT                   KRTMADDKEFVVFCGVGFMGQSVKILSPEKRVVMPKVACCAMAKMIDGLYYDQSIAKLE
FT                   EAGIKADDILPITYINSDAAVKARVGKMGGMVCTSSNAKIIITKALGEGKKILFVPDRC
FT                   LGQNIARQMGLKSCVIGDGTDPKEADIICYDGFCSVHQLFSVEDIEFYRNKYPGILIAV
FT                   HPECDPAICERADFVGSTSQLIKYITELPANQKVAVGTEFNMVNRLRPSNTYILSSTKP
FT                   ECPTMNETTLEDLYAVLKSIEEGAPINEIEVDEDTAHWAKIALERMMAL"
FT   gene            428797..429612
FT                   /locus_tag="Sulku_0440"
FT   CDS_pept        428797..429612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0440"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR004393: IPR002638; KEGG:
FT                   tdn:Suden_0668 nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; PRIAM:
FT                   Nicotinate-nucleotide diphosphorylase (carboxylating);
FT                   SPTR: Nicotinate-nucleotide pyrophosphorylase; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase, C-terminal domain; Quinolinate
FT                   phosphoribosyl transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33107"
FT                   /db_xref="GOA:E4TZL9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL9"
FT                   /protein_id="ADR33107.1"
FT                   /translation="MIEQFIREVLAEDVGRGDLYARVSDAVSASAKIIAKSDGVIAGEA
FT                   YLKVLAEIEKFNIIWHKHDGDRFVKGEVLMELSGDSHTLLRIERTLLNMLLHASSIATL
FT                   TRKYVDLIAPYGTKLLDTRKTRPLLRNFEKYATRIGGATNHRMGLDDALMLKDTHLKTI
FT                   TNLESFMEEARKKIPFTSKIEIEAEDFEMAAHAMRCGADIVMCDNMTVEQLTEVVKYKW
FT                   EHHSGVLLEASGNITLETIEAYAASGVDAISTGALIHQANWIDMSMKMD"
FT   gene            429616..430683
FT                   /locus_tag="Sulku_0441"
FT   CDS_pept        429616..430683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0441"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="COGs: COG1377 Flagellar biosynthesis pathway
FT                   component FlhB; InterPro IPR006136: IPR006135; KEGG:
FT                   tdn:Suden_0669 flagellar biosynthesis protein FlhB; PFAM:
FT                   type III secretion exporter; SPTR: Flagellar biosynthetic
FT                   protein FlhB; TIGRFAM: flagellar biosynthetic protein FlhB;
FT                   PFAM: FlhB HrpN YscU SpaS Family; TIGRFAM: flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33108"
FT                   /db_xref="GOA:E4TZM0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM0"
FT                   /protein_id="ADR33108.1"
FT                   /translation="MADDQEKTEEPTAKKLEDARAEGNVPKSQDVVGVVVLFVSILAVL
FT                   MMFTFIADRMLHLSQYYFSLMRQPLDRELMVDLAVVTMKEFLIMALPVSIIVAVAGVFG
FT                   TVAQIGFNFTTKPLTPNFSKLDPIKGFANLFTLQKGLESIKITLKSFTALGIGFLYFWY
FT                   FVEELPTVALFTLQDQMGWLRDKAIVLASVMLLIIFVYAVIDLFLVRKHYFDKLKMSLQ
FT                   EIKDEMKNMEGDPHIKAKIRQIQMQAARKRMMTSVPTADVVITNPTHYAVAIVYDENKH
FT                   NAPVVVAKGVDNMAIQIKKVARENGVHIVQNPPLARSLYKEVDIDHPIPDMLFAAVAEV
FT                   LAYVYKMGKKRKGNS"
FT   gene            430683..431810
FT                   /locus_tag="Sulku_0442"
FT   CDS_pept        430683..431810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0257 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33109"
FT                   /db_xref="GOA:E4TZM1"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM1"
FT                   /protein_id="ADR33109.1"
FT                   /translation="MERWVGLLSNKKVIASVFLVIMAILGIVLWQLEKKVTSQTLERLS
FT                   DQLSLAINNQLEKERSSALRYALILSQNTALSDALERDDEDKGFKILSEGMESIKVHTD
FT                   SLIRSQVITSDYVIFARSWDNSYAGMPLEFHRPDLLYFQNHKNPRSAIEVGRKLGVKAT
FT                   VPVYRDDKMLGFVEVVSFFESTQEYFDRLGIDMYVLMDVRFYDTAVFMQENPTIAKEYI
FT                   LANPKYTQSDLKLLNGIDFKTLKHTHVVFSGGRYLFFEPMKNGEGETIGAFVFSLSPKQ
FT                   INAYAHSDEEDISFLIHLSRNELYDVMIKKSLDDGLFQSVYDKELLYLKDTVAPEDREL
FT                   FVQEAHERLDAYSKEELIGIMLNYKVTKEIKGEIR"
FT   sig_peptide     430683..430784
FT                   /locus_tag="Sulku_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            431807..432460
FT                   /locus_tag="Sulku_0443"
FT   CDS_pept        431807..432460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0443"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_0258
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33110"
FT                   /db_xref="GOA:E4TZM2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM2"
FT                   /protein_id="ADR33110.1"
FT                   /translation="MRVLLLEDEYMLRVSITEFLEELGYEVAGFSNGEKAYDAIYETRF
FT                   DLYLLDVNVPGMNGFELLRALRKEGNKTPAIFLTSMVNVNDLQEGYKSGCCDYIRKPFD
FT                   LTELQLRIMHALKSHYHDGENTIDFGGGLVYDTEHFSLNHNDKAIALSKTEKEIFAVLL
FT                   KHTNQIVSVEMFQDEIWGEYVDPANIRVQINNLRKKLPLDIIQNRRGLGYIIER"
FT   gene            432450..433613
FT                   /locus_tag="Sulku_0444"
FT   CDS_pept        432450..433613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0444"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661: IPR003594: IPR004358: IPR005467; KEGG:
FT                   tdn:Suden_0259 histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SPTR: Histidine kinase; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33111"
FT                   /db_xref="GOA:E4TZM3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM3"
FT                   /protein_id="ADR33111.1"
FT                   /translation="MNDKLYALKNAFIYTMLVAVLLLVPTYVYVAYMKYVYEIQYEFKL
FT                   KRESHLILRSMEEFDVKEKQVFDYPRFRSFQSGLYDEHFKPMFSLIEYPIENQKVGYYV
FT                   DNGYGYLVISLPEHRYFGASYLVVGGELSYTRIYQDVVIILLSIAVLIFVLSLFFLDRF
FT                   ALPFQRVNQRLDRFIKDSMHEINTPLSIINVNIDLYNRSNPPNKYLQRIKAATKTLATL
FT                   YNDMDYLIKNERLSFEYEEIDLSRYLQDRIDYFYEVAALKNIAVESRIEDDIFIQFNPT
FT                   QLQRIIDNNLSNAIKYSHEEGKIEVILERIGDICVMRFQDYGVGIENVERIFERYYREN
FT                   RDKGGFGIGLNIVKSIIDKAGIELHIDSIYGKGTTFSYTFFPPIFIL"
FT   sig_peptide     432450..432542
FT                   /locus_tag="Sulku_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            433692..434213
FT                   /locus_tag="Sulku_0445"
FT   CDS_pept        433692..434213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0445"
FT                   /product="monoheme cytochrome SoxX"
FT                   /note="InterPro IPR009056; KEGG: tdn:Suden_0260 monoheme
FT                   cytochrome SoxX; SPTR: Monoheme cytochrome SoxX; PFAM:
FT                   Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33112"
FT                   /db_xref="GOA:E4TZM4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM4"
FT                   /protein_id="ADR33112.1"
FT                   /translation="MRKVIMLGLATFLSAADLSQVIESPDATAILKKDALPAAKAYVMP
FT                   EGCVSNDPKAIARGSYIFHNLNGKDAKENPPEGLTRLLPNGKEKQMGNCVACHNIEGAK
FT                   GYGNIGPDLTNYKELYMDSGVRNPQFMYQKIADPRLDNPKSAMTVNLANGLMNEREVCD
FT                   LVSYITAVKK"
FT   sig_peptide     433692..433778
FT                   /locus_tag="Sulku_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            434233..434703
FT                   /locus_tag="Sulku_0446"
FT   CDS_pept        434233..434703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0446"
FT                   /product="thiosulfate-binding protein SoxY"
FT                   /note="COGs: COG5501 secreted protein; InterPro IPR006311:
FT                   IPR016568: IPR017909; KEGG: sun:SUN_0498 sulfur oxidation
FT                   protein SoxY; SPTR: Twin-arginine translocation pathway
FT                   signal; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33113"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM5"
FT                   /protein_id="ADR33113.1"
FT                   /translation="MERRSFLKGFGAAAACAIALPHVASAAEEKKSGGPNEMNFETAVA
FT                   AITGGKALTPSAKVKMEAPEIAENGAVVPVKVTVDSPMSAKEYVKAIHILASKNGNVRC
FT                   ANIYLTPANGEAYFGTRIKLGGTQDVVAIAEMSDGTFLSAKQNVKVTIGGCG"
FT   sig_peptide     434233..434310
FT                   /locus_tag="Sulku_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            434753..435079
FT                   /locus_tag="Sulku_0447"
FT   CDS_pept        434753..435079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0447"
FT                   /product="sulfur compound chelating protein SoxZ"
FT                   /note="InterPro IPR014880; KEGG: nis:NIS_1830 hypothetical
FT                   protein; PFAM: Sulphur oxidation protein SoxZ; SPTR:
FT                   Putative uncharacterized protein; PFAM: Sulphur oxidation
FT                   protein SoxZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33114"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM6"
FT                   /protein_id="ADR33114.1"
FT                   /translation="MKTLIKIKPKDYKAGDIVKIDFMAMHPMETGMRKNKDTGALIPAE
FT                   YIDEVKFMFNDTLITKMVIWESLSVNPLMSISFKVPGAGTLKVIAKDNKGQSVETTSAI
FT                   NPKG"
FT   gene            435083..435856
FT                   /locus_tag="Sulku_0448"
FT   CDS_pept        435083..435856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0448"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR009056; KEGG: nis:NIS_1829 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33115"
FT                   /db_xref="GOA:E4TZM7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM7"
FT                   /protein_id="ADR33115.1"
FT                   /translation="MRTLSITAALVCLAFLATANAEEKLSMSDADKKMYAELLESNPAE
FT                   MDVAEGEQLFGELIGNANYAKMLGVKEKDLPKFIAGFPRYLEPAKRVVTIAQSIQMAAA
FT                   ANDKPVPKLESNEMVKMSAYVKSIANGQKTNIDVKANKHMVEMMKLGQQVFEERRGGRG
FT                   LSCNNCHSADIVGQRLRMQPLPDLGAKETAAAGTWPAYRMTQSQMVTLDKRMQQCMKNA
FT                   LLAEIPLGSKEIVALEVFVTNKTKGNNISVPSVKR"
FT   sig_peptide     435083..435145
FT                   /locus_tag="Sulku_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            435866..437632
FT                   /locus_tag="Sulku_0449"
FT   CDS_pept        435866..437632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0449"
FT                   /product="sulfate thiol esterase SoxB"
FT                   /note="COGs: COG0737 5'-nucleotidase/2' 3'-cyclic
FT                   phosphodiesterase and related esterase; InterProIPR006311:
FT                   IPR008334: IPR006179: IPR006146: IPR 017909; KEGG:
FT                   tdn:Suden_0264 sulfate thiol esterase SoxB; PFAM:
FT                   5'-Nucleotidase domain-containing protein; SPTR: Sulfate
FT                   thiol esterase SoxB; PFAM: 5'-nucleotidase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33116"
FT                   /db_xref="GOA:E4TZM8"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM8"
FT                   /protein_id="ADR33116.1"
FT                   /translation="MDLSRRDFFHIAAALGLGAPALASAASGPKRVDEVGLKDIYSFNA
FT                   RGNVTLLHICDMHAHLKPLYWREPSTLISAPNLTGTPGFLCGESFLKHYGMKGKSLDAY
FT                   FDTYMNFDAMAHKFGKMGGIAHMKTLINHIKKERGADNVMLLDSGDTWQGTGVALKTKG
FT                   EAIVKAQNYLGVDVMVGHWEFTYGKTRVKELIEMLNAKFVSQNIIGDDSFADDFEELIF
FT                   EPYTIMERGGAKIGIIGQSFPFTSTANPKEFTQGWSFGLRLDTLQTYVDKLRKEEKVDC
FT                   VVVLSHDGFSVDQEVARQVKGIDFILSGHTHDPSPQPTVINGTVIVIAGSHGKYIGRLD
FT                   IDIKNHKVKGYEYKLIPVAANLIPADPEGEALVKELYSPYDSELSEVLGITKNTLFKRD
FT                   TFHSTFDQLINDSIIDAMDSDISFTPGYRWGTTVLEGDAITMDHVYDMTAITYPNVYTF
FT                   ELTGKHIRTLLEDIADNVFNANPLYQQGGDMSRLGGVTYEIRVGAASGKRITNIMVGGK
FT                   PLSDTKVYKVSSWGGNLQNAGSNLKENLTRPVYDVTSAYIRRQKNVNISGNSNVRLVDY
FT                   DCGCPKKGAKGC"
FT   sig_peptide     435866..435940
FT                   /locus_tag="Sulku_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            437673..439163
FT                   /locus_tag="Sulku_0450"
FT   CDS_pept        437673..439163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0450"
FT                   /product="outer membrane porin"
FT                   /note="InterPro IPR005318; KEGG: tdn:Suden_0265
FT                   hypothetical protein; PFAM: outer membrane porin; SPTR:
FT                   Putative uncharacterized protein; PFAM: outer membrane
FT                   porin, OprD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33117"
FT                   /db_xref="GOA:E4TZM9"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM9"
FT                   /protein_id="ADR33117.1"
FT                   /translation="MNIMKISMAAAAACLLATSAHALKTEDRDLKGNNIVEYTKAPGDV
FT                   NSIKEMFTEGKVYGRLRSNTFWYNSDNEKSTLQDHNVWGLGGSLVYKTGFFHGFGATAG
FT                   FYGSVPLGSPNVPEGSTTNYGKQGKDIYRTRSDGTEAAMGVVAQAYGEYKISKSNIKLG
FT                   RQMIESTLLSSNDTKMIPNTFTAAVAETKDIKDTTLRAGYITSEKLRNHQEFHSILAYA
FT                   SLTENDDAATHKGLKIANITRAGEDKDPEMVLVTAENKSIPGLKLEGEYYGINGYFSTV
FT                   IAEANYKIGLGNDWTLTPGVRYLRQMDDGAGAIGGASLSGKAATTVNGGTTAGRAAYSD
FT                   ASSVDASMWAARLVAAKGPLELQVGYSKIADDADLITPWRGFPTGGYTRSMGQVDWIAN
FT                   TKNWALKATYDFDKAGLVPGLKISADYENMNFDDSKAATTGFTDRDIIHLDAWQTFKSL
FT                   PNTEFKFRFATIDADPAVGATTDYNSYDEYRFEINYLF"
FT   sig_peptide     437673..437738
FT                   /locus_tag="Sulku_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            439174..440079
FT                   /locus_tag="Sulku_0451"
FT   CDS_pept        439174..440079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0451"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; KEGG: nis:NIS_0439 hypothetical protein; SPTR:
FT                   Metallo-beta-lactamase domain protein; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33118"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN0"
FT                   /protein_id="ADR33118.1"
FT                   /translation="MKTLLVSFFFAVTSLSAYDYALKPVRVSEDIHCFFGKPEIMDKTN
FT                   NGNIVNSCYIDAKEGYVVVDTGPSYAYAESAYKAMKKIKSLPVKLVINTHIHDDHWLGN
FT                   NYFTEQGIRVVGTDDFKVNADMSVPSRMQTHISADAYSKTVPTMPSEMINSDTTLKIGN
FT                   QTLELKIAKRKAHTAKDMVVFLPKSKVLIAADLVFNDRLPSVRGGDINGWLSALEDLDK
FT                   LDAVHVVGGHGNRTDKDAARMTREYFTQMRTEIRAAIADGLGIDDTIKKVSMDKYKKYK
FT                   LYEETHRHNVESSYRVLEWE"
FT   gene            440082..440516
FT                   /locus_tag="Sulku_0452"
FT   CDS_pept        440082..440516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0452"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1416 conserved hypothetical protein; KEGG:
FT                   nis:NIS_1825 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33119"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN1"
FT                   /protein_id="ADR33119.1"
FT                   /translation="MKRLLMVLGLVSTLAYGDIRFAQPEPSIEKPREVVMGISHGDDES
FT                   IHHGLSTANNVLKFYGPEKIHLRIVAYYHGIRTLLKSEKEIAVRVRALQQYGVEFVACG
FT                   NTMETKKITPDQLDDDVEIVSAGIAEVIERATEGAFYIQP"
FT   sig_peptide     440082..440147
FT                   /locus_tag="Sulku_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            440526..441425
FT                   /locus_tag="Sulku_0453"
FT   CDS_pept        440526..441425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0268 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33120"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN2"
FT                   /protein_id="ADR33120.1"
FT                   /translation="MKILLVTILAGFLSLFGGDLHLFSVSNADGKYNASVIEKALEANG
FT                   FVISANSEMNGPFKIQFGQSDFSQFNLLTAYHKAHSEALVKANPDAGIFVPMGFGIYQR
FT                   NGDKNLHVSILTAKSMEKIAGFKAKEFALIEKEAIATLKKALSGAKITQSETSLPAEGK
FT                   LLSRFVKASSKESWASDKEETEMMIEDGLKPAGFVMSNFTDYNFALGQKSPFDFYDTYS
FT                   ICKLKVIYTVAKTRPEAAAFAPCTLMVYKKKDADEIVMGFPGVYNWMSSARVDNLEAKE
FT                   TLLQAQKDFEGVLKSVIE"
FT   sig_peptide     440526..440597
FT                   /locus_tag="Sulku_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            441479..442411
FT                   /locus_tag="Sulku_0454"
FT   CDS_pept        441479..442411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0454"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="COGs: COG0618 Exopolyphosphatase-related protein;
FT                   InterPro IPR001667: IPR003156; KEGG: abu:Abu_2037
FT                   exopolyphosphatase-related protein; PFAM: phosphoesterase
FT                   RecJ domain protein; phosphoesterase DHHA1; SPTR:
FT                   Exopolyphosphatase-related protein; PFAM: DHH family; DHHA1
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33121"
FT                   /db_xref="GOA:E4TZN3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN3"
FT                   /protein_id="ADR33121.1"
FT                   /translation="MPLSLIDSADHIVLVAHKNPDADSLGAACAFYSYLLRSQKKITLF
FT                   CASSAVNPNLAFLPWFEKITDRFPDNADCIISFDCGSYGRLGIEKELPLINIDHHASND
FT                   FYGTHNLVNTHAISTTEVLYDYFVANGIKINGKMALSLYAGLLDDSKCFSASECSAKTF
FT                   SMAHALIELGADHAVCTEWLYRRGSLASLRVRGSLFKQMKLVLDGQLAVFEIPFVLLEE
FT                   TGASVAECKSAMDEALGMRSVKAALMVVHFPGKGIKLSLRTNGTVNAAAIMAEFGGGGH
FT                   VKRAGTYLKQENYDELIQTMMVKITKELV"
FT   gene            442408..443778
FT                   /locus_tag="Sulku_0455"
FT   CDS_pept        442408..443778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0455"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   tdn:Suden_0671 peptidase M23B; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23B; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33122"
FT                   /db_xref="GOA:E4TZN4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN4"
FT                   /protein_id="ADR33122.1"
FT                   /translation="MRRGRKNSGIVGWILVAAVLAALGFMAFSPVFERDDPKVTLSQEG
FT                   YWNFQDPIHVNVEDVSGLKSYKATISTPHDEWVVVDENNPSHEIKKSFDIRPPKGVRRV
FT                   DSNSIVLKIEATDNSLWGLFMGNTFKQEYTLVIDQRRPVLSIIANSYKIQKGGSAIVIF
FT                   KAEDANLESLKIQTNFGKTFIAQPFMKEGYYASLVAWPVQEASFSATVVARDKAGNEVR
FT                   NAIPLRLKDHVYRVSNIELSDQFLDGKIAELANTYEQTAGVDDRLEQFRIINEKVRADN
FT                   EKIIHGITSKVSKNMITDFNPVPFYPLVNGQKVADFGDHRIYSYKGQENVSQAYHMGLD
FT                   LASVAMGPITSSNGGKVVFSQPNGIYGNLPIIDHGFGLYTLYGHCSEVHVQEGDTAAIA
FT                   QEIAKTGLSGYAMGDHLHFGILVQGIEVRPEEWMDSKWIADNITSVIDNAKAIINQH"
FT   sig_peptide     442408..442494
FT                   /locus_tag="Sulku_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            443828..444712
FT                   /locus_tag="Sulku_0456"
FT   CDS_pept        443828..444712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0456"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="COGs: COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase; InterPro IPR004463; KEGG: tdn:Suden_0672
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; SPTR: UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase; TIGRFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase; PFAM: UDP-3-O-acyl
FT                   N-acetylglycosamine deacetylase; TIGRFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33123"
FT                   /db_xref="GOA:E4TZN5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN5"
FT                   /protein_id="ADR33123.1"
FT                   /translation="MMQTTIGKSVELVGIGLHRGSPVKLRLEPLGVNSGIVFYRSDAGV
FT                   SIPLIPANVVDTKMATVIGREGVTISTIEHMLSAIYAYGIDNLRVIVDADEIPVMDGSS
FT                   MSFCMLLEEAGVVAQDTPKKIMRIKKEVIVQEGDKYVKLIPSNGMNYDFTIKFSHPVID
FT                   KQSYVLAFTKENYKKEIARARTFGFVHEVQYLRSKGLALGGSLENAVVLDDKKVLNPEG
FT                   LRFGDEFVRHKILDAIGDMSLIGMNFIGNYEAYAGSHDLNHKLTLALLKDPANYEVVEL
FT                   ASAESKELAKAYA"
FT   gene            444705..445157
FT                   /locus_tag="Sulku_0457"
FT   CDS_pept        444705..445157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0673 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33124"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN6"
FT                   /protein_id="ADR33124.1"
FT                   /translation="MHDALVIALSSPILIGIYKDGVLVEEIREDGMSSDVLAEIFESLL
FT                   KRYTFRTFIYAKGPGSFMGIKVTYLFLKTLSITLKIPLLATDAFFFNQNSPIKAVGKLY
FT                   FVKNRTTIELEPIESPELIAFSLPENIDLKKFDSDTLPYYGIDAVG"
FT   gene            445167..446048
FT                   /locus_tag="Sulku_0458"
FT   CDS_pept        445167..446048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0458"
FT                   /product="homoserine kinase"
FT                   /note="COGs: COG0083 Homoserine kinase; InterPro IPR000870:
FT                   IPR006204: IPR006203; KEGG: tdn:Suden_0674 homoserine
FT                   kinase; PFAM: GHMP kinase; SPTR: Homoserine kinase;
FT                   TIGRFAM: homoserine kinase; PFAM: GHMP kinases C terminal;
FT                   GHMP kinases N terminal domain; TIGRFAM: homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33125"
FT                   /db_xref="GOA:E4TZN7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN7"
FT                   /protein_id="ADR33125.1"
FT                   /translation="MFVSVPATSANLGPGFDSLGLAVDLRNQVELVPSRFFAVSIKGEG
FT                   ENNPRLKGNNLFVSIFNEHYRRLTQKRQNFKFTFYNQIPMSRGLGSSSAVIVSAISCAH
FT                   EAAGVKVSKRRILNHALVYESHPDNITPAVMGGFNAAMVEKQKVFSQQKHLPDYLKAVV
FT                   VIPNKPISTAKSRTTLPKSYSKENAVFNLSHTAVTVGAFFNEDWEMLRLATQDRFHQKV
FT                   RMKMLPELFAVQKMAYDNGALMSTLSGSGSTFFNMVYDQDAKMLADKFKAEFSDFEIKI
FT                   LGFDNDGLVVER"
FT   gene            446069..446323
FT                   /locus_tag="Sulku_0459"
FT   CDS_pept        446069..446323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0459"
FT                   /product="protein of unknown function DUF448"
FT                   /note="InterPro IPR007393; KEGG: tdn:Suden_0675
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF448; SPTR: Putative uncharacterized protein; manually
FT                   curated; PFAM: Protein of unknown function (DUF448)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33126"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN8"
FT                   /protein_id="ADR33126.1"
FT                   /translation="MAQKLHQPIRMCVVCRERFAQVGLLRLQCRNGKLEPYGKEGRSFY
FT                   MCRSCIEHKKTPGQLSRQCKSGATVELMNRLKEIIVNDG"
FT   gene            446313..448850
FT                   /locus_tag="Sulku_0460"
FT   CDS_pept        446313..448850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0460"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="COGs: COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase); InterProIPR000178: IPR005225: IPR006847:
FT                   IPR000795: IPR 004161; KEGG: tdn:Suden_0676 translation
FT                   initiation factor IF-2; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2
FT                   domain-containing protein; elongation factor Tu domain 2
FT                   protein; SPTR: Translation initiation factor IF-2; TIGRFAM:
FT                   translation initiation factor IF-2; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2;
FT                   Translation-initiation factor 2; Translation initiation
FT                   factor IF-2, N-terminal region; Elongation factor Tu GTP
FT                   binding domain; TIGRFAM: small GTP-binding protein domain;
FT                   translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33127"
FT                   /db_xref="GOA:E4TZN9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZN9"
FT                   /protein_id="ADR33127.1"
FT                   /translation="MMDKVRVHEIAKELGINSKEVVDKAAAMGLNVKTASSSVSIEEAE
FT                   QIMNYIMSGASTETAAPKPTSKAAPAEETPAVTVPPKTEHAPVAAAVSEVKDEPSEEAP
FT                   ADIEAPKRSGLKIVKKKRPQEEEFVAPVRQESIAVSSYGKLSEQAQRELEAKRAKKAQS
FT                   SNAPVQKKDQGVRLDIFGGGISDISMDYEEDQVVLMDFNDLGGKVEPEEEQKPKEKKPI
FT                   GRNAGKKQGANRNKPRQVSREARKKYTRDAKEDEVITHVEIPEDIRVYEFADKVRQPLS
FT                   EVIKILFNLGMMVTKNDFLGKDEIEILASEFGVEVTTIDPKDAFNYEDSYEEDNEDSAD
FT                   LEERPPVITIMGHVDHGKTSLLDAIRNAKVAHGEAGGITQHIGAYSVEQHGKLITFLDT
FT                   PGHEAFSSMRARGAQLTDIIVIVVAADDGVKPQTRESVKHAQEAKVPVIVAINKMDKPG
FT                   ANPDMVKAQMAELGLNPVDWGGDVEFVGVSAKAMTGIDELLEAILLQAEIMELKANPNN
FT                   MAKAVVVESTLEKGRGPVATVIVQNGTLKIGDNIVCGSAYGRVRALISDRKAQLQKIGP
FT                   SETAVVVGLSDVPPSGEILMVMESDKEAREFAQKRYEYDRHRELSHSTKTTLDELSSLI
FT                   AEGRLKALKVVLKTDVHGSLEAIRSALAELRNEEVKVEVISSGVGGITENDVALVNNSE
FT                   NCMLVGFNVRPTGNVNAMAKQMGIKINTYSIIYQLIDDVTAMLTGMMAPQFREENTGQA
FT                   EVRDTFPMPKGGGTIAGCVVVDGKLVRGGMVRVIREGVVIHEGDLTSLRRFKDDVKEVT
FT                   KGFDCGVVLNGYTDVKVGDVIETFTKIEKKVSL"
FT   gene            448847..449212
FT                   /locus_tag="Sulku_0461"
FT   CDS_pept        448847..449212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0461"
FT                   /product="ribosome-binding factor A"
FT                   /note="COGs: COG0858 Ribosome-binding factor A; InterPro
FT                   IPR000238; KEGG: tdn:Suden_0677 ribosome-binding factor A;
FT                   PFAM: ribosome-binding factor A; SPTR: Ribosome-binding
FT                   factor A; TIGRFAM: ribosome-binding factor A; PFAM:
FT                   Ribosome-binding factor A; TIGRFAM: ribosome-binding factor
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33128"
FT                   /db_xref="GOA:E4TZP0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZP0"
FT                   /protein_id="ADR33128.1"
FT                   /translation="MTPAQIKVKRTESILKELIPEAISQLSDARVREVDVIDVHCSRGR
FT                   SDAKVYLDPHDYTPQEQAAFLKLLEKARPIIEEHCMKDQGWFRSPRMTFVFDDTLKRSQ
FT                   NIEALFAQIAKEKKDES"
FT   gene            449202..449633
FT                   /locus_tag="Sulku_0462"
FT   CDS_pept        449202..449633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0462"
FT                   /product="protein of unknown function DUF150"
FT                   /note="InterPro IPR003728: IPR020790; KEGG: abu:Abu_2045
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF150; SPTR: Ribosome maturation factor rimP; PFAM:
FT                   Uncharacterised BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33129"
FT                   /db_xref="GOA:E4TZP1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZP1"
FT                   /protein_id="ADR33129.1"
FT                   /translation="MSLESDIKKMVESIGLSLYDTAVFNENENTIFRVSVTAPGGVSLD
FT                   QCVEATHLISPLLDVTPPVGGEYRLEVSSPGIERKLKTLDHFAQSVGEKVVFSTVNKEK
FT                   FDGEVVSVENEEITIKTKEGETHTVPFRSISKAKTYFEW"
FT   gene            449633..450643
FT                   /locus_tag="Sulku_0463"
FT   CDS_pept        449633..450643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0463"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /note="COGs: COG0117 Pyrimidine deaminase; InterPro
FT                   IPR004794: IPR002125: IPR002734; KEGG: tdn:Suden_0679
FT                   riboflavin biosynthesis protein RibD; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; bifunctional deaminase-reductase
FT                   domain protein; PRIAM:
FT                   Diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   SPTR: Riboflavin biosynthesis protein RibD; TIGRFAM:
FT                   riboflavin biosynthesis protein RibD; PFAM: RibD C-terminal
FT                   domain; Cytidine and deoxycytidylate deaminase zinc-binding
FT                   region; TIGRFAM: riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33130"
FT                   /db_xref="GOA:E4TZW5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW5"
FT                   /protein_id="ADR33130.1"
FT                   /translation="MNTTAAIHAMTLALNAAWEYQLLTFPNPAVGAVCLSDNGTVVSVG
FT                   THKRAGGPHAEVYALRDAYTLLSGDTTIAGCDDSHRIHDYLRTRHNGIFHTVSMAVTLE
FT                   PCSHSGKTPSCALLIRDLGIKRVYISVKDPNPAAAGGASLLSDAGAECVFGIMEEEGEK
FT                   LLEPFIRWQKSPFVFFKWAQRLDGTIDNGTISSQSSREHMHALRDRCDLIVIGGNTVRH
FT                   DRPTLDARLVDGKAPDVLIYSQMGEFDQSIPLFSVPDRKVYVESSLERLKEYSLVMIEG
FT                   GTSMFQASQNTCDWYLCYLAPKLGGGLQNMGPIQEDFEVLHAKITDNILLWMKKK"
FT   sig_peptide     449633..449725
FT                   /locus_tag="Sulku_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            450652..451362
FT                   /locus_tag="Sulku_0464"
FT   CDS_pept        450652..451362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0464"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR004033;
FT                   KEGG: tdn:Suden_0680 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase; SPTR:
FT                   Demethylmenaquinone methyltransferase; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferase;
FT                   PFAM: ubiE/COQ5 methyltransferase family; TIGRFAM:
FT                   ubiquinone/menaquinone biosynthesis methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33131"
FT                   /db_xref="GOA:E4TZW6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW6"
FT                   /protein_id="ADR33131.1"
FT                   /translation="MTKQEKIVSMFNDIAPTYDRANRVLSMGVDTFWRRKACDLAFGYC
FT                   PSEKIDSIVDVACGTGDMMGYWRRQAEKNGVHVSNIEGVDPSEGMVGVGREKFPQMSFY
FT                   IAPATELPKPDTTADIISISYGIRNVVERQAGLREFNRVLKPGGLVVILEFMKNENPSM
FT                   LGKVRDWYMNNVLPRIGGLISNNYEAYRYLPDSIEGFLTVAKMKQELEEAGFEMLYSKS
FT                   FSMDISTLMIARKK"
FT   gene            451367..452629
FT                   /locus_tag="Sulku_0465"
FT   CDS_pept        451367..452629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0465"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="COGs: COG1570 Exonuclease VII large subunit;
FT                   InterPro IPR003753: IPR004365: IPR020579; KEGG:
FT                   tdn:Suden_0681 exodeoxyribonuclease VII large subunit;
FT                   PFAM: Exonuclease VII, large subunit-like; nucleic acid
FT                   binding OB-fold tRNA/helicase-type; SPTR:
FT                   Exodeoxyribonuclease 7 large subunit; TIGRFAM:
FT                   exodeoxyribonuclease VII, large subunit; PFAM: Exonuclease
FT                   VII, large subunit; OB-fold nucleic acid binding domain;
FT                   TIGRFAM: exodeoxyribonuclease VII, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33132"
FT                   /db_xref="GOA:E4TZW7"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW7"
FT                   /protein_id="ADR33132.1"
FT                   /translation="MASTLSVSSLNEQIKTLLETSFEFVSVEGELSRVTKHGSGHIYFT
FT                   LKDNESAIKCVMFKGNASRLKFSLEEGAHVILHGALSLYKPRGEYQINAFSAEPYGAGA
FT                   LAVAFEQLKQKLEAKGYFDPTRKKPFPKFPQTVVLVTSATGAALQDMQRVATQRWPLVK
FT                   LIVLDVLVQGPSASGQIADALRTADTLHADAVVVGRGGGSIEDLWAFNEEIVADALYAM
FT                   KTPTISAVGHEIDWVISDYVADMRAPTPSAAMQMLLPDQNELSQSIDEIRYGAYGMITQ
FT                   RLERKREQLLSMQEAFKRHGVEHRLEVQQELIKELRERLNRQMTQRLEQSRREIIPLME
FT                   RLSQNIESILRQKQFMITQLSEGFNANHPKNKNKSGFAQIAREGKVIDLDALSVGDRFE
FT                   AMNDKRVVRAEVVEIVSINVD"
FT   gene            452697..452990
FT                   /locus_tag="Sulku_0466"
FT   CDS_pept        452697..452990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0466"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: ant:Arnit_1006 DNA polymerase beta
FT                   domain-containing protein region; PFAM: DNA polymerase beta
FT                   domain protein region; SPTR: DNA polymerase beta domain
FT                   protein region; PFAM: Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33133"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW8"
FT                   /protein_id="ADR33133.1"
FT                   /translation="MTKNEILEILKTLKPRYEQDGLILVGLFGSFSRGEEKSDSDVDIV
FT                   YEIEKGKTFSMFKYLKYLADLEKYLNHKVDLVRAETIKSDLKPYIYKDMIYV"
FT   gene            452983..453327
FT                   /locus_tag="Sulku_0467"
FT   CDS_pept        452983..453327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0467"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: ant:Arnit_1007 hypothetical
FT                   protein; PFAM: protein of unknown function DUF86; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33134"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZW9"
FT                   /protein_id="ADR33134.1"
FT                   /translation="MSRDWKFYLRDILAECQNIRKFTANITFEEFTENTEKVYATAKAF
FT                   ENIGEAVKQIPKEIQDEYSSVPWSEIAKMRDVLTHHYFGLDDKVLWDTLADDFIMFEEV
FT                   VEEIAKKYLD"
FT   gene            complement(453398..454270)
FT                   /locus_tag="Sulku_0468"
FT   CDS_pept        complement(453398..454270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0468"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR004635: IPR002142; KEGG: tdn:Suden_0685
FT                   peptidase S49, SppA; PFAM: peptidase S49; SPTR: Peptidase
FT                   S49, SppA; TIGRFAM: signal peptide peptidase SppA, 36K
FT                   type; PFAM: Peptidase family S49; TIGRFAM: signal peptide
FT                   peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33135"
FT                   /db_xref="GOA:E4TZX0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX0"
FT                   /protein_id="ADR33135.1"
FT                   /translation="MIEFVKKIGSCLARGLKFIQEHFKATVLVLIVLWLIIPSSENGIT
FT                   PHNLQKIALSGPILDATPIVAQIDEARENDGIKGVLFSIDSPGGAVAPSVEIAYAIKRL
FT                   SETKPTVVYAAGIMASGGYYSGIWGNEIIANPGSMIGSIGVIMEGADISGLMEKVGVKT
FT                   QVVHAGTYKQVGTFDREWSAAERAELNKVIDGTYSMFVVDVARARKLDPLRSGEYADAH
FT                   IFTALQAKKAGLVDSIGVEYDAKKRVEELSKVKDPTWNKEDPMDRFFKRFAAEGATLAH
FT                   LYFPPITLK"
FT   gene            complement(454267..455478)
FT                   /locus_tag="Sulku_0469"
FT   CDS_pept        complement(454267..455478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0469"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   tdn:Suden_0686 chlorohydrolase; PFAM: amidohydrolase; SPTR:
FT                   Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33136"
FT                   /db_xref="GOA:E4TZX1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX1"
FT                   /protein_id="ADR33136.1"
FT                   /translation="MKILLADAIFTDGTIYRNHGIVFDKTIIEVSSNDELRSRYGAQCV
FT                   ELGEGSVILPGLVNAHVHLEFSANRTTLTYGEFMPWLSSVIASRDELINECDDECTTRA
FT                   VEMMLSNGITAFGAVSSYGFDLDPCFKASQKVVYFNELIGSDPAMADALYANFQERLFA
FT                   SQELKRSGFYPSIAIHSPYSVHRILIQKALKHAKEKDLRVTAHFMESPAEREWLDTDSG
FT                   PFRPFFENFLKQTRAANTAEEFLSYFKEIPTLFTHAVQASHDELSVIAQNGHSIIHCPI
FT                   SNRLLGNGVLDLKPLEDKNIPLLCGTDGLSSNYTLDLFEEMKIALFMHPHDDLLSLSQK
FT                   LWRGVTSLAAAALKLNCGKIMSGYDADILVMRVNYPINGQLPLHLINQKGIIESIYIEG
FT                   ERVK"
FT   gene            455678..456037
FT                   /locus_tag="Sulku_0470"
FT   CDS_pept        455678..456037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0470"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR001789; KEGG: tdn:Suden_1034 response regulator
FT                   receiver domain-containing protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: Response regulator receiver domain protein; PFAM:
FT                   Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33137"
FT                   /db_xref="GOA:E4TZX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX2"
FT                   /protein_id="ADR33137.1"
FT                   /translation="MKILVVDDSKLARLFLIKTLKELEPTAAILEAENGLIAVELFKAE
FT                   KPSAVFLDLTMPVMDGYEALKEIIKIDPNAQVVIVSADIQAQAQSTVLESGAKMMIPKP
FT                   INSEKMLSILQQLSI"
FT   gene            456048..456665
FT                   /locus_tag="Sulku_0471"
FT   CDS_pept        456048..456665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0471"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="COGs: COG1776 Chemotaxis protein CheC inhibitor of
FT                   MCP methylation; InterPro IPR007597; KEGG: tdn:Suden_1035
FT                   CheC, inhibitor of MCP methylation; PFAM: CheC domain
FT                   protein; SPTR: CheC, inhibitor of MCP methylation; PFAM:
FT                   CheC-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33138"
FT                   /db_xref="GOA:E4TZX3"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX3"
FT                   /protein_id="ADR33138.1"
FT                   /translation="MQQNGFTDDHLDMLRELMNIAMGNATASIADLLEAFGKMHIPQIL
FT                   ISDMEGLASYIQQTISDDQRNYVTKQLFGGMFSGEFLFVISEESALHLGHHLYDVDNPS
FT                   DGDILDAVIELTNILSATIISRLTEELNTKVQFFVPSTELIDGNALISQEDIMNYHRII
FT                   IISTQMEFEHQNINGHIFILTKDGMIESLKALIDRKLEELYA"
FT   gene            456665..457951
FT                   /locus_tag="Sulku_0472"
FT   CDS_pept        456665..457951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0472"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterProIPR000014:
FT                   IPR000160: IPR013767: IPR019825: IPR 000700; KEGG:
FT                   tdn:Suden_1036 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold domain protein; SMART: GGDEF
FT                   domain containing protein; PAS domain containing protein;
FT                   SPTR: GGDEF domain/pas/pac sensor domain protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box; diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33139"
FT                   /db_xref="GOA:E4TZX4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX4"
FT                   /protein_id="ADR33139.1"
FT                   /translation="MVTIPYPNVLLDALEIGVMIIDENFEVRYWNQWLEINTSHSASEM
FT                   IGKNLRDFYPQIDYKVLARKIRTTLRLESPTFYDASVQNRFIEIPRTKITTSLLMNMQL
FT                   QVTISPYIVEDGMVMVSIYDISDLHELKLTLQSQMKKISELNSELHRDKMIIDANLLIV
FT                   KMDEECKIIEATTAFLDFFGYQPESVVGNYLPRIFGEVSVDFDTIQICDAIARHQKSSG
FT                   EVKAVLASGEEVWFDTVVTPLNDDESDTLSYTVIFHDISDKKRIELLSITDPLTKLFNR
FT                   HKFNEVFENMVLRRHWDEHRTFGLIIADVDHFKRVNDTFGHQSGDRVLIEVAHIFSQTI
FT                   RTGDILARWGGEEFVCLLPDVDREKALYVAEKLRLAVEQLHFPDVGTVTSSFGVTIFAS
FT                   GDTQESMMHRADLSLYKAKENGRNRVEYL"
FT   gene            458029..458505
FT                   /locus_tag="Sulku_0473"
FT   CDS_pept        458029..458505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0473"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COGs: COG0757 3-dehydroquinate dehydratase II;
FT                   InterPro IPR001874; KEGG: tdn:Suden_0687 3-dehydroquinate
FT                   dehydratase; PFAM: dehydroquinase class II; PRIAM:
FT                   3-dehydroquinate dehydratase; SPTR: 3-dehydroquinate
FT                   dehydratase; TIGRFAM: 3-dehydroquinate dehydratase, type
FT                   II; PFAM: Dehydroquinase class II; TIGRFAM:
FT                   3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33140"
FT                   /db_xref="GOA:E4TZX5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX5"
FT                   /protein_id="ADR33140.1"
FT                   /translation="MKIVVIQGPNLNMLRVREQQVYGPMRLEQIHAQMKEFAAQNGVDI
FT                   EFYQSNLEGEIVDRIQECYGDADGIIINPAAYTHTSIAIRDAISAVSLPTIEVHISNIY
FT                   RREEFRQKSMTAPVCTSSIIGFGPFGYHLAMMGMLQILSEINAMRQAQQGTVEE"
FT   gene            458509..459033
FT                   /locus_tag="Sulku_0474"
FT   CDS_pept        458509..459033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0474"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="COGs: COG0801 7
FT                   8-dihydro-6-hydroxymethylpterin-pyrophosphokinase; InterPro
FT                   IPR000550: IPR002052; KEGG: sun:SUN_1040
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   SPTR:2-amino-4-hydroxy-6-hydroxymethyldihydropterid
FT                   inepyrophosphokinase;
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropte
FT                   ridinepyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK);
FT                   TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33141"
FT                   /db_xref="GOA:E4TZX6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX6"
FT                   /protein_id="ADR33141.1"
FT                   /translation="MPLRRVLDEKHSISIDRYFPKTLQGGGGYRYRVLLGVGGNIGDVK
FT                   RRMNHLWFYIRRLSLMKIVRSGVILRNPPFGYTEQHDFENTVIEIATSLEPRALLRLIW
FT                   RIEKRFGRRRSFANAPRTLDLDILFFEKRSIRSKELTIPHPHWNERISVTIPLGSLAHK
FT                   STRRHYENFDI"
FT   gene            459014..460282
FT                   /locus_tag="Sulku_0475"
FT   CDS_pept        459014..460282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0475"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="COGs: COG1419 Flagellar GTP-binding protein;
FT                   InterPro IPR020006: IPR000897: IPR003593; KEGG:
FT                   tdn:Suden_0703 flagellar biosynthesis regulator FlhF; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   SMART: AAA ATPase; SPTR: GTP-binding signal recognition
FT                   particle SRP54, G-domain; TIGRFAM: flagellar biosynthetic
FT                   protein FlhF; PFAM: SRP54-type protein, GTPase domain;
FT                   TIGRFAM: flagellar biosynthetic protein FlhF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33142"
FT                   /db_xref="GOA:E4TZX7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX7"
FT                   /protein_id="ADR33142.1"
FT                   /translation="MKILTFSGATPAEALKKAQLEVGEEAMLIETREVQKKSLGKSALY
FT                   EIVVGVEENAAPAPKSKAPSDEPFMKQRPLAQKSSDVLYNISAAAKQISKIAEVTEEER
FT                   PSRQTPVRESEDLKRIKEEIEKLGDKVKLIQNMFWSEKSPKTTAAIPPEFAEIYRLAQQ
FT                   SGMDQEHLDEIMHLTLEHMPSKMRESSETVKRYFQVLMRKMIPVRLESAPRPGSKKVIM
FT                   LVGPTGVGKTTSIAKLAARFSYLLEKKYKVGLVVLDTYRIGAVEQLMQYARMMKLGIET
FT                   VVDPPEFSSALNALRYSDYILIDTMGSSPYDKGKIEKIYECLRDNNTDYTVDVVLVMPS
FT                   SIKYDDLKATYENFAPLGIDTMMFTKLDETRGFGNIFSLVYETKVPISYFSVGQEVPED
FT                   LVVATSDFLVDCLMNGFNRGESA"
FT   gene            460279..461151
FT                   /locus_tag="Sulku_0476"
FT   CDS_pept        460279..461151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0476"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="COGs: COG0455 ATPase involved in chromosome
FT                   partitioning; KEGG: tdn:Suden_0704 cobyrinic acid
FT                   a,c-diamide synthase; SPTR: Cobyrinic Acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33143"
FT                   /db_xref="GOA:E4TZX8"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX8"
FT                   /protein_id="ADR33143.1"
FT                   /translation="MNHQASKLEALVNQNRNATAKKTRFIAITSGKGGVGKSTISSNMA
FT                   FVMAKYGLKVGIFDADIGLANLDVMFNVKIKKNILHVLKGEATVEEILVPIEPNLVLIP
FT                   GESGEEIFKYASGGLFERFMDQANVLDDLDVMIIDTGAGIGEHIQLFLRACDDVIVVTV
FT                   PDPAAITDAYATIKITSKLRDEINVIMNQVRSMKEAEALFEKINKVAQANIGGALKLSY
FT                   LGQISNDPKISTSVKKRALFSRDFPTATPTNEIEVIVKRIAKKLERNVLVDPKESGLGG
FT                   LFKRLMEHF"
FT   gene            461223..461546
FT                   /locus_tag="Sulku_0477"
FT   CDS_pept        461223..461546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0705 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33144"
FT                   /db_xref="GOA:E4TZX9"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZX9"
FT                   /protein_id="ADR33144.1"
FT                   /translation="MRGSNFVYFLTIQGFFVGIVFGILQSDSAENFLGWVILISLFFYL
FT                   FAHLCVGFFFQSLGVKAHSFPKKAHEHNLDFFVREINKREQFIDAFYTHKSELLDDQGR
FT                   GKG"
FT   sig_peptide     461223..461288
FT                   /locus_tag="Sulku_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            461543..462235
FT                   /locus_tag="Sulku_0478"
FT   CDS_pept        461543..462235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0478"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="COGs: COG1191 DNA-directed RNA polymerase
FT                   specialized sigma subunit; InterProIPR014284: IPR012845:
FT                   IPR007627: IPR007630: IPR 000943; KEGG: tdn:Suden_0706
FT                   flagellar biosynthesis sigma factor; PFAM: sigma-70 region
FT                   4 domain protein; sigma-70 region 2 domain protein; SPTR:
FT                   RNA polymerase sigma factor; TIGRFAM: RNA polymerase sigma
FT                   factor, FliA/WhiG family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70, region 4; Sigma-70 region
FT                   2; TIGRFAM: RNA polymerase sigma factor, FliA/WhiG family;
FT                   RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33145"
FT                   /db_xref="GOA:E4TZY0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY0"
FT                   /protein_id="ADR33145.1"
FT                   /translation="MSGTNAYTQELKHREDQLAIQFLPAVKAMSFRLKERLPSSVDYMD
FT                   LCAIGTEELVKLARRYDESQNDSFWGYAKTRVYGAMLDYLRSLDMVSRSSRRLIKEIDH
FT                   AIEVYMADHDDEPSDSELSVILGIEEDKVREARIASDIYTVLPLDDQLGTPEEGGMLER
FT                   MEHEDLIEAIQEVLMTFEEREQIIIQLYYFEELTLKEISEIVNITESRISQIHKSVIRR
FT                   IKEAVGGQ"
FT   gene            462235..463329
FT                   /locus_tag="Sulku_0479"
FT   CDS_pept        462235..463329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0479"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="COGs: COG1868 Flagellar motor switch protein;
FT                   InterPro IPR001689: IPR001543; KEGG: tdn:Suden_0707
FT                   flagellar motor switch protein FliM; PFAM: flagellar motor
FT                   switch protein FliM; surface presentation of antigens
FT                   (SPOA) protein; SPTR: Flagellar motor switch protein FliM;
FT                   TIGRFAM: flagellar motor switch protein FliM; PFAM: Surface
FT                   presentation of antigens (SPOA); Flagellar motor switch
FT                   protein FliM; TIGRFAM: flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33146"
FT                   /db_xref="GOA:E4TZY1"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY1"
FT                   /protein_id="ADR33146.1"
FT                   /translation="MADILSQEEIDALLDVVDDEGDGLLETTEESLYPQRQITLYDFKR
FT                   PNRVSKEQLRAFRGIHDKMARSIASQISAIMRSIVEIQLHSVDQMTYGEFLMSLPNPTS
FT                   FNVFSMKPLEGNGVLEINPSIAFPMLDRILGGKGEPFEANREFSDIELSLFETILRVMM
FT                   GTLREAWGPVTDLYPQVESKESSPNVVQIVAQNEIVVMVVMEIIIGHSSGMMNICYPVI
FT                   ALEPVLPKLASRDLMLNETSSKKSRNQELQVLLGGAHVNVEVNLGEAELSLHELLELGE
FT                   GDIIRLNIPADDVVNVSVDGKDRFVGQMGLRRFRKSIQITSLIDTEKDAVKRALKEFEM
FT                   KRKARISGVKEMIRGPIEEEDEDE"
FT   gene            463322..464188
FT                   /locus_tag="Sulku_0480"
FT   CDS_pept        463322..464188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0480"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="COGs: COG1886 Flagellar motor switch/type III
FT                   secretory pathway protein; InterPro IPR012826: IPR001543:
FT                   IPR001172; KEGG: tdn:Suden_0708 flagellar motor switch
FT                   protein FliY; PFAM: surface presentation of antigens (SPOA)
FT                   protein; SPTR: Flagellar motor switch FliN; TIGRFAM:
FT                   flagellar motor switch protein FliN; PFAM: Surface
FT                   presentation of antigens (SPOA); TIGRFAM: flagellar motor
FT                   switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33147"
FT                   /db_xref="GOA:E4TZY2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY2"
FT                   /protein_id="ADR33147.1"
FT                   /translation="MSDFPGVFATEAVATIEGLTGQTPTITLKEAEEISIISNVIPPIA
FT                   QIHVSFSGAAAGRGIVMMPPQLATALGDMMLGGDGEAQDTMSDEDMDAAKEIVSNIVGA
FT                   MSTTLASQKELPKFTIKPERAEFIPESGEVNLDGYAKMFVFTFALGHINSLMMLAIDST
FT                   INEALTGEKAAPAPASNSSNIFDAPSSSVPAVKLDEGEMKNIGLIMGVKLPVRVRIGKK
FT                   KMLLKDVLSMDIGSVIELNQLANDPLDILVDDHVIAQGEVVIVDGNFGVQITSIGTKRD
FT                   RLNKLKG"
FT   gene            464191..464979
FT                   /locus_tag="Sulku_0481"
FT   CDS_pept        464191..464979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0481"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="COGs: COG1611 Rossmann fold nucleotide-binding
FT                   protein; InterPro IPR005269; KEGG: tdn:Suden_0709
FT                   hypothetical protein; PFAM: Conserved hypothetical protein
FT                   CHP00730; SPTR: Lysine decarboxylase family protein; PFAM:
FT                   Possible lysine decarboxylase; TIGRFAM: conserved
FT                   hypothetical protein, DprA/Smf-related, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33148"
FT                   /db_xref="GOA:E4TZY3"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY3"
FT                   /protein_id="ADR33148.1"
FT                   /translation="MARRHGKTKEYESSRYVKDIKSADVWSVFKIIADFVQGFDELGDL
FT                   GPSVTIFGSARLDENHPYYTQAMTLANMLGEKGYNVITGGGPGIMEAANRGAYEVETVE
FT                   SIGLNIELATEQQPNPYITKGQSFDYFFSRKVMLVKYSMAYVIFPGGFGTLDEMFEALT
FT                   LIQTRKVWGVRLFVVGTEFYAPLLQFIEDKMLAEGMIDDKDVQLINLTDDLDFVVREIE
FT                   KSLISQIHTMEKEGLTDTKYYKALTSHVDETHSYAGQGSS"
FT   gene            464979..465998
FT                   /locus_tag="Sulku_0482"
FT   CDS_pept        464979..465998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0482"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR004506;
FT                   KEGG: tdn:Suden_0710 tRNA-specific 2-thiouridylase MnmA;
FT                   SPTR: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA methyl transferase; TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33149"
FT                   /db_xref="GOA:E4TZY4"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY4"
FT                   /protein_id="ADR33149.1"
FT                   /translation="MGKKVLIGMSGGVDSTVSTLLLKEQGYDVEGVYMKLHSKPGYHEI
FT                   HQARAQRAADFAGVKLHILDLQEEFNAKVFTPFIETYKEGKTPNPCALCNRNIKFGAMV
FT                   AYADSIGADYVATGHYIRHDGQYLLQAHDDTKDQSYFLFYIDPALVPRLLFPLGERHKS
FT                   DIKAYAAGIEGLESFASQSESSEICFVETTYMDVLKPYVPVDQEGEVLNLEGKVVGKHK
FT                   GYMHYTIGKRKGFSVHGAHDPHFVVEIKPEINQIVVGTREDLECHRVELERVNMFDSRT
FT                   EFECDVKLRYRTTAVRCSVKIDGDHATVELHEPVLGVASGQAGVFYDGEKLLGGGWIV"
FT   gene            466148..467377
FT                   /locus_tag="Sulku_0483"
FT   CDS_pept        466148..467377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: pmx:PERMA_1526 general
FT                   substrate transporter; PFAM: major facilitator superfamily
FT                   MFS_1; SPTR: Major facilitator family transporter; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33150"
FT                   /db_xref="GOA:E4TZY5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY5"
FT                   /protein_id="ADR33150.1"
FT                   /translation="MTSKKKIVAAGIIGNVIEYYDFALIGFLAVMMGNLFFPSHDPFLS
FT                   LLGSFGAFAAGMIMRPVGALIFGHIGDRVSRRTALMSSLLMMALPTFLIGFLPTYAQIG
FT                   ILAPILLVLLRMIQGLSVGGEYASSIVYLVEQSAPDHQNLYGSFVSVGAKIGMALGSGF
FT                   CGALLWYIGGDAMGEWGWRIPFWASIIIAAAGLYLRRNLTDDYRPSEDKTVPIVAILRH
FT                   HRREFWQFLTIASAIWVFYYTVFIYLPIWLEGSAGLSKAEAGQINTLSIVVGVVFIPLM
FT                   AMVADVIGSLRLMRLTSITLAISVYPLFYWMSIGGFWGALAGTIGLVILLCAFQAPIFA
FT                   STVNALHYHGYRASFTAVILGSAAGIVGGITPALMTSITEYSGNPFAPSYLIAAASLMG
FT                   GWGILRNVRA"
FT   gene            complement(467358..468119)
FT                   /locus_tag="Sulku_0484"
FT   CDS_pept        complement(467358..468119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0484"
FT                   /product="carbonic anhydrase"
FT                   /note="COGs: COG0288 Carbonic anhydrase; InterPro
FT                   IPR001765; KEGG: cvi:CV_1136 hypothetical protein; PFAM:
FT                   carbonic anhydrase; SPTR: Carbonic anhydrase; PFAM:
FT                   Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33151"
FT                   /db_xref="GOA:E4TZY6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY6"
FT                   /protein_id="ADR33151.1"
FT                   /translation="MDKRTFLKFFALTSSSLLLANSAEASSAHAAPNTQELQEIAQKMF
FT                   AEVISQNDYYVNHQGSAFFEKLKNGQHPRATVIGCSDSRFQSAALDATAENDLFIIRNI
FT                   GNQFSSNMGSVEYGVRHLNTPLLIIVGHSRCGAIKAALGDYSSEGPHIIKELDSLSLAV
FT                   RKTSMMGTEEAKWLAAVVSNINQQVYYAQKEFKGDVESGKLTIVGVVYDLANDFNNGYG
FT                   RLKIVNINGESNPGKMMDYPLMKSLFKPVHF"
FT   sig_peptide     complement(468030..468119)
FT                   /locus_tag="Sulku_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(468164..469027)
FT                   /locus_tag="Sulku_0485"
FT   CDS_pept        complement(468164..469027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0485"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="COGs: COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein); InterPro IPR011812:
FT                   IPR001264; KEGG: cte:CT2025 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; PFAM: glycosyl transferase
FT                   family 51; SPTR: Monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; TIGRFAM: monofunctional biosynthetic
FT                   peptidoglycan transglycosylase; PFAM: Transglycosylase;
FT                   TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33152"
FT                   /db_xref="GOA:E4TZY7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY7"
FT                   /protein_id="ADR33152.1"
FT                   /translation="MQKLKTILLLLLLAGAIDIGRYFIYPNIDDLKDIRPIPTAFMEYR
FT                   QNEWADENRDMEITQKWVSMSQISPNVIKAVLIGEDDKFWNHDGFDVTGMEQALERSLK
FT                   KGSVAGGSTISQQLSKNLYLSPSKNPVRKIKEAIITWRIEHALSKRRILEIYLNVAEWG
FT                   DGIFGIEAAARHYYHKSAKNLTGQEAARLAAVLPNPIKYDPTGSQKYVKNRSRIIYKIM
FT                   KRRGIVIPQFKEVMTPPRESESPAVENNQSITDLFDQTAPEETAPQEQIDVPVSNGTEK
FT                   NESITF"
FT   sig_peptide     complement(468980..469027)
FT                   /locus_tag="Sulku_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(469029..469655)
FT                   /locus_tag="Sulku_0486"
FT   CDS_pept        complement(469029..469655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0486"
FT                   /product="Uncharacterized protein family UPF0126"
FT                   /note="COGs: COG2860 membrane protein; InterPro IPR005115;
FT                   KEGG: tdn:Suden_1580 hypothetical protein; PFAM:
FT                   Uncharacterised protein family UPF0126; SPTR: Membrane
FT                   protein; manually curated; PFAM: UPF0126 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33153"
FT                   /db_xref="GOA:E4TZY8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY8"
FT                   /protein_id="ADR33153.1"
FT                   /translation="MSEFNLVVFADILGIIAFALSGFLVGVRSNLDLLGIIISASLTAL
FT                   GGGVVRDVILDRTPFAFNEYYPAITVLTTIAIAFAFRLYHREQIERQWLFVISDTIGLV
FT                   AFSITGALLAIDAGFNFFGVIILSFLTAIGGGVLRDILINQVPAVLVSDFYGSIALIVS
FT                   ILLLVFSAVIGLSTLSVAIVAFIAITLRLAAYIKGWHLPTLNTDH"
FT   gene            complement(469648..470184)
FT                   /locus_tag="Sulku_0487"
FT   CDS_pept        complement(469648..470184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0487"
FT                   /product="hexapeptide repeat-containing transferase"
FT                   /note="COGs: COG0663 Carbonic anhydrase/acetyltransferase
FT                   isoleucine patch superfamily; InterPro IPR001451; KEGG:
FT                   sun:SUN_2151 hexapaptide repeat-containing transferase;
FT                   SPTR: Transferase, hexapeptide repeat family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33154"
FT                   /db_xref="GOA:E4TZY9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZY9"
FT                   /protein_id="ADR33154.1"
FT                   /translation="MIANYLHYTPDMKERVWIAPSADVIGRVSMGEDVSIWFGCVVRGD
FT                   VHYIKIGDRSNIQDLSMVHVTHHKRDDMSDGYPTIIGNDVTVGHRVMLHGCTIEDACLI
FT                   GMSATILDGAVIGKESIVGAGALVTKNKVFPPRSLIMGSPAKVVRELTDEEVAELYASA
FT                   KRYVSFKENYRAPNV"
FT   gene            complement(470197..472296)
FT                   /locus_tag="Sulku_0488"
FT   CDS_pept        complement(470197..472296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0488"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="COGs: COG0855 Polyphosphate kinase; InterPro
FT                   IPR003414; KEGG: tdn:Suden_1578 polyphosphate kinase; PFAM:
FT                   Polyphosphate kinase; PRIAM: Polyphosphate kinase; SPTR:
FT                   Polyphosphate kinase; TIGRFAM: Polyphosphate kinase; PFAM:
FT                   Polyphosphate kinase; TIGRFAM: polyphosphate kinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33155"
FT                   /db_xref="GOA:E4TZZ0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ0"
FT                   /protein_id="ADR33155.1"
FT                   /translation="MPNNYKDPALYINRELSWLQFNTRVLRQAQDESLPLFERLKFLAI
FT                   YGTNLDEFYMIRVAGLKKLFSAGVNVSGADRFTPLHQLRGIREYLHKEQEEVEYCLQGI
FT                   MKELEKEGIFFKPYKEATPEQRKYLDKYFHENIYPVVIPIAIDATHPFPHLNNLGFGQI
FT                   VKLRDKDDATIERYGLIRIPRVLPRFVEIDNRIYIPIGSIVAEHIQDLFPGYELIKFAA
FT                   FRVTRNADIAIEEEEADDFMEILEEGLKLRKKGELVRLELSVHADDDLLNFFNRHANVY
FT                   KDDIYRFQTYLNLGSLWQVVGNKDFAHLTTPSFKPRNLPPLDTDESLYATLDKQDLLLY
FT                   HPFESFEPVVRLIQIAAKDPEVVSIRMTLYRSGSKSPIVQSLINAAESGKQVTVMVELR
FT                   ARFDEENNLHWAKALENSGAHVIYGIAGFKVHAKAALITRRVDGKLKQYAHIGTGNYNP
FT                   STATIYTDISYMTSNDTITHDMTRFFHFLTGFSKKGKLHELYMAPTQIKPKVLSLIQNE
FT                   TRMGSEGVIIAKMNALVDEDIIKALYKASQAGVKIELIIRGICCLRPGVPGVSENIRVI
FT                   SLIGKYLEHARIYYFKHSTPQTYISSADWMPRNLLRRIELLTPIQGEEISNKLIQILQL
FT                   QTSDNILAYELQNDGSYVKVKHEPGNLIDSHKIAETHTNKVYNSVKKQTPNYVQQLTAR
FT                   LFKES"
FT   gene            472366..472953
FT                   /locus_tag="Sulku_0489"
FT   CDS_pept        472366..472953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0489"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR001440: IPR019734: IPR013026; KEGG:
FT                   tdn:Suden_0443 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33156"
FT                   /db_xref="GOA:E4TZZ1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ1"
FT                   /protein_id="ADR33156.1"
FT                   /translation="MSIFQILMFAATLFFAYQIFRHVQNLDDAQPHKKESNIVDTAVFS
FT                   ASALVEEADNAYQRGELDRARTALEEASRIESENPEILNKLAFITAKTGDRLKAIELYE
FT                   QSLELDENDDLTHNAIASLYRAENAYERAQDHYLKAIEIDDTYPQTFYNYANLLVDMDE
FT                   VEKARGMYKRALELQSDFPEAREALLSLGAHV"
FT   sig_peptide     472366..472419
FT                   /locus_tag="Sulku_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            472950..473690
FT                   /locus_tag="Sulku_0490"
FT   CDS_pept        472950..473690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0490"
FT                   /product="protein of unknown function DUF88"
FT                   /note="KEGG: mmh:Mmah_0289 protein of unknown function
FT                   DUF88; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33157"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ2"
FT                   /protein_id="ADR33157.1"
FT                   /translation="MIDDQARLAVLIDADNSQPSIIAGLMDEIAAHGIASVKRIYGDWT
FT                   DTKLKGWKNALLEHGLHPMQQFAYTTGKNATDSAMIIDAMDLLYTKNFDGFCIVSSDSD
FT                   FTRLASRIRESGIKVYGFGEQKTPKAFIGVCDKFIYTENLRRDANHKEPVGTKIKPDNK
FT                   ALLALVRNAVEDTTNEAGWSYLGSIGQNLINKSPEFDPRSYGFKKLLDLIESLGEFEFK
FT                   FSDPLSGSQAVHVRLKRHKRSYEK"
FT   gene            473687..474409
FT                   /locus_tag="Sulku_0491"
FT   CDS_pept        473687..474409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0491"
FT                   /product="protein of unknown function DUF34"
FT                   /note="COGs: COG0327 conserved hypothetical protein;
FT                   InterPro IPR002678; KEGG: tdn:Suden_0444 hypothetical
FT                   protein; PFAM: protein of unknown function DUF34; SPTR:
FT                   Putative uncharacterized protein; PFAM: NIF3 (NGG1p
FT                   interacting factor 3); TIGRFAM: dinuclear metal center
FT                   protein, YbgI/SA1388 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33158"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ3"
FT                   /protein_id="ADR33158.1"
FT                   /translation="MTVQEIYTYLDGLSPFATQEGWDNSGLLVGDFAQEITHVVLSIDI
FT                   DEELIETIPENALLITHHPVIFGGLKQLQFNQYPAKILMPLIRKNITNIAMHTNFDQTH
FT                   LNDYVATEVLGYPIIAKEGFVAYLGVDEPYDAFAEKIKTALGLPHTRGVKCHDHIRTCA
FT                   LVTGSGASLMRNIEAECFLTGDIKYHDAMEAKALGLSMIDIGHYESERYFGEVLGGYLE
FT                   KLGLSVIISPSKNPFTYL"
FT   gene            474449..475171
FT                   /locus_tag="Sulku_0492"
FT   CDS_pept        474449..475171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0492"
FT                   /product="protein of unknown function DUF164"
FT                   /note="COGs: COG1579 Zn-ribbon protein possibly nucleic
FT                   acid-binding; InterPro IPR003743; KEGG: tdn:Suden_0445
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF164; SPTR: Putative uncharacterized protein; PFAM:
FT                   Putative zinc ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33159"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ4"
FT                   /protein_id="ADR33159.1"
FT                   /translation="MNKHLEQLIELSHVDKEIDAFEPQIEEANLQYDALLATKNSITNE
FT                   INALKQEIKDEQIKKHKNELHLAELSAKLEENSKKSNEVKTEREMKSLQLEEEIAKEQV
FT                   SFANEEIERLEKLIDHKQSKIDELEAKAAEIDGTLAGVKADVDVKLARIDEERKEVFAR
FT                   KEALVGAMNQKGLSFYQKIRRWAKNTTAVAVRNQACMGCYMAISDKVYSDVIKGEEITM
FT                   CPHCGRILFLEPSDAIGA"
FT   gene            475164..476327
FT                   /locus_tag="Sulku_0493"
FT   CDS_pept        475164..476327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0493"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein"
FT                   /note="COGs: COG1519 3-deoxy-D-manno-octulosonic-acid
FT                   transferase; InterPro IPR007507; KEGG: tdn:Suden_0446
FT                   3-deoxy-D-manno-octulosonic-acid transferase; PFAM:
FT                   Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain-containing protein; SPTR:
FT                   3-deoxy-D-manno-octulosonic-acid transferase; PFAM:
FT                   3-Deoxy-D-manno-octulosonic-acid transferase
FT                   (kdotransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33160"
FT                   /db_xref="GOA:E4TZZ5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ5"
FT                   /protein_id="ADR33160.1"
FT                   /translation="MRNVVFDLIYTLVAAFFYVAALPLLILFSFKKKYRDSIPARFFGI
FT                   KNPPFQPHDIWFHVCSFGEAKAIAPVLEKLKDKKIAISVITHTGYEAASKYAAQVRYLP
FT                   YELWLWFWIERPKTVVVLEAEFWYLLFRLASRRGARVIALNARISDRSFSKYYRMRWFY
FT                   RILLSQCDRVFCQSSEDMVRFIALGARNVEVVGNIKLAQKIESNKHYPKPNGLLIVAAS
FT                   THEGEEEGIIRGFMAYREHNPSAKLLVVPRHPERFAKVGELIAKTAPKMTLSRWSESQM
FT                   ITEDITLIDTMGDLNNLYAISDVVVLGGAYAPIGGHNPLEPATFGCRIISGMEIFHQRE
FT                   LFKYVSHVQFTSVEGIAEALKNAETMPPSQINGSVDLKKVLNYLTEK"
FT   sig_peptide     475164..475208
FT                   /locus_tag="Sulku_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            476329..477066
FT                   /locus_tag="Sulku_0494"
FT   CDS_pept        476329..477066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0494"
FT                   /product="pseudouridine synthase"
FT                   /note="COGs: COG0564 Pseudouridylate synthase 23S
FT                   RNA-specific; InterPro IPR006145: IPR006224: IPR002942;
FT                   KEGG: tdn:Suden_0447 pseudouridine synthase; PFAM:
FT                   pseudouridine synthase; SPTR: Pseudouridine synthase; PFAM:
FT                   RNA pseudouridylate synthase; TIGRFAM: pseudouridine
FT                   synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33161"
FT                   /db_xref="GOA:E4TZZ6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ6"
FT                   /protein_id="ADR33161.1"
FT                   /translation="MEKPKAYKLLAEQEGISNSEAKSLIDRGLVYVGNSKVMIARGEIS
FT                   PKTVFIVQKVEKVRPIFENDDLIVVDKPAFVNSDEIERQFKGSQLLHRLDRETSGVLML
FT                   VKNEEFRLKAIQEFKKDNVYKEYVAWVEGLVSEPFVVDQPLITEKKGNKAYTKVAKKGK
FT                   PAITEVTPLEVSGKKTKVQLIIHHGRTHQIRAHMKFAQHPIIGDESYGGRQSKRVMLHA
FT                   KKVTLLGQTFEAPEPKVFGHFGS"
FT   gene            477403..478749
FT                   /locus_tag="Sulku_0495"
FT   CDS_pept        477403..478749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0495"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterProIPR004780: IPR013822: IPR000897: IPR004125: IPR
FT                   003593; KEGG: tdn:Suden_0450 signal recognition particle
FT                   protein; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; GTP-binding signal recognition particle
FT                   SRP54 helical bundle; Signal peptide binding (SRP54) M-
FT                   domain protein; SMART: AAA ATPase; SPTR: Signal recognition
FT                   particle protein; TIGRFAM: signal recognition particle
FT                   protein; PFAM: SRP54-type protein, GTPase domain;
FT                   SRP54-type protein, helical bundle domain; Signal peptide
FT                   binding domain; TIGRFAM: signal recognition particle
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33162"
FT                   /db_xref="GOA:E4TZZ7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ7"
FT                   /protein_id="ADR33162.1"
FT                   /translation="MFDTLTESFTSAIRKIRFHDDEKALTKALGELKKALLKADVNHKV
FT                   VKELIDSVEIQTKQNGVGKDQFLDALRKSLYALLDVKGKSGFVYAPVAPTVILMTGLQG
FT                   SGKTTTTGKLANWLKTRQKKRVLVVAADLQRLAAVEQLRQVCGAIDVELYADDATKNPV
FT                   EVVKAALEHAKKVLVDVVLIDTAGRLAIDDELMGELAEVKAVANPHEIFYVADSLSGQD
FT                   AVRTAATFNEKIGIDGVILTKYDGDSKGGVALGIASQIQVPLRFIGAGEKMEDLEIFLP
FT                   DRIVNRLMGLGDIEGLAERTASVIDEKKAKALTKKIKKGEFNFNDFLEQMESLKKMGSM
FT                   KSIMGMIPGMGGMASALKDFDLENSTQLKQIKALVSSMTVKEREDPELLNNSRKARLAK
FT                   GCGLDIIEVNRILKQFKNASKMAKRFSGKQGMKDLQSMMGQMQGARLPR"
FT   gene            478898..479128
FT                   /locus_tag="Sulku_0496"
FT   CDS_pept        478898..479128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0496"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="COGs: COG0228 Ribosomal protein S16; InterPro
FT                   IPR000307: IPR020592; KEGG: tdn:Suden_0451 30S ribosomal
FT                   protein S16; PFAM: ribosomal protein S16; SPTR: 30S
FT                   ribosomal protein S16; TIGRFAM: ribosomal protein S16;
FT                   PFAM: Ribosomal protein S16; TIGRFAM: ribosomal protein
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33163"
FT                   /db_xref="GOA:E4TZZ8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ8"
FT                   /protein_id="ADR33163.1"
FT                   /translation="MATVIRLTRMGRKKQPFYRIAVTDSRKRRDGGWIELIGYYNPMTD
FT                   PITTKVDEERLNYWLSVGAQMSDRVKKITGK"
FT   sig_peptide     478898..478960
FT                   /locus_tag="Sulku_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            479131..479370
FT                   /locus_tag="Sulku_0497"
FT   CDS_pept        479131..479370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0497"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1837 RNA-binding protein (contains KH
FT                   domain); KEGG: tdn:Suden_0452 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33164"
FT                   /db_xref="GOA:E4TZZ9"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZZ9"
FT                   /protein_id="ADR33164.1"
FT                   /translation="MIADFVAGFARLIASYPEEIRVESHEGDEVTEIVLYANQADVGKL
FT                   IGKEGKMIGAIKTVISGCKAKDGKSYRINVEPLS"
FT   gene            479351..479905
FT                   /locus_tag="Sulku_0498"
FT   CDS_pept        479351..479905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0498"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="COGs: COG0806 RimM protein required for 16S rRNA
FT                   processing; InterPro IPR011961: IPR002676: IPR007903; KEGG:
FT                   tdn:Suden_0453 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein; SPTR: Ribosome
FT                   maturation factor rimM; TIGRFAM: 16S rRNA processing
FT                   protein RimM; PFAM: RimM N-terminal domain; TIGRFAM: 16S
FT                   rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33165"
FT                   /db_xref="GOA:E4U000"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:E4U000"
FT                   /protein_id="ADR33165.1"
FT                   /translation="MSNRFRNSPSHDLLHVATLGRTVGLKGDMKLNLSTDFPEQFIPNA
FT                   TFTLDNGKEVTLSSYNPDRELVHLKGIDTPEAAKALTNAKLFTTFEATRERCNLGEGEF
FT                   FWFDLLGSKVVEGESVLGKVQEIERIGPLDYLLVATDPSLVSKGMAATFLIPYIDRFVL
FT                   GTDATAKVITVEGGLDLLEAS"
FT   gene            479905..480600
FT                   /locus_tag="Sulku_0499"
FT   CDS_pept        479905..480600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0499"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="COGs: COG0336 tRNA-(guanine-N1)-methyltransferase;
FT                   InterPro IPR002649: IPR016009; KEGG: tdn:Suden_0454 tRNA
FT                   (guanine-N(1)-)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase; PRIAM: tRNA
FT                   (guanine-N(1)-)-methyltransferase; SPTR: tRNA
FT                   (guanine-N(1)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (Guanine-1)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33166"
FT                   /db_xref="GOA:E4U001"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E4U001"
FT                   /protein_id="ADR33166.1"
FT                   /translation="MRFTYVTIFSNLIEGYFQDSILKRGIESGKFSVGYLNPRDFSTSK
FT                   HHKVDDTAAGGGAGMVMTPQPLFDTLKTLDDDAHIIFVAPVGKQFTQNDAKRLATKSHV
FT                   VFVSGRYEGIDERVVERFGDEVFSIGDYVLTGGELPSLVMTDAIVRNIDGVLGNSESLE
FT                   YESFETPLLEAPSFGKPPAYENMRVPSEYLKGNHSKIRALKSSLSECKTKYFRPEQLQK
FT                   HKIRTSYEK"
FT   gene            480590..480949
FT                   /locus_tag="Sulku_0500"
FT   CDS_pept        480590..480949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0500"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="COGs: COG0335 Ribosomal protein L19; InterPro
FT                   IPR001857: IPR018257; KEGG: tdn:Suden_0455 50S ribosomal
FT                   protein L19; PFAM: ribosomal protein L19; SPTR: 50S
FT                   ribosomal protein L19; TIGRFAM: ribosomal protein L19;
FT                   PFAM: Ribosomal protein L19; TIGRFAM: ribosomal protein
FT                   L19, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33167"
FT                   /db_xref="GOA:E4U002"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E4U002"
FT                   /protein_id="ADR33167.1"
FT                   /translation="MKNKYIASFEQAQIASKNVPEFRAGDTLRLAVTITEGEKSRVQNY
FT                   EGICISIRGEGTGKTITVRKIGANGVGIERVFPIYSDSLEKIEVLRRGRVRRAKLFYLR
FT                   DLAGKAARIKEIRRK"
FT   gene            complement(481035..481487)
FT                   /locus_tag="Sulku_0501"
FT   CDS_pept        complement(481035..481487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0501"
FT                   /product="SsrA-binding protein"
FT                   /note="COGs: COG0691 tmRNA-binding protein; InterPro
FT                   IPR000037: IPR020081; KEGG: tdn:Suden_0441 SsrA-binding
FT                   protein; PFAM: SmpB protein; SPTR: SsrA-binding protein;
FT                   TIGRFAM: SsrA-binding protein; PFAM: SmpB protein; TIGRFAM:
FT                   SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33168"
FT                   /db_xref="GOA:E4U003"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E4U003"
FT                   /protein_id="ADR33168.1"
FT                   /translation="MGENIATNKKAFFDYYIEEKFEAGLVLKGSEVKSLRAGRVNLKDG
FT                   FIKIVRGEAFVFGVHIGVLDTTHRFYAHEERGSRKLLLHKKQIDKMFKAVEKEGFTLVP
FT                   LSIYFNDRNIAKMQVAIVKGKKLYDKRDDLKEKSIKRDIERALKGE"
FT   gene            complement(481535..481825)
FT                   /locus_tag="Sulku_0502"
FT   CDS_pept        complement(481535..481825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0548 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33169"
FT                   /db_xref="UniProtKB/TrEMBL:E4U004"
FT                   /protein_id="ADR33169.1"
FT                   /translation="MKNEPIYLDQEENELLNEIENGEWVSNPLSPQERQAYQNNAKYTK
FT                   SLQEKRQTTIRFSVSDLAVIKAKSKEMGIGYQNLIQALVHNYAVGKIKLEA"
FT   gene            complement(481815..482102)
FT                   /locus_tag="Sulku_0503"
FT   CDS_pept        complement(481815..482102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0547 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33170"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="UniProtKB/TrEMBL:E4U005"
FT                   /protein_id="ADR33170.1"
FT                   /translation="MSKIIRWNEEKNQLLQLQRNISFEQVLEKIEKDEIIERYIHPNTE
FT                   KYPNQQIFVIEIDEYIWYVPFVETEEEIFLKSIIPSRKLNAAYGGTKNEK"
FT   gene            complement(482250..483002)
FT                   /locus_tag="Sulku_0504"
FT   CDS_pept        complement(482250..483002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0504"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /note="InterPro IPR005534; KEGG: sul:SYO3AOP1_0256
FT                   hypothetical protein; PFAM: Curli production
FT                   assembly/transport component CsgG; SPTR: Putative
FT                   uncharacterized protein; PFAM: Curli production
FT                   assembly/transport component CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33171"
FT                   /db_xref="GOA:E4U006"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:E4U006"
FT                   /protein_id="ADR33171.1"
FT                   /translation="MNKITIGVIILAMCATLATADENTKVQEIAVPVNKCEAPTLSIAI
FT                   NDIECKAQSCQDTGVPSGGFAALAALASGQGNVKGIGTGVKSMLTNAIKESKCFKIVDL
FT                   EQFEKMKKMLAATGQEVKPPKIDLIISGTISSVDVSKEGGAIAGGVIPIVGLFSKNTSK
FT                   ASIGVEFFTMNPSTLEMGDSKSFKADSEKSSWGFGGFGGAAGGGWSVTKNVALDNVIRD
FT                   VVFSATNYITESYAKDKIVERPKLVAAQ"
FT   sig_peptide     complement(482943..483002)
FT                   /locus_tag="Sulku_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(483273..484034)
FT                   /locus_tag="Sulku_0505"
FT   CDS_pept        complement(483273..484034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0505"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR004424: IPR006204; KEGG:
FT                   tdn:Suden_0440 4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; SPTR:
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases N terminal domain; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33172"
FT                   /db_xref="GOA:E4U007"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E4U007"
FT                   /protein_id="ADR33172.1"
FT                   /translation="MIRYRAYAKVNIFLKITGMRGEYHTLSSRFMRVKDLFDTLWFEEK
FT                   ATPEFEIRGSFDCEVHANTIYKAYKHLLAVTRSDKLSSFFESHAVCVDKKIPSFAGLGG
FT                   GSSDAATFLTMCNEELELGLSLNELAEIASHIGADVPFFVYGYESANVSGIGEVVERFD
FT                   EPLIDFEVVTPDIQISTPSVYRYYREHLYAPISAEEAARLESTPSRDILAFMSPKEAND
FT                   LYPSALACYSELSEKEGWFFSGSGSSFFRIK"
FT   gene            complement(484031..484261)
FT                   /locus_tag="Sulku_0506"
FT   CDS_pept        complement(484031..484261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0506"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="COGs: COG1551 Carbon storage regulator (could also
FT                   regulate swarming and quorum sensing); InterPro IPR003751;
FT                   KEGG: wsu:WS0879 carbon storage regulator; PFAM: carbon
FT                   storage regulator; SPTR: Carbon storage regulator homolog;
FT                   TIGRFAM: carbon storage regulator; PFAM: Global regulator
FT                   protein family; TIGRFAM: carbon storage regulator (csrA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33173"
FT                   /db_xref="GOA:E4U008"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:E4U008"
FT                   /protein_id="ADR33173.1"
FT                   /translation="MLILSRRAEESIIIADTITVKVVSIEKGVVKLGIDAPHNIRVLRS
FT                   ELVRAVEDSNKEASSHQDESLLQQLAQKLRL"
FT   gene            complement(484255..485076)
FT                   /locus_tag="Sulku_0507"
FT   CDS_pept        complement(484255..485076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0507"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR002501; KEGG: sdl:Sdel_1632 pseudouridylate synthase
FT                   TruB domain protein; PFAM: pseudouridylate synthase TruB
FT                   domain protein; SPTR: tRNA pseudouridine synthase B; PFAM:
FT                   TruB family pseudouridylate synthase (N terminal domain);
FT                   TIGRFAM: tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33174"
FT                   /db_xref="GOA:E4U009"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E4U009"
FT                   /protein_id="ADR33174.1"
FT                   /translation="MNRLFVAYKPSGISSNQLLGRLKRKYGVKKAGYSGTLDPFAKGVL
FT                   IIAFGNHGRLFRFLNKTPKRYRATLWLGAYSPTLDIEKIETIDEIQPVSVEQIEAIFAS
FT                   LVGELTYLPPKYSAKRIEGRRAYELAREGKEVDLRAITSTIYDLTFKHYCHPFVTFEAT
FT                   VSEGSYIRSLGEIIAEHLGCNGALTALERLNEGQFIFENEKELDIKSSLALTKNRYNGT
FT                   LQTMLLGQPLLREDFEIQEEGTYWIDNGDTISILEITPEGVRYILNKVEAC"
FT   gene            complement(485083..487131)
FT                   /locus_tag="Sulku_0508"
FT   CDS_pept        complement(485083..487131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0508"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR000212: IPR014016: IPR014017; KEGG:
FT                   tdn:Suden_0437 UvrD/REP helicase; PFAM: UvrD/REP helicase;
FT                   SPTR: UvrD/REP helicase subfamily; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33175"
FT                   /db_xref="GOA:E4U010"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E4U010"
FT                   /protein_id="ADR33175.1"
FT                   /translation="MDEILSNLNEAQRSAVERIDGPLLILAGAGSGKTKTITTRLAYLL
FT                   DQVGIPAGNTLTLTFTNKAAKEMRERAMGLITQNSYPPLLCTFHKFGLLFLKFHIHLLG
FT                   RANNFVVIDTDDKKKIIKKINADLPTALIASEISRYKNSLIDPEEAYAQAELTNYKHIA
FT                   KIYEEYEAYLLKNNLVDFDDLLCLTYKLLDENPDLCAQTSEKYRYIMIDEYQDTNELQL
FT                   RLLQKLCTTHNNLCVVGDDDQSIYGWRGAHVRNILEFDQDFADAMVVKLEHNYRSTQPI
FT                   LTVANALIEHNRSRLGKTLIATKTGGDEVQTITSNDESEESQKIAKAIKELISKGVRPN
FT                   EIAVLYRINALSRSLEEGLNRTGVAYKLVGGLRFYDRAEIKDLISYLRVITNVHDNFSL
FT                   KRIINKPKRGLGKATIDKIELSSIEAGKSMFEFISTLSDSDLEGLVRKKSAGELRDFVA
FT                   EILELRRVSEEAIYRFIDLLEERFKIKETLKGLPDEAEKIANVDEFYGLFRDYVKQNPE
FT                   ASLAEFLNDITLQSEQDQVEGESIYIMSIHASKGLEFEHLFVIGLEEGFLPLIGDGSDL
FT                   EEERRLGYVAITRAKSNLTLSNVNSRFYKGRRTDLQKSRFINEAGLCEGSLILEKNTSY
FT                   KKGDLVRHKIFGAGRVEGVSKAGREFKLSINFGGNKRDILASFVEKL"
FT   gene            487296..488195
FT                   /locus_tag="Sulku_0509"
FT   CDS_pept        487296..488195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0509"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847: IPR005119; KEGG: tdn:Suden_0436 LysR family
FT                   transcriptional regulator; PFAM: regulatory protein LysR;
FT                   LysR substrate-binding; SPTR: Transcriptional regulator,
FT                   LysR family; PFAM: Bacterial regulatory helix-turn-helix
FT                   protein, lysR family; LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33176"
FT                   /db_xref="GOA:E4U011"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E4U011"
FT                   /protein_id="ADR33176.1"
FT                   /translation="MLKDFAKLMTFLTVVREKSFSKASAKLGISQPAVTQQIKFIEDYL
FT                   DTRVVERKKNGIKLTKEGEDLYRIATKLEKAIQVSEKEVLKIINKEFTFIVGASYAIGN
FT                   YVLPSYIGQLKDKINNEVHIRVAFSEEIIDQLLDKKIDIALIESPVFKDGLIYREWEED
FT                   ELVIFSNQPIPKQLRKEDMYKFDWICRDENSHTRKLTSEVFEEIGVECSSFSVIGVVAS
FT                   STAIKETLMRSPKDAARPVVSVISRHVISDEVEEGKLFEARIKNYKIKRKFYIVYSKER
FT                   KHDAFIDNVVTYLLGLKL"
FT   sig_peptide     487296..487364
FT                   /locus_tag="Sulku_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(488306..488767)
FT                   /locus_tag="Sulku_0510"
FT   CDS_pept        complement(488306..488767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0435 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33177"
FT                   /db_xref="UniProtKB/TrEMBL:E4U012"
FT                   /protein_id="ADR33177.1"
FT                   /translation="MLFDIIKSSSFARLMENHIREMLIYLFENDQNFGILCKIEHVTFD
FT                   PPLPKHLNDEFRSMTLFFLAGYTFESARIENDTLIFEAGFGQENIGSFVSVPLLSIVQI
FT                   IVDDTPAFVNLALPQEQHPIVNIEKHEGVQNSMSALLSNPENQKFLKKK"
FT   gene            complement(488931..489500)
FT                   /locus_tag="Sulku_0511"
FT   CDS_pept        complement(488931..489500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0387 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Aminotransferase
FT                   class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33178"
FT                   /db_xref="GOA:E4U013"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4U013"
FT                   /protein_id="ADR33178.1"
FT                   /translation="MLLETIRCEHKEAKHLPYHQKRLELACQALGITKRYDLKALITPP
FT                   DEKLYRCRFLYDQQGYSIEFHPYFPKKISSLKLITCDSLEYPLKYADREVLNALFELRA
FT                   ECDDVLIIKNGCLSDTTIANIALQIDGVWLTPDKPLLRGTTRARLIDEGFLTPAPLRPS
FT                   DIAKATKIALMNAMVGFIEVENGIIP"
FT   gene            complement(489501..490424)
FT                   /locus_tag="Sulku_0512"
FT   CDS_pept        complement(489501..490424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0512"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COGs: COG0031 Cysteine synthase; InterProIPR005856:
FT                   IPR005859: IPR001926: IPR010916: IPR 001216; KEGG:
FT                   abu:Abu_2299 cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Cysteine synthase; TIGRFAM: cysteine synthase A;
FT                   cysteine synthase; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme; TIGRFAM: cysteine synthase A; cysteine synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33179"
FT                   /db_xref="GOA:E4U014"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E4U014"
FT                   /protein_id="ADR33179.1"
FT                   /translation="MNIASNITELIGNTPLVRLNAPSDQNGATILGKCEFMNPTSSVKD
FT                   RIGFNMIKTAMEAGLINADTLIVEPTSGNTGIALASICAALGLKLTLTMPESMSIERRN
FT                   LLKALGANLVLTPAALGMKGAIDEADALVASNPNAIVLQQFANPANPAIHRVTTAQEIL
FT                   RDTDGKVDIFVAAVGTGGTLTGTGEALRAVLPNIQIIAVEPKDSPVLSGGKPGPHKIQG
FT                   IGAGFVPNVLNTSLYNEVITVSNEDAIAASKALAKTEGLLVGISAGANVHAAALVAARP
FT                   ENKGKTIVTILCDTAERYLSTPLFES"
FT   gene            490663..492120
FT                   /locus_tag="Sulku_0513"
FT   CDS_pept        490663..492120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0513"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /EC_number="6.4.1.1"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005481: IPR005479: IPR005482:
FT                   IPR011761: IPR 011764; KEGG: abu:Abu_0605 acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; SPTR: Acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33180"
FT                   /db_xref="GOA:E4U015"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4U015"
FT                   /protein_id="ADR33180.1"
FT                   /translation="MKTKKISKVLIANRGEIALRIIRACKELGIKSVVVFSEVDVNGVW
FT                   VRKADECYPIMGDPIAAYLDYERIISLAKKADCDAIHPGYGFLSESAEFAQACIDNGII
FT                   FIGPKPEHIALFGDKMASKVAMREVGVPMLPGTDEPIDNIEDAEKIAIDIGFPIIIKAA
FT                   FGGGGRGMRIVEKAEDFKEMYESATNEALRFFSRGEVFIEKYLKNPRHIEIQIVADKYG
FT                   NIVHLGDRDCSIQRRHQKVIEIAPSPLLNHETRRELYRISKKAMYRLGYESVGTIEYLV
FT                   DQDDNIYFIEMNTRVQVEHPVTEAISGIDLIQRMIQIAEGDQLKFMQEEIHLRGYAIEF
FT                   RINAENPKLGFVPSPGLITNYLAPGGPGVRLDSMAYTNYQIPSNYDSMIGKLIVTALTW
FT                   EDAVRKAARALDEFLIEGVPTNIPLHRQIVRDQDFIDGKIDTGYLDTKLQHFNLDAIHN
FT                   MDDEEAKMQHITAVIEAINKNNLNVRH"
FT   gene            complement(492150..493367)
FT                   /locus_tag="Sulku_0514"
FT   CDS_pept        complement(492150..493367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0514"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="COGs: COG0815 Apolipoprotein N-acyltransferase;
FT                   InterPro IPR004563: IPR003010; KEGG: tdn:Suden_1577
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; SPTR:
FT                   Apolipoprotein N-acyltransferase; TIGRFAM: apolipoprotein
FT                   N-acyltransferase; PFAM: Carbon-nitrogen hydrolase;
FT                   TIGRFAM: apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33181"
FT                   /db_xref="GOA:E4U016"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E4U016"
FT                   /protein_id="ADR33181.1"
FT                   /translation="MKYRSSPLIELVVAPLIIALFFSAFIYWEYFSLTSKALNTLSGLI
FT                   ALYALLHVPKRTVLLSGFWIGWLWCYWIGFSFQYYGLGWATWLVALGFGFVYALYYGTM
FT                   ALTTDALLRALILFGLTFVWPMDFNWMQPELIFVESYLGFSKWQFALILFALASTAYFK
FT                   GFKKAIPLLLLLGSVQLSYTPPPVPDLKIKLVSTDISQDFKWQSDRLPQTIQDNFSAID
FT                   EAIAQGYDLIVLPESAFPLYMNEHTEISEALSMRSLHIAILTGTLHKENGLNYNVSYLF
FT                   NQGNITVAKKTILVPFGEYIPLPKFLRGWVNREIFGGGADFVTARTPTDFQVKGVTFRN
FT                   AVCYEATRRELYTPDVRYMVAVSNNGWFKPSIEPTLQNLLIRFYARQNKTIVFHAVNGG
FT                   GSGIVY"
FT   gene            493437..493703
FT                   /locus_tag="Sulku_0515"
FT   CDS_pept        493437..493703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0515"
FT                   /product="protein translocase subunit yajC"
FT                   /note="COGs: COG1862 Preprotein translocase subunit YajC;
FT                   InterPro IPR003849; KEGG: tdn:Suden_1576 preprotein
FT                   translocase subunit YajC; PFAM: YajC family protein; SPTR:
FT                   Preprotein translocase, YajC subunit; TIGRFAM: preprotein
FT                   translocase, YajC subunit; PFAM: Preprotein translocase
FT                   subunit; TIGRFAM: preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33182"
FT                   /db_xref="GOA:E4U017"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E4U017"
FT                   /protein_id="ADR33182.1"
FT                   /translation="MEILSQILPFVFLIAIMYFVIIRPQNQQAKKHKEMIEALTKGDKI
FT                   ITTGGLIVEIKKVEDKFFMIKMNNETEARLVKDAVARKYEDEA"
FT   sig_peptide     493437..493523
FT                   /locus_tag="Sulku_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            493693..495270
FT                   /locus_tag="Sulku_0516"
FT   CDS_pept        493693..495270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0516"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="COGs: COG0342 Preprotein translocase subunit SecD;
FT                   InterPro IPR005791: IPR003335: IPR001036; KEGG:
FT                   tdn:Suden_1575 preprotein translocase subunit SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; SPTR:
FT                   Protein-export membrane protein SecD; TIGRFAM:
FT                   protein-export membrane protein SecD; protein-export
FT                   membrane protein, SecD/SecF family; manually curated; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33183"
FT                   /db_xref="GOA:E4U018"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E4U018"
FT                   /protein_id="ADR33183.1"
FT                   /translation="MKLNYRVVLLIIATVFGLIFSLPSFTQSSEGKKITLGLDLQGGLH
FT                   MLLGVKTEEAVNSQIKSIASGVKHFAERNDILIEGISVREGKVVFELLDGDDATTMDEH
FT                   LKTIEGTVVHASEGKYAISITPEAVEKLKLQAVDQAIETIRNRLDQFGLAEPTVAKQGI
FT                   DKILVELPGIKTAEEEQRARELISRAAKLELMAVDEDRSMRVNDLSEAEAASYGDRILE
FT                   DALQPQMKHLVNEIPILDGTMLTDAQVGYDQNNRPVINFSLNSAGAQVFGDFTGKSVGK
FT                   RLAIVLDGKVYSAPVINERIGGGSGQISGNYTVAEANDLAIALRSGALLAPIYMLEKRS
FT                   VGPSLGADSIKASLLALVSGFVLVMIFMIMYYGLAGIIANLAVVINIFIILAMMALLGA
FT                   TLTLPGMAGIVLHIGLAVDANIIINERVREQIRLGIGLKRALHEGYSKAMRAILDSNIT
FT                   QIIACTILYVYGTGAIKGFAVTLSMGILASMLTAIVGTYGIFQLFTNRIEKSKNYKMWF
FT                   GMTRKVNA"
FT   sig_peptide     493693..493776
FT                   /locus_tag="Sulku_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            495270..496241
FT                   /locus_tag="Sulku_0517"
FT   CDS_pept        495270..496241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0517"
FT                   /product="protein translocase subunit secF"
FT                   /note="COGs: COG0341 Preprotein translocase subunit SecF;
FT                   InterPro IPR005665: IPR003335; KEGG: wsu:WS1247 preprotein
FT                   translocase subunit SecF; PFAM: SecD/SecF/SecDF export
FT                   membrane protein; SPTR: PROTEIN-EXPORT MEMBRANE PROTEIN
FT                   SECF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein, SecD/SecF family;
FT                   protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33184"
FT                   /db_xref="GOA:E4U019"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E4U019"
FT                   /protein_id="ADR33184.1"
FT                   /translation="MELFKEDKVYNFLGKGKIFFVASFVLFFLAIALIATKGFSFGIDF
FT                   TGGTVVQVKYQGPAPIDKVREALEKDELFKHAAVSEFGSPEEIVIKTAASTDGLSKDIG
FT                   DVTREILKGTGEFEIRRVDMVGPKVGDELRVKGLTAFLLTLGAIMAMVTFRYEWRFALA
FT                   AIIAIVHDIVITFGFVSYFEIDFNIESVAALLMILGYSIHDTIIVYDRIREHIQESKNS
FT                   DFVMIVNEAVSRTQSRTTLTSLTVFFVVLTLFLFGGDIMLGFSFPMLVGVIIGTYSSIF
FT                   VAAQLVVWTGFSVGRYREKMAEKQKMQAEKEKMRAQFEQGIV"
FT   sig_peptide     495270..495389
FT                   /locus_tag="Sulku_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            496271..498718
FT                   /locus_tag="Sulku_0518"
FT   CDS_pept        496271..498718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0518"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COGs: COG0495 Leucyl-tRNA synthetase; InterPro
FT                   IPR002302: IPR002300: IPR001412; KEGG: tdn:Suden_1572
FT                   leucyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ia; SPTR: Leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase; PFAM: tRNA synthetases class I (I,
FT                   L, M and V); TIGRFAM: leucyl-tRNA synthetase, eubacterial
FT                   and mitochondrial family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33185"
FT                   /db_xref="GOA:E4U020"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E4U020"
FT                   /protein_id="ADR33185.1"
FT                   /translation="MNYTPASIEAKWQKTWSTTKAYEPSDDFSKPKKYVLSMFPYPSGR
FT                   IHMGHVRNYTIGDAFARYYRQQGFNVLHPIGWDSFGMPAENAAIKHGVHPKKWTYENIA
FT                   TMRGELAGLGLSFSEDREFATSNPEYTAFEQGFIIDMFNRGLLYRKQGFLNWCPHDLTV
FT                   LANEQVVDGGCWRCGTPIVQKEMYQYYLKISDYAEELLESLKTLEGKWPKQVLTMQENW
FT                   IGKSYGLEFAFKLDEESEGKLGAVYQSFDVFTTRPDTIYGVSYAALAPEHEIVRHMLSF
FT                   GLLDEATSDAIKAMQRVSARDRATSPKEGVSLGIHVIHPLTGAKVPVWVANFVLTDYGS
FT                   GAVMAVPAHDDRDYEFAAKYNLPIKAVIFPSEGELPLGCAYTEAGTLRESAQFSGLDNV
FT                   TAKASIMDHFEASHLGKKVINFRLKDWGISRQRYWGAPIPLIHCESCGIVPEDKANLPV
FT                   ALPEDVVINGEGNPLEHHPTWKHCTCPKCGKSAVRETDTMDTFIQSSWYFLRYTVKNDY
FT                   QKALDPAALDYWMGVDHYIGGIEHAILHLLYARFFTKMLRDLGYVNSDEPFEHLLTQGM
FT                   VLKDGAKMSKSKGNTVDPGELVAKYGADTARLFILFAAPPTQELEWNDSAVEGAFRFLK
FT                   RFADRSQYVNVTDKLPSIEHSTLSKEEKAARKKVYEALKRAQEVYGERHTFNTMIAGVM
FT                   EAMNALNEQNNRDVWTEGYWILTSVMEPIVPHICWELSTNLFNGKNFGTQTVREEVFEV
FT                   EALALGVSINGKNRATIEVGVNESQEAIIEIAKASVEKWIEGKEIVKAIVIPGKLVNLV
FT                   IKG"
FT   gene            498722..499219
FT                   /locus_tag="Sulku_0519"
FT   CDS_pept        498722..499219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1463 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33186"
FT                   /db_xref="UniProtKB/TrEMBL:E4U021"
FT                   /protein_id="ADR33186.1"
FT                   /translation="MKYWILSALIFLAGCGYQPSSHLAKNVVGDSVSTEVVIRMEDPQN
FT                   TVIIKDAVDMAVITRFRTALVPKNVSHTHLKIMINSVSFSPLRYDTNGYIITYRTAVVM
FT                   GISRTTAGKTANYTTSGVYDFDIEPNAIISDQARFEAIRQGAQKGIDVFIAQVSAQGSD
FT                   SK"
FT   sig_peptide     498722..498793
FT                   /locus_tag="Sulku_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            499229..500764
FT                   /locus_tag="Sulku_0520"
FT   CDS_pept        499229..500764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0520"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160; KEGG: tdn:Suden_1570 diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein; SPTR: Diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33187"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4U022"
FT                   /protein_id="ADR33187.1"
FT                   /translation="MTINQIVRNTVERLKAEGKVWTPDVYAETFCAEAKKAGFAVEDCS