(data stored in ACNUC10043 zone)

EMBL: CP002363

ID   CP002363; SV 1; circular; genomic DNA; STD; PRO; 1314639 BP.
XX
AC   CP002363;
XX
PR   Project:PRJNA48641;
XX
DT   21-JAN-2011 (Rel. 107, Created)
DT   28-JUN-2015 (Rel. 125, Last updated, Version 8)
XX
DE   Desulfurococcus mucosus DSM 2162, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Desulfurococcus mucosus DSM 2162
OC   Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales;
OC   Desulfurococcaceae; Desulfurococcus.
XX
RN   [1]
RP   1-1314639
RX   DOI; 10.4056/sigs.1644004.
RX   PUBMED; 21677854.
RA   Wirth R., Chertkov O., Held B., Lapidus A., Nolan M., Lucas S., Hammon N.,
RA   Deshpande S., Cheng J.F., Tapia R., Han C., Goodwin L., Pitluck S.,
RA   Liolios K., Ioanna P., Ivanova N., Mavromatis K., Mikhailova N., Pati A.,
RA   Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Bilek Y., Hader T., Rohde M., Spring S., Sikorski J., Goker M., Woyke T.,
RA   Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C.,
RA   Klenk H.P.;
RT   "Complete genome sequence of Desulfurococcus mucosus type strain (O7/1)";
RL   Stand Genomic Sci 4(2):173-182(2011).
XX
RN   [2]
RP   1-1314639
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Bruce D., Goodwin L., Pitluck S.,
RA   Kyrpides N., Mavromatis K., Pagani I., Ivanova N., Ovchinnikova G.,
RA   Chertkov O., Held B., Brettin T., Detter J.C., Tapia R., Han C., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Wirth R., Bilek Y., Hader T., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (23-NOV-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fa9e7970966751b6aab90a7246ab1318.
DR   BioSample; SAMN00103627.
DR   CABRI; DSM 2162.
DR   EnsemblGenomes-Gn; Desmu_R0001.
DR   EnsemblGenomes-Gn; Desmu_R0002.
DR   EnsemblGenomes-Gn; Desmu_R0003.
DR   EnsemblGenomes-Gn; Desmu_R0004.
DR   EnsemblGenomes-Gn; Desmu_R0005.
DR   EnsemblGenomes-Gn; Desmu_R0006.
DR   EnsemblGenomes-Gn; Desmu_R0007.
DR   EnsemblGenomes-Gn; Desmu_R0008.
DR   EnsemblGenomes-Gn; Desmu_R0009.
DR   EnsemblGenomes-Gn; Desmu_R0010.
DR   EnsemblGenomes-Gn; Desmu_R0011.
DR   EnsemblGenomes-Gn; Desmu_R0012.
DR   EnsemblGenomes-Gn; Desmu_R0013.
DR   EnsemblGenomes-Gn; Desmu_R0014.
DR   EnsemblGenomes-Gn; Desmu_R0015.
DR   EnsemblGenomes-Gn; Desmu_R0016.
DR   EnsemblGenomes-Gn; Desmu_R0017.
DR   EnsemblGenomes-Gn; Desmu_R0018.
DR   EnsemblGenomes-Gn; Desmu_R0019.
DR   EnsemblGenomes-Gn; Desmu_R0020.
DR   EnsemblGenomes-Gn; Desmu_R0021.
DR   EnsemblGenomes-Gn; Desmu_R0022.
DR   EnsemblGenomes-Gn; Desmu_R0023.
DR   EnsemblGenomes-Gn; Desmu_R0024.
DR   EnsemblGenomes-Gn; Desmu_R0025.
DR   EnsemblGenomes-Gn; Desmu_R0026.
DR   EnsemblGenomes-Gn; Desmu_R0027.
DR   EnsemblGenomes-Gn; Desmu_R0028.
DR   EnsemblGenomes-Gn; Desmu_R0029.
DR   EnsemblGenomes-Gn; Desmu_R0030.
DR   EnsemblGenomes-Gn; Desmu_R0031.
DR   EnsemblGenomes-Gn; Desmu_R0032.
DR   EnsemblGenomes-Gn; Desmu_R0033.
DR   EnsemblGenomes-Gn; Desmu_R0034.
DR   EnsemblGenomes-Gn; Desmu_R0035.
DR   EnsemblGenomes-Gn; Desmu_R0036.
DR   EnsemblGenomes-Gn; Desmu_R0037.
DR   EnsemblGenomes-Gn; Desmu_R0038.
DR   EnsemblGenomes-Gn; Desmu_R0039.
DR   EnsemblGenomes-Gn; Desmu_R0040.
DR   EnsemblGenomes-Gn; Desmu_R0041.
DR   EnsemblGenomes-Gn; Desmu_R0042.
DR   EnsemblGenomes-Gn; Desmu_R0043.
DR   EnsemblGenomes-Gn; Desmu_R0044.
DR   EnsemblGenomes-Gn; Desmu_R0045.
DR   EnsemblGenomes-Gn; Desmu_R0046.
DR   EnsemblGenomes-Gn; Desmu_R0047.
DR   EnsemblGenomes-Gn; Desmu_R0048.
DR   EnsemblGenomes-Gn; Desmu_R0049.
DR   EnsemblGenomes-Gn; Desmu_R0050.
DR   EnsemblGenomes-Gn; EBG00001095863.
DR   EnsemblGenomes-Gn; EBG00001095864.
DR   EnsemblGenomes-Gn; EBG00001095865.
DR   EnsemblGenomes-Gn; EBG00001095866.
DR   EnsemblGenomes-Gn; EBG00001095867.
DR   EnsemblGenomes-Gn; EBG00001095868.
DR   EnsemblGenomes-Gn; EBG00001095869.
DR   EnsemblGenomes-Gn; EBG00001095870.
DR   EnsemblGenomes-Gn; EBG00001095871.
DR   EnsemblGenomes-Gn; EBG00001095872.
DR   EnsemblGenomes-Gn; EBG00001095873.
DR   EnsemblGenomes-Gn; EBG00001095874.
DR   EnsemblGenomes-Gn; EBG00001095875.
DR   EnsemblGenomes-Gn; EBG00001095876.
DR   EnsemblGenomes-Gn; EBG00001095877.
DR   EnsemblGenomes-Gn; EBG00001095878.
DR   EnsemblGenomes-Gn; EBG00001095879.
DR   EnsemblGenomes-Gn; EBG00001095880.
DR   EnsemblGenomes-Gn; EBG00001095881.
DR   EnsemblGenomes-Gn; EBG00001095882.
DR   EnsemblGenomes-Gn; EBG00001095883.
DR   EnsemblGenomes-Gn; EBG00001095884.
DR   EnsemblGenomes-Gn; EBG00001095885.
DR   EnsemblGenomes-Gn; EBG00001095886.
DR   EnsemblGenomes-Gn; EBG00001095887.
DR   EnsemblGenomes-Gn; EBG00001095888.
DR   EnsemblGenomes-Gn; EBG00001095889.
DR   EnsemblGenomes-Gn; EBG00001095890.
DR   EnsemblGenomes-Gn; EBG00001095891.
DR   EnsemblGenomes-Gn; EBG00001095892.
DR   EnsemblGenomes-Gn; EBG00001095893.
DR   EnsemblGenomes-Gn; EBG00001095894.
DR   EnsemblGenomes-Gn; EBG00001095895.
DR   EnsemblGenomes-Gn; EBG00001095897.
DR   EnsemblGenomes-Gn; EBG00001095898.
DR   EnsemblGenomes-Gn; EBG00001095899.
DR   EnsemblGenomes-Gn; EBG00001095900.
DR   EnsemblGenomes-Gn; EBG00001095901.
DR   EnsemblGenomes-Gn; EBG00001095902.
DR   EnsemblGenomes-Gn; EBG00001095903.
DR   EnsemblGenomes-Gn; EBG00001095904.
DR   EnsemblGenomes-Gn; EBG00001095905.
DR   EnsemblGenomes-Gn; EBG00001095906.
DR   EnsemblGenomes-Gn; EBG00001095907.
DR   EnsemblGenomes-Gn; EBG00001095908.
DR   EnsemblGenomes-Gn; EBG00001095909.
DR   EnsemblGenomes-Gn; EBG00001095910.
DR   EnsemblGenomes-Gn; EBG00001095911.
DR   EnsemblGenomes-Gn; EBG00001095912.
DR   EnsemblGenomes-Gn; EBG00001095913.
DR   EnsemblGenomes-Gn; EBG00001095914.
DR   EnsemblGenomes-Gn; EBG00001095915.
DR   EnsemblGenomes-Tr; Desmu_R0001-1.
DR   EnsemblGenomes-Tr; Desmu_R0002-1.
DR   EnsemblGenomes-Tr; Desmu_R0003-1.
DR   EnsemblGenomes-Tr; Desmu_R0004-1.
DR   EnsemblGenomes-Tr; Desmu_R0005-1.
DR   EnsemblGenomes-Tr; Desmu_R0006-1.
DR   EnsemblGenomes-Tr; Desmu_R0007-1.
DR   EnsemblGenomes-Tr; Desmu_R0008-1.
DR   EnsemblGenomes-Tr; Desmu_R0009-1.
DR   EnsemblGenomes-Tr; Desmu_R0010-1.
DR   EnsemblGenomes-Tr; Desmu_R0011-1.
DR   EnsemblGenomes-Tr; Desmu_R0012-1.
DR   EnsemblGenomes-Tr; Desmu_R0013-1.
DR   EnsemblGenomes-Tr; Desmu_R0014-1.
DR   EnsemblGenomes-Tr; Desmu_R0015-1.
DR   EnsemblGenomes-Tr; Desmu_R0016-1.
DR   EnsemblGenomes-Tr; Desmu_R0017-1.
DR   EnsemblGenomes-Tr; Desmu_R0018-1.
DR   EnsemblGenomes-Tr; Desmu_R0019-1.
DR   EnsemblGenomes-Tr; Desmu_R0020-1.
DR   EnsemblGenomes-Tr; Desmu_R0021-1.
DR   EnsemblGenomes-Tr; Desmu_R0022-1.
DR   EnsemblGenomes-Tr; Desmu_R0023-1.
DR   EnsemblGenomes-Tr; Desmu_R0024-1.
DR   EnsemblGenomes-Tr; Desmu_R0025-1.
DR   EnsemblGenomes-Tr; Desmu_R0026-1.
DR   EnsemblGenomes-Tr; Desmu_R0027-1.
DR   EnsemblGenomes-Tr; Desmu_R0028-1.
DR   EnsemblGenomes-Tr; Desmu_R0029-1.
DR   EnsemblGenomes-Tr; Desmu_R0030-1.
DR   EnsemblGenomes-Tr; Desmu_R0031-1.
DR   EnsemblGenomes-Tr; Desmu_R0032-1.
DR   EnsemblGenomes-Tr; Desmu_R0033-1.
DR   EnsemblGenomes-Tr; Desmu_R0034-1.
DR   EnsemblGenomes-Tr; Desmu_R0035-1.
DR   EnsemblGenomes-Tr; Desmu_R0036-1.
DR   EnsemblGenomes-Tr; Desmu_R0037-1.
DR   EnsemblGenomes-Tr; Desmu_R0038-1.
DR   EnsemblGenomes-Tr; Desmu_R0039-1.
DR   EnsemblGenomes-Tr; Desmu_R0040-1.
DR   EnsemblGenomes-Tr; Desmu_R0041-1.
DR   EnsemblGenomes-Tr; Desmu_R0042-1.
DR   EnsemblGenomes-Tr; Desmu_R0043-1.
DR   EnsemblGenomes-Tr; Desmu_R0044-1.
DR   EnsemblGenomes-Tr; Desmu_R0045-1.
DR   EnsemblGenomes-Tr; Desmu_R0046-1.
DR   EnsemblGenomes-Tr; Desmu_R0047-1.
DR   EnsemblGenomes-Tr; Desmu_R0048-1.
DR   EnsemblGenomes-Tr; Desmu_R0049-1.
DR   EnsemblGenomes-Tr; Desmu_R0050-1.
DR   EnsemblGenomes-Tr; EBT00001550584.
DR   EnsemblGenomes-Tr; EBT00001550585.
DR   EnsemblGenomes-Tr; EBT00001550586.
DR   EnsemblGenomes-Tr; EBT00001550587.
DR   EnsemblGenomes-Tr; EBT00001550588.
DR   EnsemblGenomes-Tr; EBT00001550589.
DR   EnsemblGenomes-Tr; EBT00001550590.
DR   EnsemblGenomes-Tr; EBT00001550591.
DR   EnsemblGenomes-Tr; EBT00001550592.
DR   EnsemblGenomes-Tr; EBT00001550593.
DR   EnsemblGenomes-Tr; EBT00001550594.
DR   EnsemblGenomes-Tr; EBT00001550595.
DR   EnsemblGenomes-Tr; EBT00001550596.
DR   EnsemblGenomes-Tr; EBT00001550598.
DR   EnsemblGenomes-Tr; EBT00001550599.
DR   EnsemblGenomes-Tr; EBT00001550600.
DR   EnsemblGenomes-Tr; EBT00001550601.
DR   EnsemblGenomes-Tr; EBT00001550602.
DR   EnsemblGenomes-Tr; EBT00001550603.
DR   EnsemblGenomes-Tr; EBT00001550604.
DR   EnsemblGenomes-Tr; EBT00001550605.
DR   EnsemblGenomes-Tr; EBT00001550606.
DR   EnsemblGenomes-Tr; EBT00001550607.
DR   EnsemblGenomes-Tr; EBT00001550608.
DR   EnsemblGenomes-Tr; EBT00001550609.
DR   EnsemblGenomes-Tr; EBT00001550610.
DR   EnsemblGenomes-Tr; EBT00001550611.
DR   EnsemblGenomes-Tr; EBT00001550612.
DR   EnsemblGenomes-Tr; EBT00001550613.
DR   EnsemblGenomes-Tr; EBT00001550614.
DR   EnsemblGenomes-Tr; EBT00001550615.
DR   EnsemblGenomes-Tr; EBT00001550616.
DR   EnsemblGenomes-Tr; EBT00001550617.
DR   EnsemblGenomes-Tr; EBT00001550618.
DR   EnsemblGenomes-Tr; EBT00001550619.
DR   EnsemblGenomes-Tr; EBT00001550620.
DR   EnsemblGenomes-Tr; EBT00001550621.
DR   EnsemblGenomes-Tr; EBT00001550622.
DR   EnsemblGenomes-Tr; EBT00001550623.
DR   EnsemblGenomes-Tr; EBT00001550624.
DR   EnsemblGenomes-Tr; EBT00001550625.
DR   EnsemblGenomes-Tr; EBT00001550626.
DR   EnsemblGenomes-Tr; EBT00001550627.
DR   EnsemblGenomes-Tr; EBT00001550628.
DR   EnsemblGenomes-Tr; EBT00001550629.
DR   EnsemblGenomes-Tr; EBT00001550630.
DR   EnsemblGenomes-Tr; EBT00001550631.
DR   EnsemblGenomes-Tr; EBT00001550632.
DR   EnsemblGenomes-Tr; EBT00001550633.
DR   EnsemblGenomes-Tr; EBT00001550634.
DR   EnsemblGenomes-Tr; EBT00001550635.
DR   EnsemblGenomes-Tr; EBT00001550636.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002363.
DR   SILVA-SSU; CP002363.
DR   StrainInfo; 120933; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4089449
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Desulfurococcus mucosus 07, DSM 2162
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Iceland
CC   environment         :: Fresh water, Sulfur spring
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 2162, ATCC 35584, JCM 9187
CC   biotic_relationship :: Free living
CC   trophic_level       :: Organotroph
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi02914
CC   Type Strain         :: Yes
CC   Funding Program     :: DOE-GEBA 2007
CC   Gene Calling Method :: Prodigal 1.4, GenePRIMP
CC   Isolation Site      :: Hot solfataric spring; Iceland
CC   Cell Shape          :: Coccus-shaped
CC   Motility            :: Motile
CC   Temperature Range   :: Hyperthermophile
CC   Temperature Optimum :: 85C
CC   Gram Staining       :: Gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1314639
FT                   /organism="Desulfurococcus mucosus DSM 2162"
FT                   /strain="DSM 2162"
FT                   /mol_type="genomic DNA"
FT                   /country="Iceland"
FT                   /isolation_source="hot solfataric spring"
FT                   /db_xref="taxon:765177"
FT                   /culture_collection="DSM:DSM 2162"
FT   gene            42..224
FT                   /locus_tag="Desmu_0001"
FT   CDS_pept        42..224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0001"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1061 IS605 family transposase OrfB;
FT                   SPTR: Transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64320"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA42"
FT                   /protein_id="ADV64320.1"
FT                   /translation="MRGLQPFVNEGLFPSRDNQMGGSLTTPTAPQMTDVNPNKCGEPMN
FT                   RPKGTPALKGGEEVR"
FT   gene            259..1443
FT                   /locus_tag="Desmu_0002"
FT   CDS_pept        259..1443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0002"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003593: IPR014277: IPR015163; KEGG:
FT                   dka:DKAM_1377 cell division control protein 6 - like
FT                   protein, cdc6; PFAM: CDC6 domain-containing protein; SMART:
FT                   AAA ATPase; SPTR: Cell division control protein 6 homolog;
FT                   TIGRFAM: orc1/cdc6 family replication initiation protein;
FT                   PFAM: ATPase family associated with various cellular
FT                   activities (AAA); CDC6, C terminal; TIGRFAM: orc1/cdc6
FT                   family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64321"
FT                   /db_xref="GOA:E8RA43"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA43"
FT                   /protein_id="ADV64321.1"
FT                   /translation="MEDIIDELIKKRGFASKVFKNREVLHPDYIPDTLPHRENEIKKLA
FT                   EHLLVSAQGIRPSNVLIYGLTGTGKTVVAKYVVGKLKEKASMLSTRLDYAYVNTRKLDT
FT                   TYRVIASIAQSIGLRIPHTGLAVSEVYRRYINALESWGGLHIVVLDEVDYYVKREGDDL
FT                   IYKLVRANEELTRAKIVLVGITNDINFVENLDPRVRSSMGEVEMVFPPYNAEQLYTILR
FT                   QRAELAFNPGVIDDGVISYCAALAAREHGDARRALDLLRVSGEIADREGADRVTIEHVK
FT                   KATLEIEEGRIYQSVVTLPLHQKIVLKKIVELVEAKGSATTGEIYAAYAESMKSLKYEP
FT                   LSPRRISEILMQLDMMGLITSETISRGRYGVTKVVRVKKDVLQVVKEALKDVEA"
FT   gene            1464..2054
FT                   /locus_tag="Desmu_0003"
FT   CDS_pept        1464..2054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0003"
FT                   /product="protein of unknown function DUF99"
FT                   /note="COGs: COG1628 conserved hypothetical protein;
FT                   InterPro IPR002802; KEGG: dka:DKAM_1378 protein of unknown
FT                   function DUF99; PFAM: protein of unknown function DUF99;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF99"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64322"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA44"
FT                   /protein_id="ADV64322.1"
FT                   /translation="MQDCGLVTVEAYDDGFFPVEYKGGRGDTYVVGVKTCGSSRIINIA
FT                   ASRIIVDGGWTHVAVREMSRLLGGGVIMLDGVTYAGFDVVDPFSLSSETGKPVIAVQLH
FT                   PLNLERVKAALLKHFADWEERFRVIRDYYNSLVPVETPWRPIQVAYTGISLGEAVSILR
FT                   QTCIYSPEPEPLRIADMIASSLSRLWLNQCVLC"
FT   gene            2157..4046
FT                   /locus_tag="Desmu_0004"
FT   CDS_pept        2157..4046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0004"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="COGs: COG1274 Phosphoenolpyruvate carboxykinase
FT                   (GTP); InterPro IPR008209; KEGG: dka:DKAM_1379
FT                   phosphoenolpyruvate carboxykinase; PFAM:
FT                   phosphoenolpyruvate carboxykinase (GTP); PRIAM:
FT                   Phosphoenolpyruvate carboxykinase (GTP); SPTR:
FT                   Phosphoenolpyruvate carboxykinase; PFAM:
FT                   Phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64323"
FT                   /db_xref="GOA:E8RA45"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA45"
FT                   /protein_id="ADV64323.1"
FT                   /translation="MDASVTGLLTRLSRYADERAVERLSRISDRRLLEWITEVVELLEP
FT                   ASVFVNTGSREDLEYIRMRAVEKREEIPSRYNPRHTVHFDGIYDLARDRENTRILTPGG
FT                   SPIPMVNTGNRDEGLRELREIYRGIMRGKEMYIGFYCFGPRGSPFTLYGVQVTDSAYVM
FT                   HSENILYRVCYDVFVEKGGSMRYMRFLHSAGELNEYGWSRNISKRRIYIDTVDNITYSV
FT                   NTQYAGNTVGLKKLSLRLCVNQGYRENWLCEHMFIVGVKGTGDTISYFTGAFPAGCGKT
FT                   STALIADTVVGDDLAMIRNVNGEARAVNPEIGMFGIIDGVNPVDDPEIYGILSSRETEV
FT                   IFSNVLLTEDGEVWWNGKPSEPRRGVNYAGEWWPGKLDEKGRPIPPSHPNARFTTSIFY
FT                   LSKVDPRINDPNGVPVSGMIFGGRDSDTWVPVEEAFNWVHGIVTKGASLESERTTAVLG
FT                   KAGEREFNPFAILDFLSVSPGEFIELHFRFGDGLEKQPRIYGVNYFLRDEAGRYLTEKV
FT                   DKRVWLKWMALRVNNEVDALETPTGLIPVYEDLAVLFKRELGKEFSIELYEKLFTVRVG
FT                   KHLEKAERILRIYENIPGTPRLFFDTLIEQKRRLKHALDKYGMFISPLSLDKR"
FT   gene            complement(4091..4164)
FT                   /locus_tag="Desmu_R0001"
FT   tRNA            complement(4091..4164)
FT                   /locus_tag="Desmu_R0001"
FT                   /product="tRNA-Lys"
FT   gene            4264..4503
FT                   /locus_tag="Desmu_R0002"
FT   tRNA            join(4264..4302,4468..4503)
FT                   /locus_tag="Desmu_R0002"
FT                   /product="tRNA-Gln"
FT   gene            complement(4507..5871)
FT                   /locus_tag="Desmu_0005"
FT   CDS_pept        complement(4507..5871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0005"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /note="COGs: COG0160 4-aminobutyrate aminotransferase and
FT                   related aminotransferase; InterPro IPR005814; KEGG:
FT                   dka:DKAM_1380 pyridoxal phosphate-dependent
FT                   aminotransferase; PFAM: aminotransferase class-III; SPTR:
FT                   Pyridoxal phosphate-dependent aminotransferase; PFAM:
FT                   Aminotransferase class-III; TIGRFAM: 4-aminobutyrate
FT                   aminotransferase, prokaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64324"
FT                   /db_xref="GOA:E8RA46"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA46"
FT                   /protein_id="ADV64324.1"
FT                   /translation="MGSPSRARGTSSQLIEKYKRYVSGSQAFKYFPMIVGKALNARIWD
FT                   TDGREYIDFLSSAATYNVGHSNREVLEAVKTQLDKFIHYCLYLYHEPVVELAELLAGIT
FT                   PGSFEKKVAFGLSGGDANDAALKAALVYTRRRVIVSFDYSYHGTTALDIAVSGSFSPEL
FT                   RGLMPFRDVYFAEYPDTYRCIGGVEDPEECGELYLSRFEELLKKIGGSNVAAIILEPVQ
FT                   GDGGVLIPPANFIKGVRKMASEHGIVLIDDEVQTGMGRTGRLFAIEHYSVEPDLMVLGK
FT                   ALGGGMPVSAVVGRSDIMDSAPPQSFFATSAAHAASVAAAIAVVKYVTRNNLHERAREM
FT                   GEYALKRLNELKEKYEVVGDVRGLGLMIGVDIVVDKKSKRPDRAKALKIIWRAWEKGLV
FT                   MMTYGKYGNVLRIAPPLTIPREDLDKGIDIIEESVKDVLEGKVPDEVVDKMTAWK"
FT   gene            complement(5911..6132)
FT                   /locus_tag="Desmu_0006"
FT   CDS_pept        complement(5911..6132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1381 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64325"
FT                   /db_xref="GOA:E8RA47"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA47"
FT                   /protein_id="ADV64325.1"
FT                   /translation="MSGENIPRGPTPLSLATWLASIIVVASLLLALGFSTGVEDVLNNW
FT                   PAHISIVLLLILLELAAWIAGRKRAQAG"
FT   sig_peptide     complement(6034..6132)
FT                   /locus_tag="Desmu_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            6244..7632
FT                   /locus_tag="Desmu_0007"
FT   CDS_pept        6244..7632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0007"
FT                   /product="amino acid carrier protein"
FT                   /note="COGs: COG1115 Na+/alanine symporter; InterPro
FT                   IPR001463; KEGG: dka:DKAM_1382 sodium:alanine symporter;
FT                   PFAM: sodium:alanine symporter; SPTR: Sodium:alanine
FT                   symporter; TIGRFAM: amino acid carrier protein; PFAM:
FT                   Sodium:alanine symporter family; TIGRFAM: amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64326"
FT                   /db_xref="GOA:E8RA48"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA48"
FT                   /protein_id="ADV64326.1"
FT                   /translation="MDVIELIRYIDGLVWGLPAIMILVGTGVAIAILGGFFQVRYLGKA
FT                   FKNLLYKGTGGKGEVKPFALFAAVMGATVGVGNIAGVSTAVHLGGAGALFWMWVCAILG
FT                   MGTKAVEATLAAWSRRITPDGRVEGGTPYYIRLVPVIGPALAVVFSVFTFIAAYGIGNT
FT                   VQANNVALGVEYIAKGYGWDPGLARLVAGVLMFVFTALVVLGGIRRIADVSNYLVPFMA
FT                   FWYIAASLIIWVKYAGNFPLAIKEIFTYAFTPQAAAGGLAGWMVYSAIRYGFARGLFSN
FT                   EAGLGSAPNAYAYMTVDHPGRVGLYGVFEVFMDTIVICTMTGIVDVVTRVYIERPDLDG
FT                   AALAMEAFYRAYGGWAPPILGIALALFAYTTLLTWEWYGEVNWLYFWSKTLGLPEKPLM
FT                   WIWRVMWVIPIIPAAVSAGLFKAFWDFADTMNGLMAIPNLIAVAYFAPVGIGLIKDFLK
FT                   SGKV"
FT   sig_peptide     6244..6336
FT                   /locus_tag="Desmu_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(7674..9365)
FT                   /locus_tag="Desmu_0008"
FT   CDS_pept        complement(7674..9365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0008"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG2896 Molybdenum cofactor biosynthesis
FT                   protein; InterPro IPR000385: IPR007197; KEGG: dka:DKAM_1383
FT                   predicted Fe-S oxidoreductase; PFAM: Radical SAM domain
FT                   protein; SPTR: Predicted Fe-S oxidoreductase; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64327"
FT                   /db_xref="GOA:E8RA49"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034471"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA49"
FT                   /protein_id="ADV64327.1"
FT                   /translation="MSLQQLSKKPGEIAYTLPKLRGGEEALSLTASVCPYCYRVLPAVI
FT                   VEREGKVYIRRVCPEHGEIEELYYGDVEFYKRVTKYTEDGRGTRHIYTQVKTLCPFNCG
FT                   LCPMHKQHTALVNMVVTNRCNLSCWYCFFYSEAAGYVYEPSLEQIRGMVRSIKKQGVTV
FT                   AIQLTGGEPLLREDLVDIVKLLREEGVRHIQLNTNGIKFAELYLEDPGKAVEYARQLRV
FT                   NGVNTVYLSFDGVSPVTNWKNHWEIPYIFETFRKAGMTSVVLVPTVIKGVNTHELGAIV
FT                   RFAAKHIDIVRAVNFQPVSLTGYMKKHERDKYRVTIPEVAKLIEEQTGGEVPREAWFPV
FT                   NVSAVFSRFIEGFSGEFKFEMSNHPICGVGTYVYVERENSGVKLTPITSFVDVEGLLEY
FT                   LREKWEDLVAGSNRYVTGLKVLYSIRKFIDPSKQPEGFDLYKLLFNIVVKRSYDALGEL
FT                   HYRLLFLGQMHFMDLYNYDIQRVQRCNIHYSTPDGRLIPFCAFNIFDDIYRDKIQREHG
FT                   IPLEEYSRKYGMPKGMVTRKYVRDRRRLESSELYKLTYEGVLMPGK"
FT   gene            9485..10066
FT                   /locus_tag="Desmu_0009"
FT   CDS_pept        9485..10066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0009"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COGs: COG1936 nucleotide kinase (related to CMP and
FT                   AMP kinase); KEGG: dka:DKAM_1384 predicted nucleotide
FT                   kinase; PRIAM: Adenylate kinase; SPTR: Predicted nucleotide
FT                   kinase; PFAM: ATPase family associated with various
FT                   cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64328"
FT                   /db_xref="GOA:E8RA50"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA50"
FT                   /protein_id="ADV64328.1"
FT                   /translation="MGLLLVVAGVPGTGKTSVARELASLTGFPLVELGSYAVEKGLVAG
FT                   FDAETGSYVIDEDALSREVSALAESVEGRLIVSTHYPEILEPDVVEKVFVLRAHPLVLA
FT                   ERLESRGWGRRKINENVMAEILGVVSYNAVEAFGEGKVYEVDTSNASPGEVARLIVGVL
FT                   EGRVNLAPGIRIDWLPILPPEVLSRFDNYE"
FT   sig_peptide     9485..9541
FT                   /locus_tag="Desmu_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            10059..10919
FT                   /locus_tag="Desmu_0010"
FT   CDS_pept        10059..10919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0010"
FT                   /product="Ras superfamily GTP-binding protein YlqF"
FT                   /note="COGs: COG1161 GTPase; InterPro IPR016478: IPR002917;
FT                   KEGG: dka:DKAM_1385 GTP-binding protein, HSR1-related;
FT                   PFAM: GTP-binding protein HSR1-related; SPTR: GTP-binding
FT                   protein, HSR1-related; PFAM: GTPase of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64329"
FT                   /db_xref="GOA:E8RA51"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA51"
FT                   /protein_id="ADV64329.1"
FT                   /translation="MSSRGGFTLASWSQLEKMVSRVDVVLMVLDSRDPLSTFSRRLESM
FT                   VERNGRKLILVLNKADLVPRSVAEEWKEYFTEKGYTTVYMAAARHMGTLRLRRTIRRVA
FT                   PSLPTLVAVAGYPKVGKSSIINGLKGRHSASTSPYPGSPGYTRHFQVYRVDKDIMVVDS
FT                   PGVIPVEGGELEMVIRGFPPEKLDDPVPPAVKLIERILRYHPDAFKKAYGIAETNPLRI
FT                   LEELAVKRGWFYKATREPLIEEAARTIIRNYHDGRIPFYIRPSQILGGGGALNDKGEGG
FT                   GGAVT"
FT   gene            10882..11082
FT                   /locus_tag="Desmu_0011"
FT   CDS_pept        10882..11082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1386 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: ThiS family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64330"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA52"
FT                   /protein_id="ADV64330.1"
FT                   /translation="MIKVRVAGEQSPRIVEAAGIRVSELLERLGLSRSEHIVLRNGVPL
FT                   TEDEVLGDGDEVLVYLVKSGG"
FT   gene            11097..11879
FT                   /locus_tag="Desmu_0012"
FT   CDS_pept        11097..11879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0012"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="COGs: COG0476 Dinucleotide-utilizing protein
FT                   involved in molybdopterin and thiamine biosynthesis family
FT                   2; InterPro IPR000594: IPR007901; KEGG: dka:DKAM_1387
FT                   MoeB/ThiF molybdopterin or thiamine synthase protein; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB domain
FT                   protein; SPTR: MoeB/thiF molybdopterin or thiamine synthase
FT                   protein; PFAM: MoeZ/MoeB domain; ThiF family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64331"
FT                   /db_xref="GOA:E8RA53"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA53"
FT                   /protein_id="ADV64331.1"
FT                   /translation="MALSEEELERYSRQLPIIGVEGQAKLKNTSILVAGAGGLGSAVLY
FT                   YLTAAGVGRIIFIDEGLVELSNLQRQILYTVDDIGRSKVTAAYERLRRLNPNVLLEPVQ
FT                   ASITRELLDEVMQRVDIVVDALDNWETRFTLDEAAWRHGKPLVHAGVGEHYGQLTVVIP
FT                   GKTPCLRYLFHGVRAREKGRVIVMPHIPGLLGLLEVNEVFKLILGYGDVMAGRILLFNA
FT                   KAPSIEVIEVKCGDFEKHCGKPGAVVEGLSHPSQGLQA"
FT   gene            complement(11848..12132)
FT                   /locus_tag="Desmu_0013"
FT   CDS_pept        complement(11848..12132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0013"
FT                   /product="thiamineS protein"
FT                   /note="InterPro IPR003749; KEGG: dka:DKAM_1388
FT                   molybdopterin converting factor, small subunit; PFAM:
FT                   thiamineS protein; SPTR: Molybdopterin converting factor,
FT                   small subunit; PFAM: ThiS family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64332"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA54"
FT                   /protein_id="ADV64332.1"
FT                   /translation="MLTGAGGMRVTLVVLGRASDYAGVNMAELELPENSTLKDAIRALS
FT                   ERTNPVLYERYINGHYIFVTLVNGKPVLSPETPLKDGDRITLVTPEMGG"
FT   sig_peptide     complement(12067..12132)
FT                   /locus_tag="Desmu_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(12188..12397)
FT                   /locus_tag="Desmu_0014"
FT   CDS_pept        complement(12188..12397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1389 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: ThiS family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64333"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA55"
FT                   /protein_id="ADV64333.1"
FT                   /translation="MIKVKLLPRNIEVEVDAEEAEVQVILEKLRNELSSDGVLVLVNGR
FT                   LVEDMRRVVRKGDTVVVVEEFLGG"
FT   gene            complement(12394..12912)
FT                   /locus_tag="Desmu_0015"
FT   CDS_pept        complement(12394..12912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0015"
FT                   /product="Protein of unknown function DUF2148"
FT                   /note="COGs: COG4739 Uncharacterized protein containing a
FT                   ferredoxin domain; InterPro IPR019224; KEGG: dka:DKAM_1390
FT                   hypothetical protein; PFAM: Protein of unknown function
FT                   DUF2148; SPTR: Uncharacterized protein containing a
FT                   ferredoxin domain; PFAM: Uncharacterized protein containing
FT                   a ferredoxin domain (DUF2148)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64334"
FT                   /db_xref="InterPro:IPR019224"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA56"
FT                   /protein_id="ADV64334.1"
FT                   /translation="MLIDEGDAVKKAVEAVAVLMVASAKTAPKARGVDNIVCMVVTDKG
FT                   ILEKLAAKMRELAGRYGAFFERDADSVAGSDAVVLIGCRLVKLSLVKPDKWLLDADTVN
FT                   SVVNLGIALGSAVKTASMLNIDNRIMFSVGVAAQELGLLDADIVYGVPLSIRGKNMYFD
FT                   RQQSSARKP"
FT   gene            complement(14011..14733)
FT                   /locus_tag="Desmu_0016"
FT   CDS_pept        complement(14011..14733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0016"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="COGs: COG2820 Uridine phosphorylase; InterPro
FT                   IPR018016: IPR000845; KEGG: dka:DKAM_0803 purine and other
FT                   phosphorylase, family 1; PFAM: purine or other
FT                   phosphorylase family 1; SPTR: Purine and other
FT                   phosphorylase, family 1; PFAM: Phosphorylase superfamily;
FT                   TIGRFAM: purine-nucleoside phosphorylase, family 1 (deoD)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64335"
FT                   /db_xref="GOA:E8RA57"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA57"
FT                   /protein_id="ADV64335.1"
FT                   /translation="MVGNVLIKEPPGGMGRSALIVGDPHRVELLSTLLEEPVVKTGVRG
FT                   YVYAIGKYRGERISIVTHGIGAPSASIVVEELHRLGVNVVVRLGTAGSIQHEIRVGDVI
FT                   LASTALCRIGGCATSMYMRDLTPPASPHPVLAARIIDALKGSGVKTWVAPVFTSDALHA
FT                   ETEGLIEELRGYGVAAVDMETAILYTLSWLRKLHAASVLIVSNNLVQGDQSILGTEELG
FT                   EAFKKVAKVILEVLHDYS"
FT   gene            complement(14740..15660)
FT                   /locus_tag="Desmu_0017"
FT   CDS_pept        complement(14740..15660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0017"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: dka:DKAM_1392 ABC-type
FT                   transport system, permease component; PFAM: inner-membrane
FT                   translocator; SPTR: ABC-type transport system, permease
FT                   component; PFAM: Branched-chain amino acid transport system
FT                   / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64336"
FT                   /db_xref="GOA:E8RA58"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA58"
FT                   /protein_id="ADV64336.1"
FT                   /translation="MIDFITALVENTLFSATVILFGALGAIVNEKSGVVNIGVEGVFIV
FT                   SAFSTVYFTLATGSLLAGAVAALLISGLIGLLHGLLAAYLRSDQVIAGVGLNMVAYGLT
FT                   IVLMAITWGDYSQTPQIGKIQSLQFNIAGKPFIIPVFSILAFIIGVAEWFILEKTRYGL
FT                   ILKACGDEPRAAEAMGVNVFRVRVLATVIGSILMGLGGVYLSAEWFGNYTRATTAGRGF
FT                   IALANEAFSNWNPAMAVAGALLFGFFEALSISVPIELQSLLGRQFTAETYLFKMMPYLA
FT                   TILVITLVMKKIQMPRALGKPYIKE"
FT   sig_peptide     complement(15586..15660)
FT                   /locus_tag="Desmu_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(15657..16691)
FT                   /locus_tag="Desmu_0018"
FT   CDS_pept        complement(15657..16691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0018"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   dka:DKAM_1393 putative ABC-type transport system, permease
FT                   component; PFAM: inner-membrane translocator; SPTR:
FT                   Putative ABC-type transport system, permease component;
FT                   PFAM: Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64337"
FT                   /db_xref="GOA:E8RA59"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA59"
FT                   /protein_id="ADV64337.1"
FT                   /translation="MHREILLAKITRVIAEEALSLLIGFAAAAAVLLVSGYDPLRVFSI
FT                   MFSEGFRNWRILMEQSTPVIATGLAFSIPMLAGLFNIGGESQLYIGAFTGLVATYTVYN
FT                   AVGQPLLASFAGILLGALAGGLWGLIVGYLRTYRSVNEVVVAIMMNWATYYLVLYLIVS
FT                   RFTDPVYSHMSVFVPQPARLPGVAGFTIISIVAVLVYLALKYSGLGYSIRAVGLNPKAS
FT                   LYAGFNIGRTLLSTMALAGGIAGLGGALFVVSTIYSIDTTMSSIHGLGFLGIGIGLLGR
FT                   NNPIGIVLAGLFISGLQFGGQWVELRTGAPPYLTDVVIGVVVMALSATYVYELIASRMR
FT                   RGGE"
FT   sig_peptide     complement(16605..16691)
FT                   /locus_tag="Desmu_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(16684..18186)
FT                   /locus_tag="Desmu_0019"
FT   CDS_pept        complement(16684..18186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0019"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro IPR017871: IPR003439:
FT                   IPR003593; KEGG: dka:DKAM_1394 putative ABC sugar transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: Putative ABC sugar transport
FT                   system, ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64338"
FT                   /db_xref="GOA:E8RA60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA60"
FT                   /protein_id="ADV64338.1"
FT                   /translation="MKAVEMLGIRKIYPDGVVALRGVDFEVEEGEIHGLLGENGAGKTT
FT                   LMRILYGEIHATDGEIKVFGRRVRFRSPRDAIRHGIAMIYQHFSLVPTMSVLDNLYLSM
FT                   SAVNPGVSRDDTEERAEKLIAETGLRIPLGKTVEELPVGVQQRVEILKALIRDARILIL
FT                   DEPTSVLTPLEVEELFTSLRRLRDKGITIILITHKLREAKAITDRVTVLRRGSKVGTVK
FT                   TSEASEQQLARMMVARDVELVIEKPPSRGPGREVLRIEDIWVKGGEGVDALRGVSLVVR
FT                   EGEILGIAGVQGNGQTELCETIAGLRKPYKGRILLDSRDVTWLDTKERYRLGIAYIPES
FT                   RKIGLIHDMSVLENSILTSIDEYTGRLGIVNWKKAKEKAVEVIKEYGVQPPNPDTPVKF
FT                   LSGGNQQKLMVGREIARKPRILVVAEPTQGVDVASTEFIRKRLLELRNQGIGILLVSTD
FT                   LDEIFQLSDRVAVMYEGRIMGEGRVEEFTPEKIGLLMGGVNA"
FT   gene            complement(18269..19507)
FT                   /locus_tag="Desmu_0020"
FT   CDS_pept        complement(18269..19507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0020"
FT                   /product="nucleoside-binding protein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR003760; KEGG: dka:DKAM_1395 membrane lipoprotein family
FT                   protein; PFAM: basic membrane lipoprotein; SPTR: Membrane
FT                   lipoprotein family protein; PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64339"
FT                   /db_xref="GOA:E8RA61"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8RA61"
FT                   /protein_id="ADV64339.1"
FT                   /translation="MKSLATKTLVAILVVVILVAAVGVYYYVSTSQPAKTTTTTSKPVK
FT                   VAILFDVGGRGDLSFNDMAWLGAEKAKHDFGVTVEYTTPQSQGKMKELLETLSSSGEYD
FT                   LIVLVGFLWTSPLNETADKYPNQKYALIDASTFINRPNEVDILFSEQEAGALVGVLAAD
FT                   MASKIGCNKVGAVAGMSIPPLWRFHVGYLFGVKYYEMKTNKTIGFLWDYTGTFGDTQKG
FT                   YQYATSMLQSGACVLYGLAGLTHVGMFDAVRDWNKQGKGTALAIGQDASQEWYMPRYMP
FT                   FSGAKRVDVAVYKAIEMVVKNQWSGGIHVLSLKDGGVGIWDLDGVKYFAEIAYNQSKLE
FT                   AGLTPDDVVRIVNESRRTYITETGWSIMQELQQLIISGQIAFKSPSTEDEYNQIVNALK
FT                   NGDLNAALSKGKV"
FT   sig_peptide     complement(19445..19507)
FT                   /locus_tag="Desmu_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            19593..20594
FT                   /locus_tag="Desmu_0021"
FT   CDS_pept        19593..20594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0021"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase; InterPro IPR002328: IPR013154:
FT                   IPR013149; KEGG: dka:DKAM_1396 alcohol dehydrogenase GroES
FT                   domain protein; PFAM: Alcohol dehydrogenase GroES domain
FT                   protein; Alcohol dehydrogenase zinc-binding domain protein;
FT                   SPTR: Alcohol dehydrogenase GroES domain protein; PFAM:
FT                   Alcohol dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase; TIGRFAM: 2-desacetyl-2-hydroxyethyl
FT                   bacteriochlorophyllide A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64340"
FT                   /db_xref="GOA:E8RAD0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD0"
FT                   /protein_id="ADV64340.1"
FT                   /translation="MKALLLEEPKHIRLTEVEQPSPGPGWLLIRVERAGICGTDKAMYT
FT                   GTYRLLKKPLIPGHEVSGIVVDVGAGVSRDLVGRRVTTEINVYCGKCWYCRNGMHTHCP
FT                   YRETIGITRDGGMAEYMVTRADLIHVVDDLSPLQAAFVEPLAAVVEMVEMEPVRPLSRV
FT                   AVIGVGAIGLLAVQVLRLFNPELIVAVSRPGSPKARLAGELGADLVVDYPELTEILRRE
FT                   TPEGQGFDYVVEATGSSKGLEIAVDIARPRGVVALKSTHGSPVSFDQTKAVIKELRLTT
FT                   SRCGPFDKAISLLRKRLVNVDKLVTSEYGLEKGAEAFEKSLERDQVKVHIVI"
FT   gene            20656..21108
FT                   /locus_tag="Desmu_0022"
FT   CDS_pept        20656..21108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0022"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="COGs: COG0698 Ribose 5-phosphate isomerase RpiB;
FT                   InterPro IPR003500; KEGG: dka:DKAM_1397 sugar-phosphate
FT                   isomerase, RpiB/LacA/LacB family; PFAM: Ribose/galactose
FT                   isomerase; SPTR: Sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; PFAM: Ribose/Galactose Isomerase; TIGRFAM:
FT                   sugar-phosphate isomerases, RpiB/LacA/LacB family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64341"
FT                   /db_xref="GOA:E8RAD1"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD1"
FT                   /protein_id="ADV64341.1"
FT                   /translation="MRVAVGSDDTYSVAGFIAEYLRRKGFEVKLVGALATGKPYPWPDV
FT                   GFEVGSMVARGEVDYGVVICYTGTGVSIAANKVKGVRAALVTDARNAEGARKWNDANVL
FT                   ALSARLTSEELAKEIIDAFFAVREVDPSEAENIRKLKAVDTLGDTR"
FT   gene            complement(21110..22948)
FT                   /locus_tag="Desmu_0023"
FT   CDS_pept        complement(21110..22948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0023"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterProIPR018247: IPR017932: IPR005855:
FT                   IPR000583: IPR 001347; KEGG: dka:DKAM_1398
FT                   glucosamine--fructose-6-phosphate aminotransferase; PFAM:
FT                   glutamine amidotransferase class-II; sugar isomerase (SIS);
FT                   SPTR: D-fructose-6-phosphate amidotransferase; TIGRFAM:
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: SIS domain; Glutamine amidotransferases
FT                   class-II; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64342"
FT                   /db_xref="GOA:E8RAD2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD2"
FT                   /protein_id="ADV64342.1"
FT                   /translation="MCGIIGLCLRDKKALRLGEAIYRGLLRLEYRGYDSAGVAVVSDGK
FT                   LVVLKGKGKLRDLEEKYSFTKLEGVTGIGHTRWATHGAPSDVNAHPHTDCGNVFAVVHN
FT                   GVLENYLELKKALSARGHVFRSETDTEVVAHLIEEYYRETGDVYQAFRRAVAALKGAYA
FT                   LLMVTPLEPDKIFFARKDSPLVIGVGPGYNLVASDIPALLEHTRRIIVVRDGWVGYITP
FT                   SSIHVEDASSGRLVNAADYVRIVEWDISDAEKEGYPHFMLKEIHEQPRALRSTLHGLMS
FT                   DAMMGEAAEMLADADTVFVTGAGTSYHASEYFALISMRLAERPVIAFIASEYGSYVNAA
FT                   GPRDVLVAVSQSGETMDTLKALRAFKKRGSRVISLTNAVDSAIARESDVAVYTRAGPEI
FT                   GVAATKTFLTQTLALTWLAVETATRIGSLRGGEEMELLKELESTPKHVEESISTTSELV
FT                   KKLAERIAGSKSMYYLSRGVGLPVAREGALKIKEIAYVHAEAYPAGESKHGPIALVEPS
FT                   FPVVFTIPNDAELQRMLLGNIEEMRARGGVIVGVLPRGSELRERVDLAIEVPRAHWIAT
FT                   ALTHTPPLQLLAYHVASLKGLDPDKPRNLAKTVTVE"
FT   gene            23017..23691
FT                   /locus_tag="Desmu_0024"
FT   CDS_pept        23017..23691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0024"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="COGs: COG0528 Uridylate kinase; InterPro IPR011818:
FT                   IPR001048; KEGG: dka:DKAM_1399 uridylate kinase, putative;
FT                   PFAM: aspartate/glutamate/uridylate kinase; PRIAM: UMP
FT                   kinase; SPTR: Uridylate kinase, putative; TIGRFAM:
FT                   uridylate kinase; PFAM: Amino acid kinase family; TIGRFAM:
FT                   uridylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64343"
FT                   /db_xref="GOA:E8RAD3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD3"
FT                   /protein_id="ADV64343.1"
FT                   /translation="METLVLKITGKVFDEGASLVARYIELLRMLLDEYRVVVVAGGGNM
FT                   ARKYISDARALGVSSNYWLDTIGIWASRLNSLLLASSLQPYAYPKPAASLEEVLDALSS
FT                   HRVVAMGGLIPGQSTASTAVEVAEAVGVGKLYYFSAVGFVYDKDPLRHPDAKPLREVDA
FT                   TRLKAMLEQKQLPGEYALIDEKALDLAVRSNIVIQLISHREPEKLMEAMRGGNPGSVIY
FT                   PR"
FT   gene            complement(23732..24445)
FT                   /locus_tag="Desmu_0025"
FT   CDS_pept        complement(23732..24445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0025"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro IPR002347: IPR002198; KEGG:
FT                   dka:DKAM_1401 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   Short-chain dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64344"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD4"
FT                   /protein_id="ADV64344.1"
FT                   /translation="MLEEGARVVLNGRTRESVEKALSELRGKYEGRVYGVAADLTRRED
FT                   VHRLVEESARYLDGLDSVVYITGPPRPGRFLEIREDEWEENTRLLILNAIWLVNASIPY
FT                   LRRSRNPSIVFSTSIAVKEPLGNLALSNVLRLGIHGLVRTLARELGREGIRVNAVMPGY
FT                   IETDRVRRLIEEKAGREGKPYSEAYRDYVSEIPLGRLGSPKEYGRVVAFLVSEYASYLN
FT                   GASIPVDGGLLRSVF"
FT   gene            24576..25820
FT                   /locus_tag="Desmu_0026"
FT   CDS_pept        24576..25820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0026"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095: IPR001959; KEGG:
FT                   pcl:Pcal_0427 IS605 family transposase OrfB; PFAM:
FT                   transposase IS605 OrfB; transposase IS891/IS1136/IS1341
FT                   family; SPTR: Transposase, IS605 OrfB family; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: Putative transposase
FT                   DNA-binding domain; Probable transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64345"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD5"
FT                   /protein_id="ADV64345.1"
FT                   /translation="MGGEGFLTLCAVFRVSPEPVGEPLLLSLLRRYRDALNYSIKRIHG
FT                   YMEENGLKKTPGDGAVHGLLYEELKSRFGLPSRIAIDCYREAKSILKSWLGNGGNGRLP
FT                   RARRPRMWLTERYGYRVKDGYVEIIGGLRLKIIGWDRRYDQYPSRQAVLTYRNGKFLLR
FT                   VAKMVPKPQPINPVDVLAVDVNEKYIVAGNHRVEHRFETAVEKAVRYRELAERLQRKYS
FT                   NGSYRAWLRRRGIRDRVRRFHEKARSIIEDWARKTSHEIVVVARQNNYAIAREDLTYLV
FT                   ESLRKLPRQHRTRLVLLGYRRLGYWLDWQCEKHGVPCIAVNPKDTSSTCPLCGSRLVES
FT                   GYRRLKCPSCGFEADRDTVAVLNIRRKALAQMGGSLTTPTAPQMTDVAPNRCGEPVNRP
FT                   KGNPLLGRGGGQQYA"
FT   sig_peptide     24576..24626
FT                   /locus_tag="Desmu_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(25983..28757)
FT                   /locus_tag="Desmu_0027"
FT   CDS_pept        complement(25983..28757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0027"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="InterPro IPR004300; KEGG: tpe:Tpen_1269 glycoside
FT                   hydrolase family protein; PFAM: glycoside hydrolase family
FT                   57; SPTR: Glycoside hydrolase, family 57; PFAM: Glycosyl
FT                   hydrolase family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64346"
FT                   /db_xref="GOA:E8RAD6"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD6"
FT                   /protein_id="ADV64346.1"
FT                   /translation="MGVSRRVIAVLMLILIALPFTPQLRIAASQEPVVVDGVGFDWPYA
FT                   SCHALDPSSDLLDASSYYYDSRDLAAWYYLVGSQYVFMRLDFMDLAYGAEAASGGSVGD
FT                   ALNIYVLIGWSNAPGYQEWVPDYVKYQGYGIHLPDYNWVLAIAIYDSAHYTVYDYKWSP
FT                   ILSNTGIQVAFNSRWDLLEIGVPASILSNYGWTPTTRVWAKVATVLVVNGQATIADVMP
FT                   NTISIGNGRAEWSGALFSDSSCGTAKVIMVHHGNQHLTDNRALNPPSSVNSYGYILYVH
FT                   EYLSNKTGRRIPVSIHMSGTLIASFLWWDPGFISYVKGLTARGLVAILGGVWAEHITAY
FT                   FYDNFNDPSANFTKWYVRQVFGYNPVTAWVPERTWDDERTGIAYTLSKYYSAVILDANT
FT                   HHDEWSPSTNPYKPHKYDTSRTAGRTLYVLFIDWDTQQKLLSNTDGGLHMDLRRKYIWA
FT                   ATNSDQQMVFIYADDWEKAAGIAGWYTGNPYLYNNSLTWIAMHPWIQVVTTDDVVNWLN
FT                   SGAWSPVTGYYCGYDTYQYLKTWVQNYPYDYRRAYDGWYWGTSSEKSFAWYGSGQTSPK
FT                   YVLPDTVIPFGDVFGYTVFNGSANNTVIYRLLSPGGLFDKTPRNELWWLALATANAMLY
FT                   ETAWHDESDWDGDGLQDCPGWGLTVWNHLRLVNVLLNAAKWLDDVRAGRVTKSSFILDD
FT                   LDWDGRSEAVIYNQYLFIFIDDKGGAAPYIFLYNKTRNTVFMGVGAPPVYWGTSRDMWF
FT                   GDAHVGFFADDYFTGTGKNYYNASYTIYSAYYDTTYRRVVVTLRAPDLDADGKPDFYKY
FT                   YVLYDSSNTLYVDYLGSGKNGTLYAAIGFSVDVFNNLIYGNSLSQRNSPSGTSIFGYRN
FT                   TRTGAYVYVAPIQGITWTGSQDLVKYTLQYRAKVAVSISSTTWSYAKAYFGYS"
FT   sig_peptide     complement(28674..28757)
FT                   /locus_tag="Desmu_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(28880..29590)
FT                   /locus_tag="Desmu_0028"
FT   CDS_pept        complement(28880..29590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0028"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0565 rRNA methylase; InterPro IPR004384:
FT                   IPR001537; KEGG: dka:DKAM_1403 SpoU rRNA methylase; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); SPTR: SpoU rRNA
FT                   methylase; manually curated; PFAM: SpoU rRNA Methylase
FT                   family; TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64347"
FT                   /db_xref="GOA:E8RAD7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD7"
FT                   /protein_id="ADV64347.1"
FT                   /translation="MIRVVLVGIEGAVNLGVIARTCVNFGVDELYIVKPVASLDEALNY
FT                   AAKGRGFLENAVVTDSLDEAIKGVDMIVATSDEGYSESDMLRQAVDLSDFAERIFPRTR
FT                   SVAILFGRESTGLTREEIGRADILVTIPANPAYPVLNVSQAVAVVLWELWKHRGMEAVN
FT                   VPRKASRDLLGELLSLAVDVSRSVMSTEEKVARSRILWKRMLSKAMLTEKEARVLKYWL
FT                   QRVRRQLRQDCLHE"
FT   gene            complement(29508..30161)
FT                   /locus_tag="Desmu_0029"
FT   CDS_pept        complement(29508..30161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0029"
FT                   /product="methyltransferase small"
FT                   /note="COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; InterPro IPR002052: IPR007848; KEGG: dka:DKAM_1404
FT                   predicted rRNA or tRNA methylase; PFAM: methyltransferase
FT                   small; SPTR: Predicted rRNA or tRNA methylase; PFAM:
FT                   Methyltransferase small domain; TIGRFAM: HemK-related
FT                   putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64348"
FT                   /db_xref="GOA:E8RAD8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD8"
FT                   /protein_id="ADV64348.1"
FT                   /translation="MKLVFVGDVYRPSDDTWLALKLLDSLKPKAGLCVDLGCGSGILGL
FT                   YGLIKGYCERTVFVDIDEDALATTLRNIPLNNAQARSIVVSSDNAVLHGAADLVLANPP
FT                   YLPAAEGKVLDAATEGGVHGYEAVLHFINVAHEVLRPGGLLILVYSSLSNQLVVEEHLS
FT                   RKGFTMVAFTSKNMFYETLYVAGVVKARDTGSASGDRGGSEPGSHSEDMRELRG"
FT   gene            complement(30167..31003)
FT                   /locus_tag="Desmu_0030"
FT   CDS_pept        complement(30167..31003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0030"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro IPR020598: IPR001737; KEGG:
FT                   dka:DKAM_1405 probable dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like; SPTR:
FT                   Probable dimethyladenosine transferase; manually curated;
FT                   PFAM: Ribosomal RNA adenine dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64349"
FT                   /db_xref="GOA:E8RAD9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAD9"
FT                   /protein_id="ADV64349.1"
FT                   /translation="MGRPIEPDSMSRRTLFSWTLRVLQSHGLKPRRRLSQNFIVDPALL
FT                   KGFTRNVEYLDTFEIGCGIGTLTMSLSRFVPRLICVEIDWRLLEAAVENIDAANVVLVN
FT                   ADATVYTPPSKQVVGNIPYHITSEILTGVARLNTVTRAVFTVQRDVAERITAAPGDRRY
FT                   GRITILLNALFEIKVAGTYGSSSFYPEPGVEHSIIVMVRRAPFNRDVEALEALTRAVFT
FT                   QRRRIALRVLERVLGVREDSPVHSYASRLLGGKRVYEVGWEVYLELARALREAGLL"
FT   gene            complement(30987..31622)
FT                   /locus_tag="Desmu_0031"
FT   CDS_pept        complement(30987..31622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0031"
FT                   /product="protein of unknown function DUF655"
FT                   /note="COGs: COG1491 RNA-binding protein; InterPro
FT                   IPR007003; KEGG: dka:DKAM_1406 DNA-binding protein; PFAM:
FT                   protein of unknown function DUF655; SPTR: DNA-binding
FT                   protein; PFAM: Protein of unknown function, DUF655"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64350"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE0"
FT                   /protein_id="ADV64350.1"
FT                   /translation="MGFHDRGPRHRRQAEKLEPALYVLDYLELGNPSDPHYEHRSQPFL
FT                   QGVGTRYFSLLEATPLPAMKIEILEKVELGYPSKVKRIMHVSYGELTSVAKTNLPEAVK
FT                   LIVLENEGVFVEFFNIVEPVNIRLHALELLPDIGKKTMNQILDERSKKRFESFEDIRNR
FT                   TRVDPVKAIVNRVVKELAGGEKYYLFVRPREPGAMYLGYLEKLYGETY"
FT   gene            complement(31649..32023)
FT                   /locus_tag="Desmu_0032"
FT   CDS_pept        complement(31649..32023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0032"
FT                   /product="RNA polymerase Rpb4"
FT                   /note="InterPro IPR006590: IPR005574; KEGG: dka:DKAM_1407
FT                   RNA polymerase Rpb4; PFAM: RNA polymerase Rpb4; SMART: RNA
FT                   polymerase II, Rpb4, core; SPTR: RNA polymerase Rpb4; PFAM:
FT                   RNA polymerase Rpb4"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64351"
FT                   /db_xref="GOA:E8RAE1"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE1"
FT                   /protein_id="ADV64351.1"
FT                   /translation="MSSTTVLKALEEKQLSNSEAYAILRSVVEKTREETGTVSLLLSRV
FT                   LEYLEKNHRIPPEKAGELRAFLESKGLKEETIVILMNICPSTLDELRYLMELEEKLPEQ
FT                   GVLEEILSTLSKYCVSESPG"
FT   gene            complement(32080..32397)
FT                   /locus_tag="Desmu_0033"
FT   CDS_pept        complement(32080..32397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0033"
FT                   /product="LSU ribosomal protein L21E"
FT                   /note="COGs: COG2139 Ribosomal protein L21E; InterPro
FT                   IPR018259: IPR001147; KEGG: dka:DKAM_1408 50S ribosomal
FT                   protein L21e; PFAM: Ribosomal protein L21e; SPTR: 50S
FT                   ribosomal protein L21e; PFAM: Ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64352"
FT                   /db_xref="GOA:E8RAE2"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE2"
FT                   /protein_id="ADV64352.1"
FT                   /translation="MVKAPKGYRHRTRKLLKKNIREKGSVPSLSLIMREYKEGEKVHIV
FT                   INPSVHSGMPHRRYHGRTGIVVGKRGKAYVVKVMMGSKEKTLFVRPEHIRPAPLPQAQQ
FT                   A"
FT   gene            complement(32476..33810)
FT                   /locus_tag="Desmu_0034"
FT   CDS_pept        complement(32476..33810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0034"
FT                   /product="THUMP domain-containing protein"
FT                   /note="COGs: COG1258 pseudouridylate synthase; InterPro
FT                   IPR004114: IPR005912; KEGG: dka:DKAM_1409 putative
FT                   pseudouridylate synthase; PFAM: THUMP domain-containing
FT                   protein; SPTR: Predicted pseudouridylate synthase; PFAM:
FT                   THUMP domain; TIGRFAM: conserved hypothetical protein
FT                   TIGR01213"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64353"
FT                   /db_xref="GOA:E8RAE3"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE3"
FT                   /protein_id="ADV64353.1"
FT                   /translation="MDTGEKDSWSMDHILSTAEEVLSEHPLCDRCLGRLFARRGLDLSN
FT                   EERGRAVKTLLAMKLHADFTDGKTSIEHIQRIAVNSGEPVARLYRRLTGESVEPRVCHI
FT                   CLGRLSDEYLDKVAREAASLLAGLQASSFLIGVKLDAEVARRELEVSLITKLASSESVK
FT                   NELKREVGKKVSQITGLQPDFDKPDVVVIINVDRDFNYTLSTQVNPVLLKAVYLKKGRR
FT                   ISHVPWFTSNGARKYPESLQDFVRDSIASLFEAVDVKIHAAGREDVDARMLGTGRPVII
FT                   EILEPRFRSVDIGLLNQILDDQFIKVSVTGPASRRDIEAIKEGSRRRKKIYRVSVLTGK
FT                   PVTMKDLEELSGFFRNRVVKQRTPLRILGRKKDRERIRRVYSVEAVAVTPRVFEALIHC
FT                   DGGLYVKELVHCDNGRTTPCFSEVLGSTAYPLELDVIHVEDNGDK"
FT   gene            complement(33827..35179)
FT                   /locus_tag="Desmu_0035"
FT   CDS_pept        complement(33827..35179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0035"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterPro IPR003593: IPR013822: IPR000897: IPR004125; KEGG:
FT                   dka:DKAM_1410 GTP-binding signal recognition particle
FT                   SRP54, G-domain protein; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; Signal peptide
FT                   binding (SRP54) M- domain protein; SMART: AAA ATPase; SPTR:
FT                   GTP-binding signal recognition particle SRP54, G-domain
FT                   protein; PFAM: SRP54-type protein, GTPase domain;
FT                   SRP54-type protein, helical bundle domain; Signal peptide
FT                   binding domain; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64354"
FT                   /db_xref="GOA:E8RAE4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE4"
FT                   /protein_id="ADV64354.1"
FT                   /translation="MVFDNIRSALARFLKGGDYEKAVDEFIRELQKELVRADVNLKLAM
FT                   ELTSRIKERALKAEPPPGISRKEWFITVVYEELTRLLGGERKPSVKPAKKPWVIMLVGL
FT                   QGSGKTTTTAKLAYFYKLEGLRVGLVAADTFRPAAYMQLKQLGEQVGVPVYGEPGNSDA
FT                   VAIAVKGVEFFRERKMDVIIIDTAGRHHREEDLLEEMKKMSEHVKPDEVMLVIDAAIGQ
FT                   QAFNIARRFHEATPIGSIIVTKLDGTAKGGGALSAVAATGASIKFIGTGEKIDELEVFN
FT                   PPRFVSRILGLGDIESLIEKVRRVQLDFTEEDARRLIEGKVNMRLVYKQLVSLRKMGPL
FT                   GKIMQMIPGLGVKIPFEVDSKQLEEKMSKWLAIINSMTYEELDNPDIIDRSRMKRIARG
FT                   AGVEVEDVKELLKQYELVKKLSKQLRRKDVLKRLGIRPEDLRLGDGEAGGA"
FT   gene            35291..35392
FT                   /locus_tag="Desmu_R0003"
FT   tRNA            join(35291..35331,35347..35392)
FT                   /locus_tag="Desmu_R0003"
FT                   /product="tRNA-Leu"
FT   gene            35507..36031
FT                   /locus_tag="Desmu_0036"
FT   CDS_pept        35507..36031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0036"
FT                   /product="LSU ribosomal protein L10AE"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR018255: IPR001197: IPR016180; KEGG: dka:DKAM_1411 50S
FT                   ribosomal protein L10e; PFAM: Ribosomal protein L10e/L16;
FT                   SPTR: 50S ribosomal protein L10e; PFAM: Ribosomal protein
FT                   L16p/L10e; TIGRFAM: ribosomal protein L10.e"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64355"
FT                   /db_xref="GOA:E8RAE5"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE5"
FT                   /protein_id="ADV64355.1"
FT                   /translation="MPLRPARCYTHFSGPPYTRKEYIPGVPQPKITKFEMGDPKLDYDY
FT                   EVALVVEEAGQIRHNALEAARVMALKKLSVEAGENNFYLKVKVYPHHVIRENKMMAFAG
FT                   ADRLQDGMRLSFGKPIGTAARVYPGQEIIVIRVKAQHGKTAKEALRIAASKLPLPSRIV
FT                   VKPLKPEVPPL"
FT   gene            36063..37064
FT                   /locus_tag="Desmu_0037"
FT   CDS_pept        36063..37064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0037"
FT                   /product="diphthamide biosynthesis protein"
FT                   /note="COGs: COG1736 Diphthamide synthase subunit DPH2;
FT                   InterPro IPR002728; KEGG: dka:DKAM_1412 diphthamide
FT                   biosynthesis protein; PFAM: Diphthamide synthesis DPH2
FT                   protein; SPTR: Diphthamide biosynthesis protein; TIGRFAM:
FT                   diphthamide biosynthesis protein; PFAM: Putative
FT                   diphthamide synthesis protein; TIGRFAM: diphthamide
FT                   biosynthesis protein 2-related domain; arCOG04112 universal
FT                   archaeal diphthamide biosynthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64356"
FT                   /db_xref="GOA:E8RAE6"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE6"
FT                   /protein_id="ADV64356.1"
FT                   /translation="MSDICSLYDIDLDALTKQVSKSSGRVLLHAPDGLKPLYNCIAPVL
FT                   EQAGVEAAFSASPGYGACDIPFEEAEAIGADLLVHIGHLEYFQYGFKPAVKVLYIPVYR
FT                   RPYIEQGLLRELVETLREAGVVKVSVSSTLVEEKIRRVVANHLASNGFKPIEVGFPVLG
FT                   CLYTHVTSLDTSVDAHLMVAGGVFHPLGLALVSKKPVVVLDPYRGRVWRAGDEASRVLK
FT                   QRLMRVFEARNSGNRVGVIVGSRPGQYRPWLVEKIEEEAAGRGYRVYRIISGYLTLERL
FT                   IAVDNALGLDVYVVTSCPRLPIDDLSEFYKPVLTPGEFMMLLKDAGNYIYPW"
FT   gene            37067..37711
FT                   /locus_tag="Desmu_0038"
FT   CDS_pept        37067..37711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0038"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG2263 RNA methylase; InterPro IPR002052;
FT                   KEGG: dka:DKAM_1413 predicted DNA methylase; SPTR:
FT                   Predicted DNA methylase; PFAM: Putative RNA methylase
FT                   family UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64357"
FT                   /db_xref="GOA:E8RAE7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE7"
FT                   /protein_id="ADV64357.1"
FT                   /translation="MRVKSKKELELALSRIEPYRGSKKRLEQYQTPVSLVAHMAWTAYM
FT                   RGDVEGLTIADLGCGDGRISIAALLLGASRAVCIDVDEDILLHGAWKIYPLFPEAAGRL
FT                   IHVNADVARLGLVRVDTVLMNPPFGVVEGNRGVDILFLRVAMGIARVVYSIHKYSEGFF
FT                   NLLREVSESKGFELASYEIRDFEIPMMFETHRRRIYRFKTVFVVLVESGGS"
FT   gene            37708..38259
FT                   /locus_tag="Desmu_0039"
FT   CDS_pept        37708..38259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0039"
FT                   /product="RNA-binding protein (consists of S1 domain and a
FT                   Zn-ribbon domain)"
FT                   /note="COGs: COG1096 RNA-binding protein (consists of S1
FT                   domain and a Zn-ribbon domain); InterPro IPR003029; KEGG:
FT                   dka:DKAM_1414 predicted RNA-binding protein (consists of S1
FT                   domain and a Zn-ribbon domain); SPTR: Predicted RNA-binding
FT                   protein (Consists of S1 domain and a Zn-ribbon domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64358"
FT                   /db_xref="GOA:E8RAE8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR030850"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE8"
FT                   /protein_id="ADV64358.1"
FT                   /translation="MNAQDVVVPGEPLAVEEEAIPVQGAYLDSRGFIRSLVFGLKVFDK
FT                   YRKQVYVKQVKTTGFVKPGSVVEAYVEAVSDDIAFLRIYSVEGQGMSASGVLHVSQASN
FT                   GFVQSLLDVVRPGDYVKAKVLNNSIPYQLTLKEPDLGVVEAYCSVCGGLLYRSGDVLVC
FT                   SLCGNREKRKTSLSYIHVSR"
FT   gene            38264..38872
FT                   /locus_tag="Desmu_0040"
FT   CDS_pept        38264..38872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0040"
FT                   /product="Protein of unknown function DUF2067"
FT                   /note="COGs: COG3286 conserved hypothetical protein;
FT                   InterPro IPR019202; KEGG: dka:DKAM_1415 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2067; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   protein conserved in archaea (DUF2067)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64359"
FT                   /db_xref="InterPro:IPR019202"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAE9"
FT                   /protein_id="ADV64359.1"
FT                   /translation="MPLVKRRFRVPCRGEECLKLYEYVKDRIPSLEHVEFKVSGSGLVV
FT                   EAYGYETDVKRLWSELRSYVRALRHVSTRGLNSFRIDYIVKLTGKTFPPDVLVEVLSRQ
FT                   GHRVEAGEGVIYTSAGVDEVLGLVERISELNSVAKNIAKGTAARYFIVSASLLTGLPPQ
FT                   EIVERAVGLQLMEPDESGAYLLKHEWRRALDLLVRYLKQ"
FT   gene            38904..39185
FT                   /locus_tag="Desmu_0041"
FT   CDS_pept        38904..39185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0041"
FT                   /product="RNA polymerase dimerization"
FT                   /note="COGs: COG1761 DNA-directed RNA polymerase subunit L;
FT                   InterPro IPR008193: IPR011261; KEGG: dka:DKAM_1416
FT                   DNA-directed RNA polymerase, subunit L; PFAM: RNA
FT                   polymerase dimerisation; SPTR: DNA-directed RNA polymerase,
FT                   subunit L"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64360"
FT                   /db_xref="GOA:E8RAF0"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF0"
FT                   /protein_id="ADV64360.1"
FT                   /translation="MEVRVVSRSERELVVEVHGEDHTLGNLLAKEAIRHPGVEYSMYRV
FT                   PHPLKNMFEFTIIVKPGYSVDSVLKEIVEGLKKTLSEFRGLVEEKIVE"
FT   gene            39276..39605
FT                   /locus_tag="Desmu_0042"
FT   CDS_pept        39276..39605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1417 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64361"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF1"
FT                   /protein_id="ADV64361.1"
FT                   /translation="MLRIQYPASMFARDALDAMSTREELAYMLKCVDDDSTGFTLNGLR
FT                   VLDGSEHLVQALRYCGIVHLILRLLESYGMHTGIPPSGENLITFYTVKSPIAGQGWFNS
FT                   VEAVP"
FT   gene            39586..39930
FT                   /locus_tag="Desmu_0043"
FT   CDS_pept        39586..39930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0043"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1594 DNA-directed RNA polymerase subunit
FT                   M/Transcription elongation factor TFIIS; InterPro
FT                   IPR001222: IPR001529: IPR006288; KEGG: tag:Tagg_0041
FT                   DNA-directed RNA polymerase subunit M; PFAM: Transcription
FT                   factor TFIIS; DNA-directed RNA polymerase, M/15 kDa
FT                   subunit; SMART: Transcription factor TFIIS; DNA-directed
FT                   RNA polymerase, M/15 kDa subunit; SPTR: DNA-directed RNA
FT                   polymerase, subunit M; TIGRFAM: transcription factor S;
FT                   manually curated; PFAM: Transcription factor S-II (TFIIS);
FT                   TIGRFAM: transcription factor S, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64362"
FT                   /db_xref="GOA:E8RAF2"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF2"
FT                   /protein_id="ADV64362.1"
FT                   /translation="MSRLCPKCGGLMRPQRIDGKPYLVCTRCGYRLEAEASGVREFKVS
FT                   TRIEHRPDEKTLVLKSENEANLPVTREVTCPKCGWHEAYYWMLQTRAADEPPTRFFKCT
FT                   RCGHTWREYA"
FT   gene            40003..40752
FT                   /locus_tag="Desmu_0044"
FT   CDS_pept        40003..40752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0044"
FT                   /product="proliferating cell nuclear antigen PcnA"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR000730; KEGG: dka:DKAM_1419 DNA
FT                   polymerase sliding clamp subunit B2 (PcnA - like protein);
FT                   PFAM: Proliferating cell nuclear antigen, PCNA; SPTR: DNA
FT                   polymerase sliding clamp; TIGRFAM: proliferating cell
FT                   nuclear antigen PcnA; PFAM: Proliferating cell nuclear
FT                   antigen, N-terminal domain; Proliferating cell nuclear
FT                   antigen, C-terminal domain; TIGRFAM: proliferating cell
FT                   nuclear antigen (pcna)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64363"
FT                   /db_xref="GOA:E8RAF3"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF3"
FT                   /protein_id="ADV64363.1"
FT                   /translation="MRLRFRDAVVWRYAIASISKIIEEAGFKVDPEKGLVLRAMDPSTV
FT                   VLVEFTMPRDAFSIYEVEGERFIGVNMEELAKVLKRARKGDELLLEVSGDGRLSVVFEG
FT                   RGSRRFTLPSIELTHEELPEVSFEVGFKGRMLPKVFRDVISEVEPVSDAVEFSAVKGEG
FT                   KLVVASRSEVAEAEIELSASEGALIEHEITEDSRAKYTVDYLTDISSASQAAELMSVEF
FT                   GNDTPLKLTYELSGGGRLVFYVAPREE"
FT   gene            40730..41857
FT                   /locus_tag="Desmu_0045"
FT   CDS_pept        40730..41857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0045"
FT                   /product="DNA primase small subunit"
FT                   /note="COGs: COG1467 Eukaryotic-type DNA primase catalytic
FT                   (small) subunit; InterPro IPR002755; KEGG: dka:DKAM_1420
FT                   probable DNA primase small subunit; PFAM: DNA primase small
FT                   subunit; SPTR: DNA primase; PFAM: Eukaryotic and archaeal
FT                   DNA primase small subunit; TIGRFAM: DNA primase,
FT                   eukaryotic-type, small subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64364"
FT                   /db_xref="GOA:E8RAF4"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="InterPro:IPR023639"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF4"
FT                   /protein_id="ADV64364.1"
FT                   /translation="MSLHARNRRGFLRRIIWDYYRLKPLEEPSNLHMREVALESLEDGK
FT                   YIRHLSFPYMEKLYEFIQGGKTPLHLYYSSALYSDPSAEDMESKGWQGSELIFDIDADK
FT                   YPGCSQVFKICIGGGVVDGEAGCPGGREPVEYPVVPWDCIRRAWESALRLRDILLRDLG
FT                   FSRIKIYFSGNRGFHVRVLDESALPLTREQRRLLADYVACSNLDTARMFPSYRGKVVFH
FT                   RFEHGLRRRVLESARARGLVREGEIAGLKGLVLDEEHLPMLLEENCIGIDKVVTIDTSR
FT                   LSRFGNSLNMKSGLRVTEMDPGKGLDDAGFTSFSPFKGGIRVKSLIDASRLPVLDKLVD
FT                   LKKGGVFELEAPYAIYLIIHGVVDPVEAGGVVVKP"
FT   gene            41854..42354
FT                   /locus_tag="Desmu_0046"
FT   CDS_pept        41854..42354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1421 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64365"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF5"
FT                   /protein_id="ADV64365.1"
FT                   /translation="MSNTYVNMVREELQASKCTVIQRVKLEEAGELIRRSMFKLPLITR
FT                   EGRRLFVEMLTKMAGDAELLGRLRVAKIALGSHVPEDSYDREVLEIVESLVELEKEALS
FT                   PVSIRYHDKRLVVFEKDCVVNGEKYRRGDLALLTVNELTAAFIHRCVKPLQNPLVVFSK
FT                   SHG"
FT   gene            complement(42374..42772)
FT                   /locus_tag="Desmu_0047"
FT   CDS_pept        complement(42374..42772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1422 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64366"
FT                   /db_xref="GOA:E8RAF6"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF6"
FT                   /protein_id="ADV64366.1"
FT                   /translation="MRKPVREVYRYVLEYDVLPGVLARLALYVSTISWIIICGNWLYVW
FT                   FNYSYMSPSQFNRFTAFSILYTLLIALSIGVAFTLPYFIQSVRPRSFKHIREARLRDIV
FT                   FVGSLILLLIVISAYIILGYYYMENAVT"
FT   gene            complement(42941..43015)
FT                   /locus_tag="Desmu_R0004"
FT   tRNA            complement(42941..43015)
FT                   /locus_tag="Desmu_R0004"
FT                   /product="tRNA-Asp"
FT   gene            complement(43090..43290)
FT                   /locus_tag="Desmu_0048"
FT   CDS_pept        complement(43090..43290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0048"
FT                   /product="RNA-binding protein Nop10p"
FT                   /note="COGs: COG2260 Zn-ribbon RNA-binding protein;
FT                   InterPro IPR007264; KEGG: dka:DKAM_1423 nucleolar
FT                   RNA-binding protein Nop10p; PFAM: RNA-binding protein
FT                   Nop10p; SPTR: Ribosome biogenesis protein Nop10; PFAM:
FT                   Nucleolar RNA-binding protein, Nop10p family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64367"
FT                   /db_xref="GOA:E8RAF7"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF7"
FT                   /protein_id="ADV64367.1"
FT                   /translation="MNWLMRKCVRCGSYTLDKEKCPRCGGELTVPHPARFSPVDKYATY
FT                   RLREKLSSNLLKLDEKPPYVP"
FT   gene            complement(43287..44081)
FT                   /locus_tag="Desmu_0049"
FT   CDS_pept        complement(43287..44081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0049"
FT                   /product="translation initiation factor 2 subunit alpha
FT                   (aeIF-2a)"
FT                   /note="COGs: COG1093 Translation initiation factor 2 alpha
FT                   subunit (eIF-2alpha); InterPro IPR003029: IPR011488; KEGG:
FT                   dka:DKAM_1424 translation initiation factor IF-2 subunit
FT                   alpha; PFAM: translation initiation factor 2, alpha
FT                   subunit; RNA binding S1 domain protein; SPTR: Translation
FT                   initiation factor IF-2 subunit alpha; PFAM: Eukaryotic
FT                   translation initiation factor 2 alpha subunit; S1 RNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64368"
FT                   /db_xref="GOA:E8RAF8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF8"
FT                   /protein_id="ADV64368.1"
FT                   /translation="MIPRRELPDIGEYVVATVREIYDYGAYVTLDEYGDRKAFLPWSEI
FT                   ATKWVKNIRDVIREGEKIVVKVIRVDRAKKEVDVSLKKVADADRRKKMMWWKRYVKAAK
FT                   IVELVAESIGKSREDAYREVIWRLEDAYGDPLYALEEAVSTGGEALAKAGVPEEWINPL
FT                   LTEVKRHIKIKEVSVRARLTVQSRHPDGVERVRRVLEAVANTLKAKGARFKLYTAGAPR
FT                   YILEIYSQDYKTAETLLEEALKKAEEASKASDIVFKGEREKT"
FT   gene            complement(44104..46095)
FT                   /locus_tag="Desmu_0050"
FT   CDS_pept        complement(44104..46095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0050"
FT                   /product="putative oligosaccharyl transferase STT3 subunit
FT                   (B5) (integral membrane protein 1)"
FT                   /note="KEGG: dka:DKAM_1425 putative oligosaccharyl
FT                   transferase STT3 subunit (B5) (integral membrane protein
FT                   1); SPTR: Putative oligosaccharyl transferase STT3 subunit
FT                   (B5) (Integral membrane protein 1)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64369"
FT                   /db_xref="GOA:E8RAF9"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAF9"
FT                   /protein_id="ADV64369.1"
FT                   /translation="MDKKTLIGVSLLALSMAVNILLITWLDPGTPFDNVSWLSRYLSKT
FT                   AGLPYACSRINVLDDSCSYFLTYEWVASKLIGVLGATGVIAASALTVLLVFYTTLRVLG
FT                   NPALAGVTSLIYASSPAVVFWSTPSNMGHQVLSGILATLILLALYVNEKAGGIRGALLL
FT                   GLSGLLAQVLNPAGWLLVEGALIGLAAEFAVGVRGRLNRVAALLLALSSIPALVAPGLG
FT                   NLFPIIPLSTSLLLLLVDTLMQGRPIPAGTRITLIAVALTASVALPAPFILTHSGGGYT
FT                   AVFIKSYNPPLDYGVLAATGLIGLIVLSRSRLLSEMPGVKTAIISSTVLLLIAAMLDPT
FT                   LVVAEAFLLALLTSLALYVVAEYSWGFRRGAASVLYRAAAIAIVLGVVSGGVLLSVAQT
FT                   RTQPFIYTYDLQGYTGLGTPVRNESAWLNALSALKQAISNSTGSRILVLSYWGYTYWIQ
FT                   RFLADAPGEVYTLAHDLGGDRGRYLVSAIMLSSEETAARIVSNVSSEVGASRRFIVVSY
FT                   LASVRLIGGRSSGAAYLGVAVPVQTQEYYENIYYAAAGDLSRLVLYAATINTSYLSYVN
FT                   IYNARSGYELPLAWSKDGYNSLLAQLAVDSLQRLGYNVYNQLYSYSQLSSSVRLFKPVA
FT                   VESAPVLKVSGLYSEYQIIHVVAVYELP"
FT   gene            46198..47040
FT                   /locus_tag="Desmu_0051"
FT   CDS_pept        46198..47040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0051"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: tag:Tagg_0049 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: Putative uncharacterized protein;
FT                   PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64370"
FT                   /db_xref="GOA:E8RAG0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG0"
FT                   /protein_id="ADV64370.1"
FT                   /translation="MEAVFLAAMAGVLWSLNPPVIKRFAGGMDPVAFNGARGIYAVLVL
FT                   TLYMLVKGVAPSVRPEGLALIYLSALLGPVLGDIFYIKAIVSIGGGNAITIGYLYIFVA
FT                   QLIGIYVLGEKPDAHLLIGSLVAFTGIYLIYNGGGESIRGRGVAYALAAAVLWGMSAVC
FT                   SKLATQYGDALSLGFTRNVFLVLSIVLVRGLLPARYALSRNGFIAGFITGGLSFGVGMV
FT                   LFIEALATGGVSLAVLPTIIAPALARFTSRIIAGEVVGWRSIAGTLVTVAGIALGSLG"
FT   sig_peptide     46198..46242
FT                   /locus_tag="Desmu_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(47070..47291)
FT                   /locus_tag="Desmu_0052"
FT   CDS_pept        complement(47070..47291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0050 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64371"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG1"
FT                   /protein_id="ADV64371.1"
FT                   /translation="MHHETLFPRHFTGDLSSCRRIKELTLEEASSILPPEAVSRLLSGR
FT                   EVIVVEPGVVKKIAEIEVGDEYIVLKPL"
FT   gene            complement(47317..47775)
FT                   /locus_tag="Desmu_0053"
FT   CDS_pept        complement(47317..47775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0053"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="COGs: COG3260 Ni Fe-hydrogenase III small subunit;
FT                   InterPro IPR006137; KEGG: dka:DKAM_1023 NADH ubiquinone
FT                   oxidoreductase, 20 kDa subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; SPTR: NADH ubiquinone
FT                   oxidoreductase, 20 kDa subunit; PFAM: NADH ubiquinone
FT                   oxidoreductase, 20 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64372"
FT                   /db_xref="GOA:E8RAG2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG2"
FT                   /protein_id="ADV64372.1"
FT                   /translation="MKKSIWVYHLNTGSCNACDIEILDALTPFHDAERFGVKLVGSPRH
FT                   ADVILMTGPVTLETLPKVLNAIEAAPRPRIIIALGSCGVGGGIWHDTYSTIGGIKGLEK
FT                   MLKERGIRVDAIYYVPGCPIRPEALLYAIALIKGLVAKKAKGEVKYAE"
FT   gene            complement(47780..48298)
FT                   /locus_tag="Desmu_0054"
FT   CDS_pept        complement(47780..48298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0054"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="1.6.5.3"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR017900: IPR017896; KEGG: dka:DKAM_1022
FT                   hydrogenase 4 Fe-S subunit; SPTR: Hydrogenase 4 Fe-S
FT                   subunit; PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64373"
FT                   /db_xref="GOA:E8RAG3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG3"
FT                   /protein_id="ADV64373.1"
FT                   /translation="MSKALKPVELVVIAGKAGRATRKYPFEEPLVTPDFRGKVEIDASK
FT                   CIGCGACVNACPPNALQLIEDSEKLVLRYFIGRCIFCWRCIDVCPVKAIKGTREFELAT
FT                   NDVADLYVHVVHSRRKCPSCGTAYGTERIIRYVSEKAQHSEEYLDKCPECRKRNLLKAL
FT                   SKRRTGSLE"
FT   gene            complement(48302..49939)
FT                   /locus_tag="Desmu_0055"
FT   CDS_pept        complement(48302..49939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0055"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="COGs: COG3261 Ni Fe-hydrogenase III large subunit;
FT                   InterPro IPR001268: IPR014029: IPR001501: IPR001135; KEGG:
FT                   dka:DKAM_1021 NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit; PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   NADH dehydrogenase (ubiquinone) 30 kDa subunit;
FT                   nickel-dependent hydrogenase large subunit; SPTR: NADH
FT                   dehydrogenase (Ubiquinone), 30 kDa subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 30 Kd subunit;
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   Nickel-dependent hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64374"
FT                   /db_xref="GOA:E8RAG4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG4"
FT                   /protein_id="ADV64374.1"
FT                   /translation="MMPREKAILNKYMQLAEKLGGRSLVDGDTVHIVVPRESLVKAAST
FT                   LFNEHGLTHRTCVGIDERPVNGFFSLTHVFTDDSSGLYVLLKTYMESGDPVVPSIVNEV
FT                   PAADWCEQEAMDLLGIRFEGRRRERLVLPPGWPEDAYPLRKDFQYDQKPLIHPESEKMG
FT                   LTTGEEGSPIPVGPYHPALHEPEYFELYVDGERIVDVKYRGFHVHRGIEKLGESRMTYQ
FT                   QVNFLAERICGICGFEHSTCYALAVEKAAKLDVPERAQFIRSIVLEVERIHSHLLWLGV
FT                   AFHTLGYDAGFMHMWRIRERIMELAEMLTGSRKTYGINMVGGVRRDINEEKRRKVIEVL
FT                   SELEKEYWKIIDVAVNVPQVKKRLSGTGVLPKEWAVKLGVEGPVARASGVDKDARRDLP
FT                   YAAYKHVSFKVPVYTEGDNMARTLVRIEETKESMSMIIQLLDMLPKGPIMLEEYEIPEG
FT                   RIGVQVVEAPRGGDVHYVLTGRGRPYRWRVRAPTYNNIPALRIMLRDQPLADAPLTIAS
FT                   IDPCFSCTDRVLVVRKGKGVEVLELNGV"
FT   gene            complement(49936..50808)
FT                   /locus_tag="Desmu_0056"
FT   CDS_pept        complement(49936..50808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0056"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="COGs: COG0650 Formate hydrogenlyase subunit 4;
FT                   InterPro IPR018086: IPR001694; KEGG: dka:DKAM_1020
FT                   hydrogenase-4 component C; PFAM: respiratory-chain NADH
FT                   dehydrogenase subunit 1; SPTR: Hydrogenase-4 component C;
FT                   PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64375"
FT                   /db_xref="GOA:E8RAG5"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG5"
FT                   /protein_id="ADV64375.1"
FT                   /translation="MEALAAFTATLLAMLLPVIYDGVERKVKALMQSRIGPPVYQTILD
FT                   LRKLMSKETVEFPSYPLVFYTIVLSIILEAALIAVLNTVSLGVYTAQLVPVAIALIAVA
FT                   QTTSIAIPLLVPNPYSQVGGMREAMLALVNEFSLIAGLTLYYYAAHPATSIPRLLTVTV
FT                   PLIVLLVMTTYVSTGRTPFDIAEAEVELASGVLVELSGGALALYLYSVYLKRYIASMLP
FT                   ALMVLLPLPLNGVVRLMIVHVAAFATWVLYSLPAVMLGRSRVDLAPATLFKIYIALILI
FT                   SITGLLVVT"
FT   sig_peptide     complement(50758..50808)
FT                   /locus_tag="Desmu_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(50814..51095)
FT                   /locus_tag="Desmu_0057"
FT   CDS_pept        complement(50814..51095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64376"
FT                   /db_xref="GOA:E8RAG6"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG6"
FT                   /protein_id="ADV64376.1"
FT                   /translation="MSYTRASIIRWFEEIAEKTIERLKPGRGLSPASIASRLANIGDTV
FT                   FPWISHAVDVLSRRLNVLQLTMIESMILASLWFGAIALLLAIATMLTG"
FT   gene            complement(51092..52612)
FT                   /locus_tag="Desmu_0058"
FT   CDS_pept        complement(51092..52612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0058"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="COGs: COG0651 Formate hydrogenlyase subunit
FT                   3/Multisubunit Na+/H+ antiporter MnhD subunit; InterPro
FT                   IPR003918: IPR001750; KEGG: dka:DKAM_1018
FT                   NADH/ubiquinone/plastoquinone (complex I); PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   NADH/ubiquinone/plastoquinone (Complex I); PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64377"
FT                   /db_xref="GOA:E8RAG7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG7"
FT                   /protein_id="ADV64377.1"
FT                   /translation="MNTLHITAMSLAYLLVLSGSLLSDRASRLSKVLRVTGFTMPLLDA
FT                   LINQQGALGFQEYFVVLASLASIAITLHSEGYYRILTGKVSYQQTLLNTTLIAVLTVFN
FT                   ARILGEFVTGLLVLDVLLMLVIMMDKGAENYKVAIYYIVLSAVPADVAVLSLWALIAQY
FT                   MGLDASLTASPAELAAVKIPLSPLPALLILVGFATKLGLFPIHMWLPIVHPEAPKHGSA
FT                   ILSGLVIKIGLFGLLLTSSLFTYSSELHYVTLAQGAITALYGGFAATIQRDVRRLLAYS
FT                   SLSHAGVMAVTYSLSEIYGSGLLLQLLYFYVIYHGLAKAHAFMNAALMDQLANTFDVYK
FT                   LGYLGQLHPALIVPAFNIFMNFAGIPPSYGFTMKLVLLASLVMLVSSYGVIPLLAGIAI
FT                   AVVAVFSIIYSVKIMGCYVGGYRKVLKPPVEVTREELLSEYYATSVTLVFPLIYIAISL
FT                   SSGYMPLQLLVPLAVVEAITLPVFITVLLSKPLSRIHEPKYWLSGVEQ"
FT   sig_peptide     complement(52535..52612)
FT                   /locus_tag="Desmu_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(52609..54123)
FT                   /locus_tag="Desmu_0059"
FT   CDS_pept        complement(52609..54123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0059"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="COGs: COG0651 Formate hydrogenlyase subunit
FT                   3/Multisubunit Na+/H+ antiporter MnhD subunit; InterPro
FT                   IPR001750; KEGG: dka:DKAM_1017
FT                   NADH/ubiquinone/plastoquinone (complex I); PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   NADH/ubiquinone/plastoquinone (Complex I); PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64378"
FT                   /db_xref="GOA:E8RAG8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG8"
FT                   /protein_id="ADV64378.1"
FT                   /translation="MEPSFSLTICVLSLVFITLLSKLGPAPRFKVISKLSIYGSLGVAL
FT                   YLDSTRGLIDGFSTLLGYTTILTGLPVSVYTLYYSRMEGYGEGLDALMDCFIILVAMTY
FT                   TAPNILAMAVAWTVAEVVGWYLITMGEAHSVEGSLRSARGFLVTSTLTFEISVFTVVMV
FT                   SVLTTVAAMASANIGLLMEPFTALKPFSGVGLYLVPFLIIGFITKAANIPLHFWLPGAH
FT                   SAAPAPASAVLSGLMTLLGFYGLYRVLHIVDLTRYYTVIAAVIATLGASSVIYGWTQIA
FT                   VQRDGKKLLAYATIATNGYISLVFALYLLNPSGMAEDLLKLSILMHATYKTTLFAEVGL
FT                   IEAVYGTRYIHGVRGLSRILPLSSIGGLLAVLTLIGVPGTIGFTVKALSVYYIVSGTLD
FT                   PGRALVLLGFTIYIASSAYLAIKYMSIYFNTPRPVLPEEPKKPPKPLELSILALGSSNI
FT                   YIPLVASVFLNGLRSSVLILSAVSPLTLLVTLLVYATVARTGGVKH"
FT   sig_peptide     complement(54040..54123)
FT                   /locus_tag="Desmu_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(54133..54624)
FT                   /locus_tag="Desmu_0060"
FT   CDS_pept        complement(54133..54624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0060"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG0437 Fe-S-cluster-containing hydrogenase
FT                   components 1; InterPro IPR017900: IPR017896; KEGG:
FT                   dka:DKAM_1016 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; SPTR: 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64379"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAG9"
FT                   /protein_id="ADV64379.1"
FT                   /translation="MSANPGKYLRIIDLGTCIGCGACEAACDFIHDGHPYIKVYRTEIG
FT                   LEIPVSCMHCAKAPCIDVCPTGAMTRDSDGAVYVAASKCIGCMACLYACPFGIPELDRS
FT                   LRVSTKCDLCMDQRRKGLEPGCSSICPAGAILYGEEAAVFERAKKRTAETMAKARFETL
FT                   "
FT   sig_peptide     complement(54550..54624)
FT                   /locus_tag="Desmu_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(54630..55709)
FT                   /locus_tag="Desmu_0061"
FT   CDS_pept        complement(54630..55709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0061"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudA"
FT                   /EC_number="1.8.1.-"
FT                   /note="COGs: COG0493 NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductase; InterPro IPR013027:
FT                   IPR000103; KEGG: dka:DKAM_1015 putative glutamate synthase
FT                   subunit beta; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Putative
FT                   glutamate synthase subunit beta; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64380"
FT                   /db_xref="GOA:E8RAH0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH0"
FT                   /protein_id="ADV64380.1"
FT                   /translation="MNFAFMCKEKTGSTNIKVAVIGAGPAGLAAAGYLACQGYSVDVYD
FT                   KLPHPGGLMVFAIPPWRIPRSRVLEGVRDLEKRLGVRFITRTKVYASPEPAHEEGDGFV
FT                   EKTLSLEEIVGSYDLVLLSTGTWRSKIPRIPGSDAKGVESALEYVHGFRLYELGLAASK
FT                   PFPGKRVVVVGGGYSAIDAAEQAVREGAEAYLVYRRTVKEAPAGLFEVERVKRLGVEFM
FT                   ELVSPVEIISENGAVKAVKLQRMQLGPPDETGRPQPIPVPGSEIVVEADRVVFATGETP
FT                   TPPLPQSEEYMGRLGIKLKKDGSIVVNQIMQTGNPKVFAAGDVVHGPSKVGPAIRSGFY
FT                   AARYMHNWIQVRLATARAR"
FT   sig_peptide     complement(55605..55709)
FT                   /locus_tag="Desmu_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            55865..56587
FT                   /locus_tag="Desmu_0062"
FT   CDS_pept        55865..56587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0062"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR006382: IPR006379: IPR013200; KEGG:
FT                   dka:DKAM_1014 phosphoglycolate phosphatase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3; PRIAM:
FT                   Phosphoglycolate phosphatase; SPTR: Phosphoglycolate
FT                   phosphatase; TIGRFAM: SPP-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: HAD-superfamily hydrolase, subfamily
FT                   IIB; sucrose-phosphate phosphatase-like hydrolase,
FT                   Archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64381"
FT                   /db_xref="GOA:E8RAH1"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH1"
FT                   /protein_id="ADV64381.1"
FT                   /translation="MAVKIVFTDIDGTLTVNRESYRLAVEAVEALRMLVDKGVIVSLVS
FT                   SNALPVVVALSRYIGLNGPVVGESGALVYHDEWGLVELAGESARQVYMDLLGNYREYVE
FT                   DSWQNKFRLYEYALKLRREHRGRAREVVDELRRYVESKYKGFTVDYSGYAIHVHAKGVG
FT                   KGVAVDYILRRLGLSGGEALGIGDSYMDVDFIARLGYRAAVGGADEELVRVCNIVAEAP
FT                   SGLGVAEVVHRILGERHE"
FT   gene            56587..57279
FT                   /locus_tag="Desmu_0063"
FT   CDS_pept        56587..57279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0063"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="COGs: COG0546 phosphatase; InterPro IPR006402:
FT                   IPR006439: IPR005834; KEGG: dka:DKAM_1013 HAD-superfamily
FT                   hydrolase, subfamily IA; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase; SPTR: HAD-superfamily hydrolase,
FT                   subfamily IA; TIGRFAM: HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1; HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED; haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64382"
FT                   /db_xref="GOA:E8RAH2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH2"
FT                   /protein_id="ADV64382.1"
FT                   /translation="MNSLLRGIRLILFDLDGTIVDSEDFIVWSFVEAGRLTGIRVDPLK
FT                   VRELIGFPLESILEAVVGTGLSREDAARFIEVRRKLVQENWFKHVRLFPDVIPVLRQLS
FT                   STGYMLGVASSSIRERVELFLSHLGVSGYFKVVSGLEPGVKGKPEPDVIVNALKAAGVP
FT                   RSEALYVGDRMVDCIAARRAGVKVVIVDRGSVNRWKQEECVPDAWISSLLELVDDASTP
FT                   TREATRHD"
FT   gene            57622..59117
FT                   /locus_tag="Desmu_R0005"
FT   rRNA            57622..59117
FT                   /locus_tag="Desmu_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            59328..62407
FT                   /locus_tag="Desmu_R0006"
FT   rRNA            59328..62407
FT                   /locus_tag="Desmu_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            62550..63401
FT                   /locus_tag="Desmu_0064"
FT   CDS_pept        62550..63401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0064"
FT                   /product="geranylgeranylglycerol-phosphate
FT                   geranylgeranyltransferase"
FT                   /EC_number="2.5.1.42"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR000537; KEGG: dka:DKAM_1012 UbiA
FT                   prenyltransferase; PFAM: UbiA prenyltransferase; PRIAM:
FT                   Geranylgeranylglycerol-phosphate geranylgeranyltransferase;
FT                   SPTR: ORF 1; PFAM: UbiA prenyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64383"
FT                   /db_xref="GOA:E8RAH3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH3"
FT                   /protein_id="ADV64383.1"
FT                   /translation="MGVLDYFSMMRIPNSLMSGVGAVFMSLMFSNYCVDCLGVVRLAAG
FT                   FATGFTVTAASMLVNDVVDLGVDRVNKPWKPLPSGRASPRVALALSILLPLIALAVNLP
FT                   VDKGLALVTVVYSALGLGYSFLRKHWWSQLIVAASTTGPIAYGYVAAGSPSSSIHVALG
FT                   LSITIFVVTLGREVLKAMQDVEGDRLHGYSTIPLKLGVEESAKLLVFAGIAGPAAGITT
FT                   GVVAGSGIVYKAVISVAGGLYLYSMVKAYRKPREKNVLEEARKETLLEMMLGLVAFWMF
FT                   RV"
FT   gene            63596..64459
FT                   /locus_tag="Desmu_0065"
FT   CDS_pept        63596..64459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0065"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: dka:DKAM_1011
FT                   phosphoesterase, PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR: ORF 2; PFAM:
FT                   PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64384"
FT                   /db_xref="GOA:E8RAH4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH4"
FT                   /protein_id="ADV64384.1"
FT                   /translation="MPGKMRSVKCQAALYMGVALALSMLLNNTAAWKVWSLLGEEYIYL
FT                   FTGIILFYLVDPYIGVYTVLATTASGALNLALKHLFNTPRPPNPLVKVEGPGFPSGHAQ
FT                   VSASFWSMLTLLRREACLAALSLVMVTGVSLSRLYLRAHYPIDVAGGVVVGLTVSVALN
FT                   QAGTRLSLGKTMLATGTAVSALSLIALVLNPGGTTAQGLLGVGAATAISAVFIEESVKA
FT                   LRNSALRPRLEMLAASGVLIAVLYLAARTGGILKIPLYTAMGLVLYGTPLIYTGLHGKA
FT                   EKSRRG"
FT   sig_peptide     63596..63688
FT                   /locus_tag="Desmu_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(64488..64562)
FT                   /locus_tag="Desmu_R0007"
FT   tRNA            complement(64488..64562)
FT                   /locus_tag="Desmu_R0007"
FT                   /product="tRNA-Pro"
FT   gene            complement(64604..65248)
FT                   /locus_tag="Desmu_0066"
FT   CDS_pept        complement(64604..65248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0066"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: dtu:Dtur_0544 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; SPTR: Methyltransferase type 11;
FT                   PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64385"
FT                   /db_xref="GOA:E8RAH5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH5"
FT                   /protein_id="ADV64385.1"
FT                   /translation="MENPFNDFYMEYDEWYESNRLIYESELRAVEKASTRVPRPWLEIG
FT                   VGSGRFSSPLRIDVGIDPSERIISLAYERGVESVVGVGEELPFRDSCFGGVFIIVTLCF
FT                   VDNPLRVLKESWRVLRDDGYVIVGFVPRESPWGRLYVEKKAKGHRFYRLARFYSVSEVY
FT                   EMLEASGFKTVSVVSTLLQGPGDVRFAETPVEGYVEGAGFIVVKAGKKHAL"
FT   gene            65346..66137
FT                   /locus_tag="Desmu_0067"
FT   CDS_pept        65346..66137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0067"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG5014 Fe-S oxidoreductase; InterPro
FT                   IPR007197; KEGG: tpe:Tpen_1582 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SPTR: Radical SAM domain protein; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64386"
FT                   /db_xref="GOA:E8RAH6"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH6"
FT                   /protein_id="ADV64386.1"
FT                   /translation="MYGLKERLMHEAGYDPLRLGVEVEKHVARGDKRKYYRFRGGRWYG
FT                   GIATADCVGCNLRCRFCWGWIPRDNYSSYGEFYSPREVYGRLVAIASRRGYRYVRVSGN
FT                   EPTLAWQHLLELLELFEQDGRYTFILETNGIIIGADKAKARDLAGFKHLHVRVSLKGVN
FT                   EDEFHRLTGARREFFSLQLKALENLLNEGVSTHPAVMLSFSEPRGVDILKERLREIDKG
FT                   LADNLEEEYVFLYPHVVELMARTGLKPRVAYSPDGIPGDLV"
FT   gene            complement(66212..67195)
FT                   /locus_tag="Desmu_0068"
FT   CDS_pept        complement(66212..67195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0068"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /EC_number="5.3.1.8"
FT                   /note="COGs: COG0166 Glucose-6-phosphate isomerase;
FT                   InterPro IPR011857: IPR019490; KEGG: dka:DKAM_1010
FT                   bifunctional phosphoglucose/phosphomannose isomerase; PFAM:
FT                   Bifunctional glucose-6-phosphate/mannose-6-phosphate
FT                   isomerase-like; PRIAM: Mannose-6-phosphate isomerase; SPTR:
FT                   Bifunctional phosphoglucose/phosphomannose isomerase;
FT                   TIGRFAM: bifunctional phosphoglucose/phosphomannose
FT                   isomerase; PFAM: Bacterial phospho-glucose isomerase
FT                   C-terminal region; SIS domain; TIGRFAM: bifunctional
FT                   phosphoglucose/phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64387"
FT                   /db_xref="GOA:E8RAH7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH7"
FT                   /protein_id="ADV64387.1"
FT                   /translation="MEEMYRGWVEQLRGALMEWGRYRIHGVFNKIVVLGMGGSGIVGDF
FT                   LSALSMIHGGLPVFTLKSHVSPGFIDSGTLAISVSYSGNTRETILATMGVLGRAGGVAV
FT                   VSSGGYLRELALKHGIPFIPLPSGLAPRASLPSMLFKILGLLDSSGLRIVGRGEAEEAF
FT                   AFIKDNMGGAEEEARRLAEWINSVQGLLVIATHTPLEPLAVRGKNEFNENSKIPVKVDV
FT                   APEWMHNDIVGYEQPGIPLRVVEVVDPSDRVGRGLVEFMHGVYVETGASTYRLALRGGT
FT                   LLEKMMYGSLVLGLASCRLARLRGIDPLETKSIKRYKESVDSLLQA"
FT   gene            67270..67902
FT                   /locus_tag="Desmu_0069"
FT   CDS_pept        67270..67902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1009 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64388"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH8"
FT                   /protein_id="ADV64388.1"
FT                   /translation="MVPLQLFTRGFKAVVSHYMVIKLKLASEIIAEAGSRVTLLDPGNM
FT                   LQGAVDTAYINAPDSGERAPGGGSLLIVFEPTQDMDLEGLAEGHDNILVFTTPGSPIRI
FT                   PRFFAKMFIDRIDERTYIMRMQGGRTLRILVNPEGLRFIDKPEGAYGRAYDLVTGLMAE
FT                   HGEVTVKDAVRAISLELGVSREAARRILYRLVEERYLRIVRGRISLG"
FT   sig_peptide     67270..67368
FT                   /locus_tag="Desmu_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(67913..68380)
FT                   /locus_tag="Desmu_0070"
FT   CDS_pept        complement(67913..68380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0070"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR016618; KEGG: dka:DKAM_1008 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64389"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAH9"
FT                   /protein_id="ADV64389.1"
FT                   /translation="MKPLEKPPRIKVLEAAGSIGDNRVRVVDSTHAVVTSSTGERSYRV
FT                   VLIQEEAGVFRVYSDDNGTIHRGYIGYPIIAFMILKGLLPVDNTVVKAFTGIPWKELNE
FT                   KYKKYSVVENIVISRAERMGVPRNVVDDYINVVLKKLGIYKVFFDESLANA"
FT   gene            complement(68383..68619)
FT                   /locus_tag="Desmu_0071"
FT   CDS_pept        complement(68383..68619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1007 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64390"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI0"
FT                   /protein_id="ADV64390.1"
FT                   /translation="MTSKKSFSGVVIGIEQVEGYDKPLLYVHGEAEGYEGEFYVLVPDE
FT                   ELENYMRLGIGQRIEGVGVEESGSPLVLRKLVV"
FT   gene            68773..69564
FT                   /locus_tag="Desmu_0072"
FT   CDS_pept        68773..69564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0072"
FT                   /product="Uncharacterized conserved protein UCP037214"
FT                   /note="InterPro IPR017140; KEGG: dka:DKAM_1006 hypothetical
FT                   protein; PFAM: Uncharacterised conserved protein UCP037214;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in archaea (DUF2258)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64391"
FT                   /db_xref="InterPro:IPR017140"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI1"
FT                   /protein_id="ADV64391.1"
FT                   /translation="MSEKTSGELNTGIIIAGAYAGKVRRTLYAQLSSRVKTDKEFAREV
FT                   ARASGELNMLLYHILVGELKVNKGDAVRVRVKYVVEGEPGRIKWLYDSLRLEVFKRVPD
FT                   EEVEGAVNKVIAEKLREIQEQYKEAPSREEAEKILSGEEAGETGLEAVKPGGDPLDSVG
FT                   SLDVIGETVEGGYLLKITGKDGSSMGVVTLAPSGEDVALDAILLGDGDKVYRYLARVRG
FT                   RVDQYIEAPGKIIEELRKAKPSQLNREDAAKLIEEKMKLLI"
FT   gene            complement(69553..70530)
FT                   /locus_tag="Desmu_0073"
FT   CDS_pept        complement(69553..70530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0073"
FT                   /product="phosphoesterase DHHA1"
FT                   /note="COGs: COG0608 Single-stranded DNA-specific
FT                   exonuclease; InterPro IPR001667: IPR003156; KEGG:
FT                   dka:DKAM_1005 phosphoesterase, DHHA1; PFAM: phosphoesterase
FT                   DHHA1; phosphoesterase RecJ domain protein; SPTR:
FT                   Phosphoesterase, DHHA1; PFAM: DHHA1 domain; DHH family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64392"
FT                   /db_xref="GOA:E8RAI2"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI2"
FT                   /protein_id="ADV64392.1"
FT                   /translation="MSRRIILVHGDSDGVASGALAYAFFSARTDTQVFFTHPVGLLGDL
FT                   KEFTRNGDDLLIADIALNETTAVDVLRLLEERGRYGNVVYIDHHPEPLGVSLSSVESIN
FT                   IVHDTCCSASELTFRYLVENGLDEEYSRVALYGAIGDYLDETPWVKKTLGEWDKRAVYL
FT                   EAGVLTQALEGTRRDHEFKRRVVEYLSKNSLPSLNTAMVERALEQARRDEELRLWVKAN
FT                   TVVYGAVGYVVNPPGSVGKAANYARVYGRARIGVAVEERGETYVMSLRSDGSVDLNKVL
FT                   RLMSREIPVMGGGHPFAAGARLEKRLFKDFLTKLNEAAGYPLDQ"
FT   gene            70744..71748
FT                   /locus_tag="Desmu_0074"
FT   CDS_pept        70744..71748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0074"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: dka:DKAM_1004 phage
FT                   integrase family protein; PFAM: integrase family protein;
FT                   integrase domain protein SAM domain protein; SPTR: Phage
FT                   integrase family protein; PFAM: Phage integrase, N-terminal
FT                   SAM-like domain; Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64393"
FT                   /db_xref="GOA:E8RAI3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR033686"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI3"
FT                   /protein_id="ADV64393.1"
FT                   /translation="MPGRIDLGRAPQGILELGNDEILEEFKVSLEASGASSETVKAYLS
FT                   AVKDFLSFIGGKPLREVTLKDVVAWRNERLRNGFPNRKMEGREKWQVTLHYYTMFLKRF
FT                   FEWLGLNIGVSSVKKPPARINALSDEEIEKLMNAARTPLDKLILRLLVDTGLRSRELLG
FT                   LRVEDVDFHSRVIRVSSAKYGKERYVTATGETFEMLRSWIALNGLKPGDRLFNLTYSGL
FT                   YKKLKRLAARAGIPPEKIRPHVLRHTFATRALRRGLSLPSLQRLLGHADIKTTQVYLHL
FT                   SIEDLKKEYQEKIGGGTGGLRRCVKCGREIPADALYCPYCGSSQQAASPALEA"
FT   gene            complement(71745..72212)
FT                   /locus_tag="Desmu_0075"
FT   CDS_pept        complement(71745..72212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1003 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64394"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI4"
FT                   /protein_id="ADV64394.1"
FT                   /translation="MAATILELESVKNLDSLLGSLSSKGYRIEVGPHAVMEDHSEVAVF
FT                   KGFKDGKPAFIIIAHYISQYYRAVLSNGYKEDQAFLEELLRIKYSGEKWSIPVNPVFIA
FT                   VLDEGVTRDLEGYSDDYPVSDGGLLVEKYRESNPSYKEIPRIIVARLLDEA"
FT   gene            72287..73837
FT                   /locus_tag="Desmu_0076"
FT   CDS_pept        72287..73837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0076"
FT                   /product="aminopeptidase Iap family-like protein"
FT                   /note="COGs: COG4882 aminopeptidase Iap family; KEGG:
FT                   dka:DKAM_1002 aminopeptidase Iap family-like protein; SPTR:
FT                   Aminopeptidase Iap family-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64395"
FT                   /db_xref="GOA:E8RAI5"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI5"
FT                   /protein_id="ADV64395.1"
FT                   /translation="MAGYVEPGSTMERRVVEKLKGIIEEHVDWTTLHTIPVVKWEWSKC
FT                   MVRVNGEEYECNPLPYASKSIGEGLALQASTLRVVAGGLNGRVLLYKYPESILELRFMV
FT                   GEALKAGAEAVVLIGGKGRRMSDAVLSSSIPVMNPDTPPGIPVVVLEADAARNLQREEA
FT                   RITVEVDAGLSEATGRTLVAGVNGDEGNVIHVSTHHDGLPGDAGFIERYSEMLRDIVAS
FT                   AATVGGSSVILISFTAKEHGDPWLNSYTWSWGSRHLLGILSSKSELEKVVLDINVEAGG
FT                   GDNASIVDNPAPILSYNSIPTGIHLNEAGAHFALDSLTYLGHGVPAVALTGLKPDVIIN
FT                   HEGLKRLTQHLVEAARDPEAMLRSMWRGLIGKLGDTPLEHRDLLARIHESSRLLGPRGA
FT                   VRALTRYVSTLSSIYLVTGTGFHACISHMGYSAALRGCRGILEEASEMYGRVVAWGLSG
FT                   IVLDARVKLKILEDVARRIDSATLIKSNELFNKTLELEACRQSLKGVVDERQEEHRDR"
FT   gene            73806..75248
FT                   /locus_tag="Desmu_0077"
FT   CDS_pept        73806..75248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0077"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COGs: COG0442 Prolyl-tRNA synthetase;
FT                   InterProIPR010916: IPR006195: IPR004499: IPR002316: IPR
FT                   002314: IPR004154: IPR016061; KEGG: dka:DKAM_1001
FT                   prolyl-tRNA synthetase; PFAM: Anticodon-binding domain
FT                   protein; tRNA synthetase class II (G H P and S);
FT                   Prolyl-tRNA synthetase, class II-like; PRIAM: Proline--tRNA
FT                   ligase; SPTR: Prolyl-tRNA synthetase; TIGRFAM: prolyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; Prolyl-tRNA
FT                   synthetase, C-terminal; tRNA synthetase class II core
FT                   domain (G, H, P, S and T); TIGRFAM: prolyl-tRNA synthetase,
FT                   family I"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64396"
FT                   /db_xref="GOA:E8RAI6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI6"
FT                   /protein_id="ADV64396.1"
FT                   /translation="MSARKSIGIDKYKDFPEWYHSVLKEAGIIDIRYPVKGMNVWMPYG
FT                   LKALRLTQRILMDLLEETGHQEAYFPTMVPESVFSREKDFLKGFGGETFVVEGTVTRKF
FT                   NERLFVRPTSETVMYYMWNMWIKGRKDLPLKMYQVVNVFRYETKMTHPILRVREIMGFI
FT                   EAHTAHATMEEAEKQISEAIAIYKEFFNRLQLPYFIVKTPPWDTFAGAEYNYDFITVMP
FT                   DGKGLELGSVINLGQKFAKAFEIKYMDTDGVEKHVYQTCYGVSERVLGAVIGIHGDETG
FT                   LFFPPDIAPIQVVIVPVMKPGENQVLEYAFKVSNILKAHGVRVFVDTDQEHTPGWKYYY
FT                   WEMKGVPTRIEVGRKELDASTVTIARRDKREKHVVKLEEAVDLLRKIWSEINEYLRSRA
FT                   LEHLARKTVFLPEHPEDKGFDGLVIAPWDGSRECAEELEKETGKNVLGEITESPLNLPP
FT                   PSQYTACGKAKADRYALLGVTY"
FT   gene            75499..75747
FT                   /locus_tag="Desmu_0078"
FT   CDS_pept        75499..75747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1000 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64397"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI7"
FT                   /protein_id="ADV64397.1"
FT                   /translation="MSEYIKQLKIQVAGKVPGVKFQDKSAMEVMIMKEGKTLLTIRDEK
FT                   DYITLTTADGKSFKYDKWYTKPENLAETIKVYVERLK"
FT   gene            complement(75692..76426)
FT                   /locus_tag="Desmu_0079"
FT   CDS_pept        complement(75692..76426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0079"
FT                   /product="ATP binding protein"
FT                   /note="COGs: COG2102 ATPase of PP-loop superfamily;
FT                   InterPro IPR002761; KEGG: dka:DKAM_0999 putative ATP
FT                   binding protein; PFAM: protein of unknown function DUF71
FT                   ATP-binding region; SPTR: Putative ATP binding protein;
FT                   TIGRFAM: ATP binding protein; PFAM: ATP-binding region;
FT                   TIGRFAM: MJ0570-related uncharacterized domain; conserved
FT                   hypothetical protein TIGR00289; arCOG00187 universal
FT                   archaeal metal-binding-domain/4Fe-4S-binding-domain
FT                   containing ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64398"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI8"
FT                   /protein_id="ADV64398.1"
FT                   /translation="MNATVLFTGGKDSVYALHKAAEAGYRIVVLSSIIPLYRYSMLYHQ
FT                   PYFNILQAQSQSLGIPLETIGVSEGEMEIDALRMLLTRVRDRYGVKVVVSGAIASNYQR
FT                   KRFEQVVGELGLELYTPLWGRNPYKYLGELLENGIRFIIMSITSMGIPLEILGREIEAE
FT                   DVERLIKLARKYGFDPSFEGGDAETIVVDSPLFKYRLLIAGEKKILSEYEGYYEPSAVR
FT                   LVKKPTSTSQHRPLSFQQGSPV"
FT   gene            complement(76595..78007)
FT                   /locus_tag="Desmu_0080"
FT   CDS_pept        complement(76595..78007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0080"
FT                   /product="H+transporting two-sector ATPase alpha/beta
FT                   subunit central region"
FT                   /note="COGs: COG1156 H+-ATPase subunit B; InterPro
FT                   IPR000194: IPR000793; KEGG: dka:DKAM_0998 V-type ATP
FT                   synthase subunit B; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SPTR:
FT                   V-type ATPase subunit B; PFAM: ATP synthase alpha/beta
FT                   chain, C terminal domain; ATP synthase alpha/beta family,
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64399"
FT                   /db_xref="GOA:E8RAI9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAI9"
FT                   /protein_id="ADV64399.1"
FT                   /translation="MESKLATRVSSRLLKAQGGLLFAETIPGVTYGEIVEVLLPTGEAK
FT                   LGQVIDVSRDATVIQVFGGVADVDLLKSRVKYRGETLRIPVSIDMLGRVFDGLGRPIDN
FT                   GPRIVPEDYLDINGAPLNPASRLPPSEFIETGISAIDGLFSIVRGQKLPIFSGSGLPHN
FT                   RIAAQIVRQARVLGKEEKFAMVFAAIGVPYDDAMFFIENFRRTGALERTVALINTASSP
FT                   VIERIATPRVALTIAEHLAWTHDMHVLVVLTDMTFYCEALRELSAAREEVPGRRGYPGY
FT                   MYTDLATIYERAGRVRGKKGSVTQLPILTMPDDDITHPIPDLTGYITEGQLVLSRQLWM
FT                   KGIYPPFDPLMSLSRLMKDGIGAGKTREDHHGVFMQLMSAYAEGTRLRELSVIVGTEAL
FT                   TQRDKKYLEFADRFEREFIGQGEYEHRTIEETLNKGWELLAILPEDELKKVKVEHIRKY
FT                   HPGYRGRNSQAG"
FT   gene            complement(78007..79764)
FT                   /locus_tag="Desmu_0081"
FT   CDS_pept        complement(78007..79764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0081"
FT                   /product="H+transporting two-sector ATPase alpha/beta
FT                   subunit central region"
FT                   /note="COGs: COG1155 H+-ATPase subunit A; InterPro
FT                   IPR020003: IPR004100: IPR000194: IPR000793; KEGG:
FT                   dka:DKAM_0997 V-type ATP synthase subunit A; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SPTR: V-type ATPase subunit A; PFAM: ATP
FT                   synthase alpha/beta family, beta-barrel domain; ATP
FT                   synthase alpha/beta chain, C terminal domain; ATP synthase
FT                   alpha/beta family, nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64400"
FT                   /db_xref="GOA:E8RAJ0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ0"
FT                   /protein_id="ADV64400.1"
FT                   /translation="MSRPAGRIYRVSGPLVVAEGMRGVSVYEVIEIGEEKLIGEAIGVE
FT                   GDKAIIQVYEDTSGLKVGDPVYPTGHPLSAELGPGLIKSIFDGIQRPLPVLEALSGIFV
FT                   RKGIKAPPLPRDKKWYFTPLVKPGEKVSEGDFIGYVNETDVVRHYIMVPPGVKGSVEWV
FT                   AGEGDYTMVEPVARINGRDVTMLQEWPVRRPRPFREKLDPREPFITGVRVIDFLFPLAK
FT                   GGKAAVPGGFGTGKTVLLHSITKWSEADITIYIGCGERGNEMADALNSFIKLVDPRTGK
FT                   PMMERSIFIANTSNMPVAAREASVFLGVTIGEYFRDMGYNVLLVADSTSRWAEAMREIS
FT                   GRLEELPGEEGFPAYLASRLAQFYERSGYVKTIGSAERLGSLTIMGAVSPPGADFSEPV
FT                   TQATLRLIRALYALDVNLAYRRHYPSINWLTSFSLYVDNVREWWSKISPEYSYLREKIS
FT                   WLLQREAELEELVRLVGADALPVEDRLVLEVARMIREDFLQQDAFSTVDAFSHPVKTSR
FT                   MAAVIVRFYEKSIEAVKQGVAFEKIRSMRIRERIARMKDIPFGDNDKEFEGILSDMENE
FT                   FKALMEGGR"
FT   gene            complement(79824..80141)
FT                   /locus_tag="Desmu_0082"
FT   CDS_pept        complement(79824..80141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0996 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64401"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ1"
FT                   /protein_id="ADV64401.1"
FT                   /translation="MYRGRVLVIGDEYLSLIGVAGGADSVVYSGGCSNLVEKLRGSIAN
FT                   YVVLITYRHVLDECPELRNLVDEAKTLVVELEKPEEASRINVKQYYAEIARKYLGIEIP
FT                   I"
FT   sig_peptide     complement(80076..80141)
FT                   /locus_tag="Desmu_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(80143..81090)
FT                   /locus_tag="Desmu_0083"
FT   CDS_pept        complement(80143..81090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0995 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64402"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ2"
FT                   /protein_id="ADV64402.1"
FT                   /translation="MLVESSRFFLTKSDYLNILSSQSLETAVGYLSDKFLATDIGRLAE
FT                   PHRMDLRSLYIAIDQGYSRVVEDLLDGTGVGRVAARRILWLLAAPDLYLSLNALSTNVK
FT                   PPLLTSPLPAVLPGNLDPGRLQELKKSLPRELHGMINEYIDKKNVSLQQLVKTLDALAQ
FT                   GFEKVKGYELGVLTGLLHDLLVIKVCIGVADVRPLQPRAFSLSPEDLYEGCGRGVSELI
FT                   PILSRARPAAGVFASVLSDALRFSPGVEALDLATYTGASHLASLVLKGSEPETVARLLL
FT                   KLLGQYVLLKLSLTVVHSGLYRQEAVQFVNRWVG"
FT   gene            complement(81099..81674)
FT                   /locus_tag="Desmu_0084"
FT   CDS_pept        complement(81099..81674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0084"
FT                   /product="H+transporting two-sector ATPase E subunit"
FT                   /note="COGs: COG1390 H+-ATPase subunit E; InterPro
FT                   IPR002842; KEGG: dka:DKAM_0994 V-type ATPase subunit E;
FT                   PFAM: H+transporting two-sector ATPase E subunit; SPTR:
FT                   V-type ATPase subunit E; PFAM: ATP synthase (E/31 kDa)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64403"
FT                   /db_xref="GOA:E8RAJ3"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ3"
FT                   /protein_id="ADV64403.1"
FT                   /translation="MQKMQEDAKAKLLREAEARAEQIVRDAEAEAERIVKEAEAKWRER
FT                   AEAERKRITSEAEREANTIISEALREARLLVSKEYEKAVEDVLREAYDSVRKRSFDIEN
FT                   SIRNLIRESLRLVNAPKKIVVSKGDLEAARRIVAELGLPGVVVEAGDIDGGVIVESESG
FT                   IVVDNTYESRLREFQSKHMDEVRRILWG"
FT   gene            complement(81681..82217)
FT                   /locus_tag="Desmu_0085"
FT   CDS_pept        complement(81681..82217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0085"
FT                   /product="V-type ATPase, subunit K"
FT                   /note="KEGG: dka:DKAM_0993 V-type ATPase, subunit K; SPTR:
FT                   V-type ATPase, subunit K; PFAM: ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64404"
FT                   /db_xref="GOA:E8RAJ4"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ4"
FT                   /protein_id="ADV64404.1"
FT                   /translation="MTCFYFPGLIRYSVLTGGNMAMDPLAQGLMYLAAALPLAGGIIGS
FT                   TTGMRHAASVGASVLSEDPTQFRNVLILAALPMTQTFYGLIQMIYMMIMYIPGLPQDSI
FT                   NMVKALALLGIGLAGFLAEWLSAWAQGIICASGIAELPRTKGKNLMSSIVLAAYVELWG
FT                   ILGIVFTILGLSLLG"
FT   gene            complement(82214..84184)
FT                   /locus_tag="Desmu_0086"
FT   CDS_pept        complement(82214..84184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0086"
FT                   /product="V-type ATPase 116 kDa subunit"
FT                   /note="COGs: COG1269 H+-ATPase subunit I; InterPro
FT                   IPR002490; KEGG: dka:DKAM_0992 V-type ATPase, 116 kDa
FT                   subunit I; PFAM: V-type ATPase 116 kDa subunit; SPTR:
FT                   V-type ATPase, 116 kDa subunit I; PFAM: V-type ATPase
FT                   116kDa subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64405"
FT                   /db_xref="GOA:E8RAJ5"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ5"
FT                   /protein_id="ADV64405.1"
FT                   /translation="MGVLLSKPSDMLRVNVAFLSGDREKVLRVLQEAGVVEVEPVEAEK
FT                   VIGEYERLQSLRERINNLLQKAKGLVIDASITGVELASLDVDKVEKHVADLYGEATLLE
FT                   EKARHLRESIESLRMLLSSLAPLPDSMDAAEIYYEGRHVSSILLSGKQEAVMELLEKSR
FT                   VLKASKMYQGGERVSVIVYLPAGDLGQVVSAAHSMGLWCPSKQLVEALQLHGSIGSLRE
FT                   HLARRISELDAEASRVEARIAEIVKANGITLGKYLLFAENRLEYYRVSGAVVGLRHLSA
FT                   VTGWIPRDSIRLLEDLVKSSGIPVFIEYKDPLRGVDNPPSRFNNKGVLRYFQVITRLYG
FT                   VPGYWEPDPTPLIAYSFAFFFGLMNSDAGYALAGLLAIALVMDKLVENPYNPVYREFKG
FT                   ALLVSNAVSLVLGLLGGSIFGDLLPSVFGVNVPALIPVFSQPVEFIKLALLIGLIHINI
FT                   AHALATVKFAREERKGDLLNEAGLFISQLFGIPYVLQVFFKYQVPVLSYIPLNILLYLT
FT                   LLGVAMVIVGNYVAMRGLGFLMWIFQLTGVLGDVMSYVRLAGVSLASFYMAVSFNMMVK
FT                   LAINSVAGFIPGAAGVALAYVVSAPLLFMIHLVIMILSELGAFVHSLRLCMLEFLMKFY
FT                   DGSGREYSPFSIIAFKRIVIT"
FT   gene            complement(84184..84477)
FT                   /locus_tag="Desmu_0087"
FT   CDS_pept        complement(84184..84477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0991 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64406"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ6"
FT                   /protein_id="ADV64406.1"
FT                   /translation="MESIKDIDEAIDNILKEAERKKLVILKEAEKKAAEILGRPIPVEE
FT                   YRREAEAILAEAVKRRNEILEKARREAEEIAKIPPEKKRKAVEYIVRKVVGL"
FT   gene            complement(84502..84915)
FT                   /locus_tag="Desmu_0088"
FT   CDS_pept        complement(84502..84915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0088"
FT                   /product="protein of unknown function DUF61"
FT                   /note="COGs: COG2083 conserved hypothetical protein;
FT                   InterPro IPR002746; KEGG: dka:DKAM_0990 hypothetical
FT                   protein; PFAM: protein of unknown function DUF61; SPTR:
FT                   DUF61 domain containing protein; PFAM: Protein of unknown
FT                   function DUF61"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64407"
FT                   /db_xref="InterPro:IPR002746"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ7"
FT                   /protein_id="ADV64407.1"
FT                   /translation="MSDEYIDRFLIEELRLVNKHAPYERKNLCDLLKMEVPYIVLRDGS
FT                   SHLFNPRELAMLTEILGDDACRLELPIIVEYTPSNGEGVYVVRGGVEARAVAAAIGLNT
FT                   YSEPLFLSRVQILELRRVLRTTTTILLNPGPLS"
FT   gene            complement(84908..85525)
FT                   /locus_tag="Desmu_0089"
FT   CDS_pept        complement(84908..85525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0089"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="COGs: COG1394 H+-ATPase subunit D; InterPro
FT                   IPR002699; KEGG: dka:DKAM_0989 V-type ATPase, subunit D;
FT                   PFAM: H+transporting two-sector ATPase D subunit; SPTR:
FT                   V-type ATPase, subunit D; TIGRFAM: V-type ATPase, D
FT                   subunit; PFAM: ATP synthase subunit D; TIGRFAM:
FT                   H(+)-transporting ATP synthase, vacuolar type, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64408"
FT                   /db_xref="GOA:E8RAJ8"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ8"
FT                   /protein_id="ADV64408.1"
FT                   /translation="MSSLQRVRPTKIELIRLKKRLQISVKVERILRERLIILINEFMIL
FT                   LRESVSRRQKVAQLITTLSARATVLSGIYGENIYDLFEKTVPKATCIIGVENIMGVKTK
FT                   TVMIMKSGEARPVKTPFDDFAEESARFIEEVIELAKAENALKTMGREIRVTKRRVNALD
FT                   YILIPRLRSTIRMLQMKFDEREREEKARLKRVKASLERRKGE"
FT   gene            complement(85580..85933)
FT                   /locus_tag="Desmu_0090"
FT   CDS_pept        complement(85580..85933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0988 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64409"
FT                   /db_xref="UniProtKB/TrEMBL:E8RAJ9"
FT                   /protein_id="ADV64409.1"
FT                   /translation="MSIDTDALKRVLSMRLIFEGGSSWAVRELIDAVEDYLMERLPMIV
FT                   NSLIEPFGLEASVLRGDPCRLFPGEACNQLVVVGLYAGDTGRHVGYVLYRLIRGENTFE
FT                   FSLYRLVEAAGGE"
FT   gene            complement(85923..86471)
FT                   /locus_tag="Desmu_0091"
FT   CDS_pept        complement(85923..86471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0091"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR020084: IPR020476: IPR000086; KEGG:
FT                   dka:DKAM_0987 ADP-ribose pyrophosphatase; PFAM: NUDIX
FT                   hydrolase; SPTR: ADP-ribose pyrophosphatase; PFAM: NUDIX
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64410"
FT                   /db_xref="GOA:E8R6X7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6X7"
FT                   /protein_id="ADV64410.1"
FT                   /translation="MDKPQLLREELLLKGLRFNVIRRYYRKANGEEFARDVVAFPEAVA
FT                   VLPVLDDGSVILLRQFRAPLNDTIIEAPAGVVDPGETPEEAAERELEEETGYHAGRLVR
FT                   LGSFTPSPGYSSEVIHFYYATRLEYRGAKPERYEVLEPFKTMFQDALAMVHRGVISDMK
FT                   TALLILLYDHALRGGGVEH"
FT   gene            86811..87749
FT                   /locus_tag="Desmu_0092"
FT   CDS_pept        86811..87749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0092"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593; KEGG:
FT                   dka:DKAM_0966 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64411"
FT                   /db_xref="GOA:E8R6X8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6X8"
FT                   /protein_id="ADV64411.1"
FT                   /translation="MVNAVEIRSFTKKFGDFTAVEDLNLDIREGEVFGLLGPNGSGKTT
FT                   TLLTVATIYRPTSGDIYVYGHSVVREDYIVRKMIGIAFQDPKALWVDKPYDLLIWHAKV
FT                   VGYSGEEARRVVREVMEALGLWEHRNKYFYQLSGGTRKKVELAKVLVQKPRLAILDEPT
FT                   AQVDVLAKHALWDVIKRLKREGVTVILATNDMFEAERVCERVAIIHKGRLRALGTIDEL
FT                   KDLIPGGDVVEIQVGGTGIPVSIMEKLGEYGRVEAGNGSLRIYLEKGEEKVVDIVDLLR
FT                   RNNIAVSRLMIKEPTLDDVFTYLTGARLRGE"
FT   gene            87706..88548
FT                   /locus_tag="Desmu_0093"
FT   CDS_pept        87706..88548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0093"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR013525; KEGG: dka:DKAM_0965 ABC-2 type
FT                   transporter; PFAM: ABC-2 type transporter; SPTR: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64412"
FT                   /db_xref="GOA:E8R6X9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6X9"
FT                   /protein_id="ADV64412.1"
FT                   /translation="MSSRISQGQGSEASRVGVPGDLRDIVHIIEWDLERLKSQRVFLAM
FT                   RLSWFIIQVFIFARAISLIVRQLTGVSYYEFYLLGIYVSILYSTSISRGYVIADEFDDG
FT                   IVEYHLSLPVKRWVLVLGRVLGCSLAATIFTLPMMLVVLLAVNALSLPGLLLSTLIAYV
FT                   FSTGVVGFVIFVVTRVKSTDVTDILFGTIDAILVRLSTVFYPLPVIEALGFAPYYYAAL
FT                   LNPLTSMADAIRLIFLPEYVAYTVSPHALLLYLVGFSLGMMVLALEHYTKRLEAGGWK"
FT   gene            88548..89315
FT                   /locus_tag="Desmu_0094"
FT   CDS_pept        88548..89315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0094"
FT                   /product="ABC-2 type transporter"
FT                   /note="InterPro IPR000412: IPR013525; KEGG: dka:DKAM_0964
FT                   ABC-2 type transporter; PFAM: ABC-2 type transporter; SPTR:
FT                   ABC-2 type transporter; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64413"
FT                   /db_xref="GOA:E8R6Y0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y0"
FT                   /protein_id="ADV64413.1"
FT                   /translation="MMEDLKSAALIAQRDLARFWRYKYWLAGQVAMNLADIFIFGLIFR
FT                   GMVNPALIPDYIKFITPGILSLSIFISSFSIGREVGVELRREVTLYLVSLPVKRTVLVA
FT                   GRILGGLLRGLIYQLGFLFFAALLLGIPNPSKWIIILYTTLLLAASMSGLSISLSTVTR
FT                   DFNLQATIRSLTYNVLFFVSNIFYPESVVKARLGFAAPVVKYSPLSMATSIYRWGFNYT
FT                   GDVDVLFNAVGLLMWSIIILAVACKLYLRNLAG"
FT   gene            89322..89864
FT                   /locus_tag="Desmu_0095"
FT   CDS_pept        89322..89864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0095"
FT                   /product="protein of unknown function DUF998"
FT                   /note="KEGG: dka:DKAM_0963 protein of unknown function
FT                   DUF998; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF998)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64414"
FT                   /db_xref="GOA:E8R6Y1"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y1"
FT                   /protein_id="ADV64414.1"
FT                   /translation="MNPRLLVLASVAVPLSSIAIAALLSNWFNPLENALSDLGHAARSS
FT                   VAAVFNGGLVFGGLLTYTVAVTSRQTRRSYNMLLALTAVFLILIGVYDEIYGRLHFAVS
FT                   VAFFTGTMIFMAWITVKETSKVIRAYSVSALLIELAAWIIYFMYRIPRGAAIPELISVA
FT                   SFTPLYIYIYSRGNQHA"
FT   sig_peptide     89322..89384
FT                   /locus_tag="Desmu_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(90171..92546)
FT                   /locus_tag="Desmu_0096"
FT   CDS_pept        complement(90171..92546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0096"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR018303: IPR006121: IPR006416: IPR001757: IPR
FT                   008250: IPR005834; KEGG: tag:Tagg_1238 heavy metal
FT                   translocating P-type ATPase; PFAM: E1-E2 ATPase-associated
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: Heavy metal translocating P-type ATPase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase; haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64415"
FT                   /db_xref="GOA:E8R6Y2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y2"
FT                   /protein_id="ADV64415.1"
FT                   /translation="MMRRREPVEIIGVDCSTCIYAIKRRLADLRGNVKLESDFLGNAVI
FT                   EYDDEYVSLSEIYHAIRDAGYDLVKEELEVFAEEIQPETAVAVEKEIRRLPGILDVRVD
FT                   TLTCRILVRFNPRTVEKHYILSLLDNMGLSLREEPRGGRGGTKAHIARRFAAFATGLTV
FT                   LIISMSHILPHDAGIPVLLALSSLTVLLSYDVFLKGFKSLFMWAPTMESLIALSAGITF
FT                   VSGILLCITGSATRYQAMFLEASAGVLGFVNLGRYLEDSLRKRALTHLTVLETSLNSKV
FT                   RVVEDGRVEEVSADAVSLNSIIEVKAGEKILVDGIVVDGWGYVDESTFTGEPIPVLKSS
FT                   ENRDRVLAGTILTSGYIRVRVTRKGRDTALYNLLASAREAVLHRPGFQQLADKAVGKLT
FT                   WIVTASALVTVFSWYIYSGDIFLSLLFAASVLAVSCPCPLGIAIPMVVSIGVIKASREG
FT                   ILVKKGDVFERIPASNILLLDKTGTITVGKPSLKGVVTLGGYSREEIMKYVCSVEQRSE
FT                   HPLARAISNYCRDAGVSVEDPEFFEHLPGLGVLGVVMGKRVGVGSINLVKGLGVEINSG
FT                   TQTLIDEIGRSGGTPVLVVIGDEVAAVLEIRDEVREDALNVVKYFKSVGFKVGIASGDI
FT                   EENVKHVGKELGLDFFYSGLRPEDKGRLIHGIQGGGQRVLYVGDGVNDAIALSAAFVGI
FT                   AVGNATDIARESGDAILLRDSLETMITLHKLSKRVLRKARENLAWAFIYNGVLIPVAAG
FT                   VLYPFNGLMLMPEMAALAMILSDVTVILNSLSLLWWKP"
FT   gene            complement(92577..92747)
FT                   /locus_tag="Desmu_0097"
FT   CDS_pept        complement(92577..92747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0097"
FT                   /product="YHS domain-containing protein"
FT                   /note="COGs: COG3350 conserved hypothetical protein;
FT                   InterPro IPR011017: IPR007029; KEGG: pas:Pars_1206 YHS
FT                   domain-containing protein; PFAM: YHS domain-containing
FT                   protein; SMART: TRASH domain-containing protein; SPTR: YHS
FT                   domain protein; PFAM: YHS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64416"
FT                   /db_xref="GOA:E8R6Y3"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y3"
FT                   /protein_id="ADV64416.1"
FT                   /translation="MEYVDPVCGMRVDPSKSKHKTLYKGRIYYFCSSRCKEEFERNPEY
FT                   YLSHGPRGMPG"
FT   gene            92885..93721
FT                   /locus_tag="Desmu_0098"
FT   CDS_pept        92885..93721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0098"
FT                   /product="protein of unknown function DUF62"
FT                   /note="COGs: COG1912 conserved hypothetical protein;
FT                   InterPro IPR002747; KEGG: dka:DKAM_0978 protein of unknown
FT                   function DUF62; PFAM: protein of unknown function DUF62;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   S-adenosyl-l-methionine hydroxide adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64417"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y4"
FT                   /protein_id="ADV64417.1"
FT                   /translation="MRSGLIALLTDFGYRDPYVGVMKGVIKSINPAAEIVDLTHGVTRH
FT                   SIVEAAVVLLVSAKYFPHGTIFVVVVDPGVGSERRALVVETNNYILLGPDNGCLSLLAA
FT                   RDGVKRAFDISNTRFKLRDTSHTFHGRDVFAPVAAWISLGVPLEEVGVEVPAGSLRMLD
FT                   IEAPRVGGDHSVEGSVIYIDVYGNIMTNIGPAEITEAGFLQGDKLKVVGPTGVTGTCVF
FT                   TTSFSLVAPGELACYMNSWGYLEVAVNMGDAARMLGVAQGSRIMFAKAGHEVRSGI"
FT   gene            complement(93705..95267)
FT                   /locus_tag="Desmu_0099"
FT   CDS_pept        complement(93705..95267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0099"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="COGs: COG0651 Formate hydrogenlyase subunit
FT                   3/Multisubunit Na+/H+ antiporter MnhD subunit; InterPro
FT                   IPR003918: IPR001750; KEGG: dka:DKAM_0973 putative
FT                   monovalent cation/H+ antiporter subunit D; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR: Formate
FT                   hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter,
FT                   MnhD subunit; PFAM: NADH-Ubiquinone/plastoquinone (complex
FT                   I), various chains"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64418"
FT                   /db_xref="GOA:E8R6Y5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y5"
FT                   /protein_id="ADV64418.1"
FT                   /translation="MLQHVVGLIPFLPVLGAFITPLTYIVSRSRRVVFAQGVAFSLITL
FT                   VLSLIAVVQAYREGTPSFYIMGGWPPPLGITYTLDMVSALLALTTSLVMTIIMAYSAEY
FT                   IVDEGYPWYVTLMLGAFSGMLGVIMTSDVFNLFVMLEVTGVSSYGLVMYYRSKAGSIVS
FT                   GLKYAFIGAMGTTLYLLALALIYNTYGSLNLVDLSLKIHGYPGSSITLEDAGYSVISAG
FT                   IIMVLALWTFSIKSGVFPNHFWLPDAHPAAPAPVSAMLSGLVVNVGAIGLYKVLYMMYG
FT                   GTLPARVTPVRDLASLLVVSTGMVSAIIGALLMGIQQDVKRIIAYSTVMNTGYIFMSLG
FT                   VLNAGGLLAFLYHTVVHSLAKSTLFLGIGVLVRYAGTRRINELAGFGRIHPLPGIAIGV
FT                   SVLTLAGIPPLPGFLSKLLMYEALFNYNPVFAIAMIVASAIGLLAYMKLFFTLLFEAPV
FT                   RKPRDTRYRLAEASALTASLILLVVGAACLFNPGFFNTVFIKPVDQVSDLMTYINHLAK
FT                   SLI"
FT   sig_peptide     complement(95163..95267)
FT                   /locus_tag="Desmu_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(95281..95766)
FT                   /locus_tag="Desmu_0100"
FT   CDS_pept        complement(95281..95766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0100"
FT                   /product="cation antiporter"
FT                   /note="COGs: COG1863 Multisubunit Na+/H+ antiporter MnhE
FT                   subunit; InterPro IPR002758; KEGG: dka:DKAM_0972
FT                   multisubunit Na+/H+ antiporter, MnhE subunit; PFAM: cation
FT                   antiporter; SPTR: Multisubunit Na+/H+ antiporter, MnhE
FT                   subunit; PFAM: Na+/H+ ion antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64419"
FT                   /db_xref="GOA:E8R6Y6"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y6"
FT                   /protein_id="ADV64419.1"
FT                   /translation="MIDRLAASLLVFIIYILIAGSLTPYDIATGVIVASVAGWVTGRYL
FT                   VRNPGKLLQPSRLLVSLLYFLKYMTVIEFKAHMDVVKRIFNMNIRPGIVKVPVTVVSDY
FT                   ARLLVANSITNTPGTVVVDERDGFFYVNWIDVSTTEPWQARLLISEEFERYASKIFD"
FT   sig_peptide     complement(95704..95766)
FT                   /locus_tag="Desmu_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(95763..96167)
FT                   /locus_tag="Desmu_0101"
FT   CDS_pept        complement(95763..96167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0101"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="COGs: COG1006 Multisubunit Na+/H+ antiporter MnhC
FT                   subunit; InterPro IPR001133; KEGG: dka:DKAM_0971
FT                   multisubunit Na+/H+ antiporter, MnhC subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: Multisubunit
FT                   Na+/H+ antiporter, MnhC subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64420"
FT                   /db_xref="GOA:E8R6Y7"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y7"
FT                   /protein_id="ADV64420.1"
FT                   /translation="MSESAFTWSLLLIVLVLNALISIYGIVYRRSLVKKLISLTMLSDT
FT                   VFVVFIMIGYRLVYPSIPPILVELTPENLEYVKQHGVDPLPQALVLTGIVIGMAVNALI
FT                   AFGIIQAYRLKGTTDARRLVEAVSEEVPEE"
FT   sig_peptide     complement(96093..96167)
FT                   /locus_tag="Desmu_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(96160..96894)
FT                   /locus_tag="Desmu_0102"
FT   CDS_pept        complement(96160..96894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0102"
FT                   /product="Na+/H+ antiporter MnhB subunit-related protein"
FT                   /note="InterPro IPR007182; KEGG: dka:DKAM_0970 multisubunit
FT                   Na+/H+ antiporter,putative MnhB subunit; PFAM: Na+/H+
FT                   antiporter MnhB subunit-related protein; SPTR: Multisubunit
FT                   Na+/H+ antiporter,putative MnhB subunit; PFAM: Domain
FT                   related to MnhB subunit of Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64421"
FT                   /db_xref="GOA:E8R6Y8"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y8"
FT                   /protein_id="ADV64421.1"
FT                   /translation="MERHRLLAVLLVLTIAGAFILTYTGCVEPSTTIKKLGLFYIENSY
FT                   YGNYSSMSPESVTAIVWDYRGLDTVYETAVFFLAIVGGLAVFRGLKPLRPGRGEGLTGI
FT                   ARTSTKIVSVMIIGASASIALHGHLTPGGGFQGGSTLGVAFLLLIPVYSVYAVLSKGVT
FT                   SEKLIAVRGLALASIGIVALLPVFKGLELASNTRFYPSHVAGMLISGSLFLYNFFEYIA
FT                   VAAGFAAVFLYLSLIEEGEGSE"
FT   sig_peptide     complement(96829..96894)
FT                   /locus_tag="Desmu_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(96897..97148)
FT                   /locus_tag="Desmu_0103"
FT   CDS_pept        complement(96897..97148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0969 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64422"
FT                   /db_xref="GOA:E8R6Y9"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Y9"
FT                   /protein_id="ADV64422.1"
FT                   /translation="MSLTLLLIILGSLLSLVFVYLTVTERDLLKAVGFSAGQSIAYTIL
FT                   LHVFAATDIVLTYIAVSVGIYSALLVYVVSKTERFEEG"
FT   sig_peptide     complement(97056..97148)
FT                   /locus_tag="Desmu_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(97145..97501)
FT                   /locus_tag="Desmu_0104"
FT   CDS_pept        complement(97145..97501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0104"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="COGs: COG1320 Multisubunit Na+/H+ antiporter MnhG
FT                   subunit; InterPro IPR005133; KEGG: dka:DKAM_0968 monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit; PFAM: Na+/H+
FT                   antiporter subunit; SPTR: Monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; TIGRFAM: monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit; PFAM: Na+/H+
FT                   antiporter subunit; TIGRFAM: monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64423"
FT                   /db_xref="GOA:E8R6Z0"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z0"
FT                   /protein_id="ADV64423.1"
FT                   /translation="MIEAILFWLGSILLFTGGVFDLIAAIGLLRFPNFYVRLHAATIGA
FT                   IYGAVFPLIGVALIALGTPELDGRFIIAGGAFATAIILMIIAPVGSHVLAYAAHKSRSV
FT                   EWNPVYDALEEDEK"
FT   sig_peptide     complement(97427..97501)
FT                   /locus_tag="Desmu_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(97498..97776)
FT                   /locus_tag="Desmu_0105"
FT   CDS_pept        complement(97498..97776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0105"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="InterPro IPR007208; KEGG: dka:DKAM_0967 multiple
FT                   resistance and pH regulation protein F; PFAM: multiple
FT                   resistance and pH regulation protein F; SPTR: Multiple
FT                   resistance and pH regulation protein F; PFAM: Multiple
FT                   resistance and pH regulation protein F (MrpF / PhaF)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64424"
FT                   /db_xref="GOA:E8R6Z1"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z1"
FT                   /protein_id="ADV64424.1"
FT                   /translation="MFQYIEYIAVISAPLYIAAIVLYTLRAVKGPTIPDIVLAIDCIAY
FT                   DLAVFLALIALYYRSPLMITPSMLLALWAYLLDIFISKHLASKRVEA"
FT   gene            complement(97858..101256)
FT                   /locus_tag="Desmu_0106"
FT   CDS_pept        complement(97858..101256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0106"
FT                   /product="pullulanase; alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /EC_number="3.2.1.41"
FT                   /note="COGs: COG1449 Alpha-amylase/alpha-mannosidase;
FT                   InterPro IPR004300: IPR019248; KEGG: dka:DKAM_0979
FT                   pullulanase, glycoside hydrolase, family 57; PFAM:
FT                   glycoside hydrolase family 57; Protein of unknown function
FT                   DUF2223; SPTR: Pullulanase, glycoside hydrolase, family 57;
FT                   PFAM: Domain of unknown function (DUF2223); Glycosyl
FT                   hydrolase family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64425"
FT                   /db_xref="GOA:E8R6Z2"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z2"
FT                   /protein_id="ADV64425.1"
FT                   /translation="MRIILLLALSLLLLSMLQPTLPVTSGLSNKIYVAIVWHYHQPWYY
FT                   SADESYLVLPWVRMHAVGNYYKMAYILSKYPDIRVTFTFSGSLLEQLTDMVENNKMDAR
FT                   EIIAWKIVNGTVTREDVFRMLQIPGGFFDINWGRIIDNSPRFRELRSLAQSAWSNCSTI
FT                   TRSESELMSCVVDSFTGGNLTGQNVIDLAVLFNLLWIDPQVAKEKYPDIYSLMEKAYSQ
FT                   SKPSYTTSDLRAVLLVHRDILANVVPAYRDLVSRGQVELIPVPYSHPLAPIVADLGFSE
FT                   DLEIHISESMRLFKKYFNVTPAGVWPAEQAVNEEVLAAFKRAGVNWTITDESILGKAGV
FT                   NTADVNMLGTPWYIDLQAGRIYVVFRSTELSNLISFQYSGRSYVDAVNDLVNRILSLRA
FT                   SVNGPRMIVIALDGENPWENYEKFGDLFLNELYKRLSELQSQGQVETTTPGAFIARYPD
FT                   TAQQLPLKTYSYLDLSGKDISNIPRDSYGNGYSDLPRKSIQARIPEGSWSGGELATWIG
FT                   DRQENIAWMWLVKARSDVLGKLGLQSFKELYTKFPEIARNLLKAEASDWWWWYGGDGGG
FT                   SPQTFDPLFKAYLRKAYELAGLTPPDYLGVTAYPDGTPVGVLNTNVPKPSGYTPSIDGV
FT                   IEPQWFTEVSSGNGLRIPVGATLDSMLLLVEPGKLYFAFNLSTTSISDLKIGVYFATPS
FT                   TSLSPFNPGYQVYPRGNRVDLGIYLVKEVLVEVSSASVTLSNATGNGWSKVAAGELRVS
FT                   RSGSSTTGEFSIDTSTLGLPEGSMAFLAVVLYNGSMVKEYSSRFGLVYQIQVPRGAIGG
FT                   NVVFKMNDPVGDDDGPGGFKYPTNAVFKPGVFDMTGFTVIDQGDKVVFKITFRDLGGNP
FT                   WSGPNGWSMQQVHIYIHTTLNGGNSSTIGLNAAIAQGYEWHMALILAPGWGNDPIPVGE
FT                   RSALYYYDKDTPVTQDGDFKVYADQASNSIIAEVSKKVLYDSGNLDKWVFTVAVTSHDG
FT                   FGTNRIRGFSIGGGEWQVNVPSNYSVAMLANVIPYILDVLAPTPQEQYQMLTSFDAANG
FT                   RQALLRGYGATPPSTTTTTTTTTTTTTTTTTTTTTTTTTTTSTPQTTITQPGQEGGMPL
FT                   LPVAVAVVVAASVSILVYLLRLKRS"
FT   sig_peptide     complement(101179..101256)
FT                   /locus_tag="Desmu_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            101418..101507
FT                   /locus_tag="Desmu_R0008"
FT   tRNA            101418..101507
FT                   /locus_tag="Desmu_R0008"
FT                   /product="tRNA-Val"
FT   gene            101652..101760
FT                   /locus_tag="Desmu_R0009"
FT   tRNA            join(101652..101691,101724..101760)
FT                   /locus_tag="Desmu_R0009"
FT                   /product="tRNA-His"
FT   gene            101813..102037
FT                   /locus_tag="Desmu_0107"
FT   CDS_pept        101813..102037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1024 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64426"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z3"
FT                   /protein_id="ADV64426.1"
FT                   /translation="MSVQKPREIYVPIHALPTCSLTDPCPNLELVELEREGEKYCVAYC
FT                   KVLERYLTKSAARKCESTWRGCPFAKLVM"
FT   gene            complement(102085..103320)
FT                   /locus_tag="Desmu_0108"
FT   CDS_pept        complement(102085..103320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0108"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR014277: IPR015163; KEGG: dka:DKAM_1427
FT                   cell division control protein 6; PFAM: CDC6
FT                   domain-containing protein; SPTR: Cell division control
FT                   protein 6-like protein, cdc6; TIGRFAM: orc1/cdc6 family
FT                   replication initiation protein; PFAM: CDC6, C terminal;
FT                   TIGRFAM: orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64427"
FT                   /db_xref="GOA:E8R6Z4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z4"
FT                   /protein_id="ADV64427.1"
FT                   /translation="MERDVRRIIEDELRRPTLFKNRESLAPEYVPDALPYRDEELRSLA
FT                   SYFRHLVTDPGSIAQRVLVTGGLGTGKTTLVRMFATGFTHVARERGVSLDYIHVNCYRS
FT                   RTLFSIVHDAASQLGLTTPSRGFSPREIVDMILSFLEENDRYAIMVLDDFHYFASVVGR
FT                   ESVYFIARMHEAGDGSRRLNLVFISANTSTTGFFDPVTESYLDRHVVRLQPYSSSQLLG
FT                   ILRYRARLAFQDDAYDEEALEFIAEYEGVDKNGEGNARHALTTLLVAGDIAEREGARRL
FT                   TVEHVRKAISRLSREIERVSDAIRYSPLHELLLLLSIVRLLRRRNVKGVEMGEVEEEYR
FT                   LLCNTYGETPRRHTQLYEYVRNLRRLGIVDTTVKNVENRGRTTIISIPYGPLEELEKYL
FT                   DALIWRKKDVEY"
FT   gene            complement(103349..103837)
FT                   /locus_tag="Desmu_0109"
FT   CDS_pept        complement(103349..103837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1426 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64428"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z5"
FT                   /protein_id="ADV64428.1"
FT                   /translation="MECSVVLLVTCRTGSDEWCAREIGDFLFSLDSNVIVEETGFPGVL
FT                   QVRSCIDAGRIYGRALSGEYGFVENIIPVQRVVPLTGLLRDPLGSLSGLELPERVKVRV
FT                   RMRGVRGVSRDVFTSLVKELKERGIIHDPASTRCLFIESIGDKVYIGVGYCEAIRRCF"
FT   sig_peptide     complement(103793..103837)
FT                   /locus_tag="Desmu_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(103876..103951)
FT                   /locus_tag="Desmu_R0010"
FT   tRNA            complement(103876..103951)
FT                   /locus_tag="Desmu_R0010"
FT                   /product="tRNA-Gly"
FT   gene            complement(104058..106589)
FT                   /locus_tag="Desmu_0110"
FT   CDS_pept        complement(104058..106589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0110"
FT                   /product="nuclease (SNase domain-containing protein)"
FT                   /note="InterPro IPR006021; KEGG: dka:DKAM_0961 nuclease
FT                   (SNase domain protein); PFAM: nuclease (SNase
FT                   domain-containing protein); SMART: nuclease (SNase
FT                   domain-containing protein); SPTR: Nuclease (SNase domain
FT                   protein); PFAM: Staphylococcal nuclease homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64429"
FT                   /db_xref="GOA:E8R6Z6"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z6"
FT                   /protein_id="ADV64429.1"
FT                   /translation="MPGVRLSITIVLLIPLLISLASLLLYQAPSVLGKYQLPFPDARVP
FT                   VAGVVDGDTLRIAPALLVAGGFRDTVRLADIDAPEINTSEGAWAAGNLSILLGQYGPVL
FT                   YLDIDSVRGVDDYGRIIGVVYIRYNSTHLLNVNKWLVDNGYAQIVNFTDNEFDPASWEL
FT                   YEAYPVEYDNNPSTYVATITSWSPAYYGSHNGFAYAVQEAYQAFAIAEEYNSASNTKPK
FT                   VYVAIVNSTTGDIAFTPSILTCYNGSSANVFQGFTGISANKTGFLVIWNQYEDTISGTR
FT                   YLRGLEFAFITGNTIVKQGYVGIESYAYAPVVFRLPGYSGWLVSYIATYRSGTTYNVTV
FT                   KLAVVNDNLDSPAALLNTLVIAPTADTTQYGNFTAVGFEYLAKVMVDPLSGRAVIASSS
FT                   WNPSTSRDIGLVMYYLNSSGAPDMAWIPVDSRTGDQGPIPQLASTTSAFYYNALYGNIH
FT                   AGMSTGASSSRVLVVYNATSSSLDYFVYDVTNNYTVAGPLSLATGLAVNASYYPYVIPL
FT                   GGNGWVVLYRDGYGNYSMSLIDFNGNLVKTIQVGRDISWVRGTYDASSGKILVSFKAGN
FT                   YTAISMYTLDLTPSNYTIVPLVNNTPLQSIPLYPVPTAQSSLMILSVGSTQVVTIRDIY
FT                   KSPQVITPTSTTTTTTTTTTTTTTTTTTTTITTPTTTTTTTQPATTTTTTQPDTTTTTS
FT                   TQPQATTTVTQTTTVTKTSTATVILVTTTTVTSTATIISPTTTTTTVTTTIPVTTTHTV
FT                   TYTTTVTSPVTTTATSTVRETTTHTTTARETTTATVTQTTTVTSTTTQPATTTTTVTEV
FT                   KTEIDYAVSAGVGLGVAVVLAAVLRFLVKGE"
FT   sig_peptide     complement(106491..106589)
FT                   /locus_tag="Desmu_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(106865..107134)
FT                   /locus_tag="Desmu_0111"
FT   CDS_pept        complement(106865..107134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0111"
FT                   /product="30S ribosomal protein S25e"
FT                   /note="KEGG: dka:DKAM_0962 30S ribosomal protein S25e;
FT                   SPTR: 30S ribosomal protein S25e"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64430"
FT                   /db_xref="GOA:E8R6Z7"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z7"
FT                   /protein_id="ADV64430.1"
FT                   /translation="MSEKKKPAPQTPSEKGARANIFEPSEDLLKRLKTAVSKQGVKYYT
FT                   PYTLAQELNIRISVARKLLREAEKRGIVKLYSGGRRAPVYIPAQ"
FT   gene            complement(107395..107811)
FT                   /locus_tag="Desmu_0112"
FT   CDS_pept        complement(107395..107811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0112"
FT                   /product="protein of unknown function DUF120"
FT                   /note="COGs: COG1339 Transcriptional regulator of a
FT                   riboflavin/FAD biosynthetic operon; InterPro IPR002834;
FT                   KEGG: dka:DKAM_0976 riboflavin kinase; PFAM: protein of
FT                   unknown function DUF120; SPTR: Riboflavin kinase; PFAM:
FT                   Domain of unknown function DUF120"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64431"
FT                   /db_xref="GOA:E8R6Z8"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR039063"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z8"
FT                   /protein_id="ADV64431.1"
FT                   /translation="MEASSRTRRARTLRGRVIEGLGEGCRYISLYRDAIRRALGIEPYP
FT                   GTLNIELIDPPVFNINMGEAIRVESPGPEYGDVLAVKAWINSIPVYIIRPVKTRHPASI
FT                   IEVVSQHNLRRSLGIRTGDIIEIQVEEGSHAPKD"
FT   gene            complement(107789..108034)
FT                   /locus_tag="Desmu_0113"
FT   CDS_pept        complement(107789..108034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oaa:100086729 hypothetical protein
FT                   LOC100086729; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64432"
FT                   /db_xref="UniProtKB/TrEMBL:E8R6Z9"
FT                   /protein_id="ADV64432.1"
FT                   /translation="MGSGDEERYLAVRGLQPLVHEGLFPSRDNQMGGSLTTPTAPQMTD
FT                   VAPNKCGEPVNPLGESSPFRAERRSEGPQHGGIQPY"
FT   gene            complement(108174..110000)
FT                   /locus_tag="Desmu_0114"
FT   CDS_pept        complement(108174..110000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0114"
FT                   /product="tungsten-dependent formaldehyde:ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="COGs: COG2414 Aldehyde:ferredoxin oxidoreductase;
FT                   InterPro IPR013983: IPR001203; KEGG: dka:DKAM_0975 aldehyde
FT                   ferredoxin oxidoreductase; PFAM: aldehyde ferredoxin
FT                   oxidoreductase; Aldehyde ferredoxin oxidoreductase; PRIAM:
FT                   Aldehyde ferredoxin oxidoreductase; SMART: Aldehyde
FT                   ferredoxin oxidoreductase; SPTR: Aldehyde ferredoxin
FT                   oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase,
FT                   N-terminal domain; Aldehyde ferredoxin oxidoreductase,
FT                   domains 2 & 3"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64433"
FT                   /db_xref="GOA:E8R700"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:E8R700"
FT                   /protein_id="ADV64433.1"
FT                   /translation="MYGWWGKVLLVDLTRMKTREIILDPETYRSYIGGRGLAVRLLWDL
FT                   VPPGADPLSPYNALVVASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGTMASHHLKH
FT                   SGFDAIVVTGASRKPVYIYVENEKVEVRSAEHLWGLDTFTTEDKLVREHGRNIGILEIG
FT                   PAGEHMVKYATVISQKGRSGGRPGIGAVMGSKRLKAIVVKGTREPPIADKNSLRSISEE
FT                   AYRKLLESEGYDYWIRQGTMATIQWSQQNSVLPTMNYREGVWELYETISGDLMEKLKTD
FT                   RRGCPYCNMQCGNVIADDAGEESELDYENVAMLGSNILLEDLRRVGEVNKMADKLGLDT
FT                   ISLGNAIGFYMEASERGLVRERLEWGDFKAVREIVVDTAYRRGLGAFIAEGVMRMSTSL
FT                   GGEALDFAMHVKGLEVSAYNCHTTPGMALAYATSSIGAHHKDAWIISYEVKTDRTSYSR
FT                   EKVERLIFLQNIRGGMFESLTTCRLPWVELGLNIEYYPKMLSAVTGLEWSINDMHTVAD
FT                   RIYTLIRAFWIREHSGWSRSMDYPPARWFKHPLTKGPYAGHHLDPLRYEKMLEAYYEMR
FT                   GWNENGIPRRETLLKLGLDFTIPILEKIVELG"
FT   gene            110242..111537
FT                   /locus_tag="Desmu_0115"
FT   CDS_pept        110242..111537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0115"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="COGs: COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase; InterPro
FT                   IPR002500; KEGG: dka:DKAM_0974 phosphoadenosine
FT                   phosphosulfate reductase; PFAM: phosphoadenosine
FT                   phosphosulfate reductase; SPTR: Phosphoadenosine
FT                   phosphosulfate reductase; PFAM: Phosphoadenosine
FT                   phosphosulfate reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64434"
FT                   /db_xref="GOA:E8R701"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8R701"
FT                   /protein_id="ADV64434.1"
FT                   /translation="MDEGWLCWDVRRNAPRLNCRKWRMKHDYWLAGSYERRLVEDMVRR
FT                   EFNASYSLQGKVMVVHRAPKPSPDAALALELFADGVRLGVVEYRLGEGWRLHPSGGLAS
FT                   LLHSTGVQVVEAESSGRRVKGKKVRVSGDVHGAKWVILDLGRHVGVGRVIDADGRVVKV
FT                   KDVVPKGFKPLQASSSSIVVDVNRDIVEEAVEEASVFLEKATGRVTGSIAVSYSGGADS
FT                   TATLMLAGRVIDPGRLIVVYVDTGMDLPGVKEYSMRVLGRLGVNPYVVSSGLDPLAEIA
FT                   SRGLPTRENRWCTRILKLEPLRRFYSEHGVKLVIEGARSRESSGRAATPRIGENPLIPG
FT                   VIRVLPIKHWSRLLVQLYLISEGVELNPLYDEGFTRLGCILCPAMHPHELELSFSKHRE
FT                   WFTMLEERTGLTLRDIVEAFYSVKHVNGPGGI"
FT   gene            complement(111519..111592)
FT                   /locus_tag="Desmu_R0011"
FT   tRNA            complement(111519..111592)
FT                   /locus_tag="Desmu_R0011"
FT                   /product="tRNA-Ile"
FT   gene            complement(111669..112565)
FT                   /locus_tag="Desmu_0116"
FT   CDS_pept        complement(111669..112565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0977 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64435"
FT                   /db_xref="GOA:E8R702"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:E8R702"
FT                   /protein_id="ADV64435.1"
FT                   /translation="MSESVRVLFSNLWFPVKTGVVKGCIFIEKGRIGFIGEHPEPEHEL
FT                   SELQYDFQGYAMALHGFSTIVDVVEYPLRRLRVGDLSVLSRDELKTVAEVGLINAVSNG
FT                   ITMPIIHSDHSEAAVEAARELGVPLIVIHGGEARVHGGIHSFTLRNGRLYVDDKPLGPL
FT                   DDVLCSPLSTRSTCRIMDLRSAGSTPQPLAILHSAGVDAARLYRILTEPYRLIGAGEGY
FT                   VDRGETADLQVVDLRNPVKASIIRGEEDFWSTASRFTSPDLVLIHGEVVYEKGEYLIKP
FT                   LRSITGILGKLANRLSP"
FT   gene            112760..113344
FT                   /locus_tag="Desmu_0117"
FT   CDS_pept        112760..113344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0117"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG0558 Phosphatidylglycerophosphate synthase;
FT                   InterPro IPR000462; KEGG: dka:DKAM_0985 CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; SPTR: CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64436"
FT                   /db_xref="GOA:E8R703"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:E8R703"
FT                   /protein_id="ADV64436.1"
FT                   /translation="MLNKLRGRIVLVMERLAKPLVLLGVSPHALTVSSMLVLLVGVFVF
FT                   AYTSNTLLYLIFIAASSMLDALDGTVARVTGRTSRFGAFLDSTVDRVNDAAMIWSLSIL
FT                   GFNQTYIVLLLVSSMLVSYVRARGESLGAQLMGIGLIERPERILGIVLILLLYNASIHL
FT                   AEILLLILAILSAATVLQRILQVYRFLGTGD"
FT   sig_peptide     112760..112897
FT                   /locus_tag="Desmu_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            113406..114425
FT                   /locus_tag="Desmu_0118"
FT   CDS_pept        113406..114425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0118"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="KEGG: dka:DKAM_0984 phosphoesterase, RecJ domain
FT                   protein; SPTR: Phosphoesterase, RecJ domain protein; PFAM:
FT                   DHH family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64437"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E8R704"
FT                   /protein_id="ADV64437.1"
FT                   /translation="MSGSVKRVFVAGDWDADGVIAAALIVYSQEKAGQYPLESKAVVDK
FT                   TPLDPDRAKYFLANFKGGYDVAVFLDIPYSEHLGNAIKMMRNHFGVSKIIFVDHHVTSL
FT                   QKAKELQSIVDVALIDHRMPTAGLVLEELNRRGISVHQRLRSFVEVVKYMDTGRRVPDQ
FT                   YMKLFELTKMFSKALTVVRDEALWSKIVDWLATPTPMPMPLDEALWSKVKAVIEERDKE
FT                   VAEKAVELAVGAIKIGDFRFIDARNKWKKRGVTALASKLSTILKAPVILLAGTNREYFL
FT                   LVIKASHGRAYRIAKYLVGEGIALDIAGHPNLAIVRLPKDLEKQDLVDKLHHAIYYSS"
FT   gene            114558..115592
FT                   /locus_tag="Desmu_0119"
FT   CDS_pept        114558..115592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0119"
FT                   /product="histone deacetylase superfamily"
FT                   /note="COGs: COG0123 Deacetylase including yeast histone
FT                   deacetylase and acetoin utilization protein; InterPro
FT                   IPR000286; KEGG: dka:DKAM_0983 histone deacetylase
FT                   superfamily; PFAM: histone deacetylase superfamily; SPTR:
FT                   Histone deacetylase superfamily; PFAM: Histone deacetylase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64438"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:E8R705"
FT                   /protein_id="ADV64438.1"
FT                   /translation="MVRVIVSARSAYMHRPVGYHPENPGRIPRIVESLRRSSIDYEWLE
FT                   SSVLNTREALEIATRIHSRSYVGKILEMAGRAPLNIDEDTYISKDSVELALETLGESYR
FT                   LALQQGNGVVFYIARPPGHHAGVRGRATGARTQGFCIFNNAVAAVKGFMDRGLGKVAVL
FT                   DFDAHYGNGSMEILYGARVLQVDLHQDTRTIPVFPLLPGSVGSGEGYGFKVGIPLEPGT
FT                   GDDSYVEVLEAVWRVIERYNPEAFVVSAGFDGFRGDGLTDLVLTEYTFHRLGEMIRGLG
FT                   VPTVVVLEGGYSSGLDKGVAAFIKGLKGVAAGYKPARTVHRVVRRVNLERAISIISWVE
FT                   KHVY"
FT   gene            115589..116197
FT                   /locus_tag="Desmu_0120"
FT   CDS_pept        115589..116197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0120"
FT                   /product="adenylyl cyclase CyaB"
FT                   /note="COGs: COG1437 Adenylate cyclase class 2
FT                   (thermophilic); InterPro IPR008173: IPR008172; KEGG:
FT                   dka:DKAM_0982 putative adenylyl cyclase CyaB; PFAM:
FT                   adenylate cyclase; SPTR: Putative adenylyl cyclase CyaB;
FT                   TIGRFAM: adenylyl cyclase CyaB; PFAM: CYTH domain; TIGRFAM:
FT                   adenylyl cyclase CyaB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64439"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:E8R706"
FT                   /protein_id="ADV64439.1"
FT                   /translation="MRRLRAVSHGLQVETEVKLRITGDPGIVEENLLSHGFIKVDECVE
FT                   RDIYFKHPCRDLSLSDEAVRLRYRSCRNSGEHLVLTYKGPRISREGVLKARMEVEARLQ
FT                   PGEIHSMVKLLEYIGFPKLASFTKKRFIFHKDGLEATIDELMGVGFFLEVELKKPDAVK
FT                   ALQDLLRGLSNVTVMVKETYLEICLETGRCIDEQGSFPT"
FT   gene            116357..117004
FT                   /locus_tag="Desmu_0121"
FT   CDS_pept        116357..117004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0121"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="InterPro IPR013343; KEGG: dka:DKAM_0981
FT                   CRISPR-associated protein Cas4; SPTR: CRISPR-associated
FT                   protein Cas4; TIGRFAM: CRISPR-associated protein Cas4;
FT                   PFAM: Domain of unknown function DUF83; TIGRFAM:
FT                   CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64440"
FT                   /db_xref="GOA:E8R707"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:E8R707"
FT                   /protein_id="ADV64440.1"
FT                   /translation="MYRASSLVTEALYRRVIGEHMARMGELRDGSTIYVTDLVACSHKY
FT                   HMRRKYPELTIGFEPSMVLGELLHKGLEEVLKGEGYEVEKSVEVPVEIDGARYIVKGRV
FT                   DAYNPGTRTVVEIKSSRTSRGIPKPHHVEQLNIYLNIMDVESGILVYVTSDKIVEYVIP
FT                   RERVDVTGLVRNTLGNLVHPRYEWECEYCVFRRLCPYAREEGEKLYTDTGRK"
FT   gene            complement(117078..118313)
FT                   /locus_tag="Desmu_0122"
FT   CDS_pept        complement(117078..118313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0122"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: dka:DKAM_0980 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64441"
FT                   /db_xref="GOA:E8R708"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8R708"
FT                   /protein_id="ADV64441.1"
FT                   /translation="MESVANGFRELRNVLSGNVLVMAISWFLYGLSGALVQPFFSLYAK
FT                   SLGAGDLEIAVVKSIGMVVLGVFTVVGGLLTDRVGRVKMILAGTLLVSLTQFAYALVGS
FT                   WSQLAVVWVIDEAAHFYQPALTAIIMDSIPSRKELKGFIALNVFPSIPWLFMPVIGGRL
FT                   YDIYGVQGIRYGFLVSGVLSLMVLLLRARALKETLTVANRGGFNLVKDLTELFRFKMMK
FT                   HVILIYLFTGFIAPLASSVWNTYGSIYSVRILGVSNTEWGIVSTVGTASSIIASLILAS
FT                   VISENYVAVMVTTSVLSAASYLFFASPTLMGVSPMTALVAGSVSGAIGGALMGPVISAM
FT                   LTRILPVELRGRAAGIQRFIENMGWALASYIGGLLYVWLGAVGSLLASSVLSVAAFIYL
FT                   YLVFRSLRTLLN"
FT   sig_peptide     complement(118215..118313)
FT                   /locus_tag="Desmu_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            118452..119972
FT                   /locus_tag="Desmu_0123"
FT   CDS_pept        118452..119972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0123"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG2182 Maltose-binding periplasmic
FT                   protein/domains; InterPro IPR006059; KEGG: dka:DKAM_0405
FT                   cyclomaltodextrin binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: Cyclomaltodextrin
FT                   binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64442"
FT                   /db_xref="GOA:E8R709"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8R709"
FT                   /protein_id="ADV64442.1"
FT                   /translation="MSQALTKTQALILVFLIIVAVAGVFIAMQWLSSSQSSTTTTPPLT
FT                   TTTTTGTTTTTATTTTTTPAGNTIVIGSTVIHVSSEFKQFVEDAKAGRVSVKIYFGHAL
FT                   TENERKAFQDIISMFKNEYPGIEVVEVAYSGMDVLKSQISAIATLSPEQRSNYIGKVPD
FT                   LFTWAHDWIGSFADKGYILPLEEVLSSDTIINDIAPNLLPIALSAVTYNLKTYGLPYAG
FT                   ETIALIVNKNLVPNPPASFDEMLQVMKSFTNRNTGSYGLSYQADPYHLYPFVTAFGGYY
FT                   YDEATKSIGVNSTGTKQGIKFYIQNVLPYVDVSDLGLTYQTNLFLNGKTPMMITGPWNI
FT                   ATINKSLGLSNIAIAPLPNIGDKVPKPFSGYRGIYITLMANVGGRERLYASVLFTLYVA
FT                   LNDNALKILVDKNNYVPVKNTMITYIQENKDKYPIVYGFLTQLMRSVPMPKDPMMDKVW
FT                   NVGTYINAILGKYSEALQSGKTVDQAVAETLSVVDQQLDEAYASIVGK"
FT   sig_peptide     118452..118559
FT                   /locus_tag="Desmu_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            120066..121511
FT                   /locus_tag="Desmu_0124"
FT   CDS_pept        120066..121511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0124"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   tag:Tagg_1305 binding-protein-dependent transporter inner
FT                   membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64443"
FT                   /db_xref="GOA:E8R710"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R710"
FT                   /protein_id="ADV64443.1"
FT                   /translation="MSSRRHLYPARIGFLMAIASIVLYFFFNIWPLAFSIGMAFTNARE
FT                   DNLFVAPEVMRNYDNAIACASFMKTNVTLSLAVSRVFADIADTMDRLSSSTSALMSLVN
FT                   KSQNPSEDPMVLLGIQSLYAESLRLRTIPGTVNSVLNCSSYGFATSKSLIEPRILDDLN
FT                   NIYNVVSEISSYYASMSRDSLLSRLSQILELSKGASTYFRNMSSDFQGYLDNYIESVRG
FT                   EKESKMLRFIGLDNFARLFTDPRFYYSLYKTTVFVATSVPLKLLLGIGLAFFYSTPLIY
FT                   GRRVLRGLALAPWALPLLLSGLTWRFLFSPSGQLGRLFGIQLFTDEWQAFLVYNLFEAW
FT                   LAYPFIMTVTMGALSGVSREVIEASYIDGASLWQRLRHVVLPLVSKPLMLAAILTTGAS
FT                   LQAFMVPLLLNGGGPTRVITVPYFGSKTGNVNEMIILFGYNRAITDKEWGYAAATYLIV
FT                   VLIIMVYVAVWMYVSRRGGKSGL"
FT   sig_peptide     120066..120188
FT                   /locus_tag="Desmu_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            121501..122352
FT                   /locus_tag="Desmu_0125"
FT   CDS_pept        121501..122352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG3833 ABC-type maltose transport systems
FT                   permease component; InterPro IPR000515; KEGG: tag:Tagg_1304
FT                   binding-protein-dependent transporter inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64444"
FT                   /db_xref="GOA:E8R711"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R711"
FT                   /protein_id="ADV64444.1"
FT                   /translation="MASKVMWLVFRVSLTVAGFLVLFALLYPVFFIVLQSFYSKPSLIE
FT                   DPVKALGMLTIENYVRAVASPEFASAIQMSLLISLLTVLVSVVVITPAAYAFSRFHFKG
FT                   RDMVLYIYLILSQAGGGFGVVAVIALLMFLLVLSSYGVPAYGWHVLPLIYSAGLVPFQT
FT                   WLLKSYFDNLPRELDEAAFIDGADWGTIIYRIVLPSSRPAVIIITLFAFMSAWGEFFIA
FT                   NLLRVNTIGAYIYMTAFGERGLQDPSVYAALSLIYAFPIIVIYMVAQRYMGEAYRLGIV
FT                   KG"
FT   sig_peptide     121501..121572
FT                   /locus_tag="Desmu_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(122533..123402)
FT                   /locus_tag="Desmu_0126"
FT   CDS_pept        complement(122533..123402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0126"
FT                   /product="Transcription factor TFIIB cyclin-related
FT                   protein"
FT                   /note="COGs: COG1405 Transcription initiation factor TFIIIB
FT                   Brf1 subunit/Transcription initiation factor TFIIB;
FT                   InterPro IPR013137: IPR006670: IPR000812: IPR013150; KEGG:
FT                   dka:DKAM_0922 transcription initiation factor TFIIIB; PFAM:
FT                   Transcription factor TFIIB cyclin-related; SPTR:
FT                   Transcription initiation factor TFIIIB; PFAM: TFIIB
FT                   zinc-binding; Transcription factor TFIIB repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64445"
FT                   /db_xref="GOA:E8R712"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:E8R712"
FT                   /protein_id="ADV64445.1"
FT                   /translation="MRCPHCGRDTVIFDSDSNTYVCQVCGAVVDERPAYQGTEGFPKNN
FT                   TTPRNSGALTHRVHDHGVGGTEIAGSFKAHLRRGRSWVRANSEIKVDKRDRKLKKALQW
FT                   LNEYLKLLDPPTPVRETAALLVREAVKDKNFKENTVRKIIVAAIYLSYKINKQPRSAKV
FT                   FCSELNIEDGYLWEGIRLIREAVKDVKLTHEHYDPRYYIGFITHRLNAPPVVETLANSI
FT                   ASSAESYGFLSGKNPASLAAASVYLAGIISNNKRNQLEVAETIGLTDVAIRNAYDSILR
FT                   NLDIDVLL"
FT   gene            complement(123399..123662)
FT                   /locus_tag="Desmu_0127"
FT   CDS_pept        complement(123399..123662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0923 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Gar1/Naf1 RNA
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64446"
FT                   /db_xref="GOA:E8R713"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:E8R713"
FT                   /protein_id="ADV64446.1"
FT                   /translation="MNKLGIVEASTRDGFIVVKPVSRDVLKLVNSSVYDDNYRRIGRVV
FT                   DVIGRVDDPRVIVKLENKAFKPSPVLYYHLAEKKRGRGGRKR"
FT   gene            complement(123836..124135)
FT                   /locus_tag="Desmu_0128"
FT   CDS_pept        complement(123836..124135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0128"
FT                   /product="signal recognition particle, subunit SRP19
FT                   (srp19)"
FT                   /note="COGs: COG1400 Signal recognition particle 19 kDa
FT                   protein; InterPro IPR002778; KEGG: dka:DKAM_0925 signal
FT                   recognition particle protein SRP19; PFAM: Ribonucleoprotein
FT                   complex SRP, Srp19 component; SPTR: Signal recognition
FT                   particle 19 kDa protein; PFAM: SRP19 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64447"
FT                   /db_xref="GOA:E8R714"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/TrEMBL:E8R714"
FT                   /protein_id="ADV64447.1"
FT                   /translation="MSREYKGRKIVVYPSYIDSKKSRREGRKIRLSDAVPNPGIDEILE
FT                   ACRRLGLNPVHEEKQYPRIHGLRGRVLVDKKMSKLSTLIAVAREIKRMRGDTRS"
FT   gene            complement(124168..124557)
FT                   /locus_tag="Desmu_0129"
FT   CDS_pept        complement(124168..124557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0129"
FT                   /product="SSU ribosomal protein S8E"
FT                   /note="COGs: COG2007 Ribosomal protein S8E; InterPro
FT                   IPR018283: IPR020919: IPR001047; KEGG: dka:DKAM_0926 30S
FT                   ribosomal protein S8e; SPTR: 30S ribosomal protein S8e;
FT                   TIGRFAM: ribosomal protein S8e; PFAM: Ribosomal protein
FT                   S8e; TIGRFAM: ribosomal protein S8.e"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64448"
FT                   /db_xref="GOA:E8R715"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:E8R715"
FT                   /protein_id="ADV64448.1"
FT                   /translation="MSYYQGNDLRKPSGGLKGEKRGKRKHELGSPPTNTTLSNSEEKVF
FT                   VRTLGGNMKVKLKKALYINVALPGEKTAKKVKILDVVETPSNPQNTRFKIISKGTVVKT
FT                   ELGLVKVTSRPGQHGVLNGVLVEKK"
FT   gene            complement(124683..125249)
FT                   /locus_tag="Desmu_0130"
FT   CDS_pept        complement(124683..125249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0130"
FT                   /product="Chromate transporter"
FT                   /note="COGs: COG2059 Chromate transport protein ChrA;
FT                   InterPro IPR003370; KEGG: dka:DKAM_0931 chromate
FT                   transporter; PFAM: Chromate transporter; SPTR: Chromate
FT                   transporter; PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64449"
FT                   /db_xref="GOA:E8R716"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:E8R716"
FT                   /protein_id="ADV64449.1"
FT                   /translation="MAASGVSLTELFVEFLKIGFFMFGGGYGGIALMYKELVEIKKWVS
FT                   EEEFLELLGVAESTPGPIAINSATWIGYSLGGLPGSIIATIGVVMPAYLVIMAIVTSLK
FT                   PYMGSDAVKIMFRGINAAVVALILYALIKVARSVLIASGGALNLVAVAIFVTAFILLYV
FT                   GDQHPIVVILVSAAVSLLLKYGLGI"
FT   gene            125356..126756
FT                   /locus_tag="Desmu_0131"
FT   CDS_pept        125356..126756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0131"
FT                   /product="CoA-binding domain protein"
FT                   /note="COGs: COG1042 Acyl-CoA synthetase (NDP forming);
FT                   InterPro IPR003781; KEGG: dka:DKAM_0930 AcdA-1 acetate--coA
FT                   ligase (ADP-forming), alpha chain; PFAM: CoA-binding domain
FT                   protein; SPTR: AcdA-1 acetate--coA ligase (ADP-forming),
FT                   alpha chain; PFAM: CoA binding domain; TIGRFAM: acetyl
FT                   coenzyme A synthetase (ADP forming), alpha domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64450"
FT                   /db_xref="GOA:E8R717"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R717"
FT                   /protein_id="ADV64450.1"
FT                   /translation="MSAITRFFNPSSVAVIGATPREGKVGRVILENFTKRYRGRVYPVN
FT                   PGYDEILGLKCYRSIRDLPEAPDLAVIAIPAPGVPEVLRELGEKGCKAAIIISGGFRET
FT                   GTPEGERLENEVKEIALKYGIRIIGPNCIGIYDSWSGVDTFFLPEEKMKRPPKGYVAFI
FT                   SQSGAFASALMDWMAYNNIGVSRAVSYGNKVDVDDVDILEYLASDEKTRVILIYLEGLK
FT                   DGRGRAFLEAARKVSTVKPVLIFKAGKTGRGSLAAASHTAALAGDYSVYKSAFKQAGIV
FT                   EVESFDEMMDAVRILLDQPLMNGNRVYIITDAGGVGVMLTDALTSQGFELPRTPPDLRE
FT                   ELRRVLPPHCIVENPIDLTGDTDDERYMKVLEKVLPRGDVDAVVVVALPQVPGIKGSLV
FT                   EYLIEAKKKYGKPIIAVSIGGEEAVKIARRLQENGITVFESPERAAKALKVLYTYSRIK
FT                   MKTTRDRG"
FT   gene            126762..127460
FT                   /locus_tag="Desmu_0132"
FT   CDS_pept        126762..127460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0132"
FT                   /product="acetyl-CoA synthetase (ADP-forming) beta subunit"
FT                   /EC_number="6.2.1.-"
FT                   /EC_number="6.2.1.13"
FT                   /note="COGs: COG1042 Acyl-CoA synthetase (NDP forming);
FT                   InterPro IPR011761: IPR013650; KEGG: dka:DKAM_0929 AcdB
FT                   acetate--coA ligase (ADP-forming), beta chain; PFAM:
FT                   ATP-grasp domain protein; SPTR: AcdB acetate--coA ligase
FT                   (ADP-forming), beta chain; PFAM: ATP-grasp domain;
FT                   branched-chain acyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64451"
FT                   /db_xref="GOA:E8R718"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E8R718"
FT                   /protein_id="ADV64451.1"
FT                   /translation="MTPRDIIINALKEGRYKLLEHEAFQLIKHYGIPSPEVVVVKSPEE
FT                   AVALADKVGYPIALKIVSPDISHKSDVGGVKLGLRSREEVGKAVKEMLETVPRRAPSAR
FT                   IVGVLMYNMAPQGLEVIIGGVRDSVFGPVVMFGLGGIFVEVLKDVSFRVSPVSKEDALT
FT                   MLKEIKSASILEGYRGQPPVDKDAIAEMIVKTARLMEDNPEIESIDLNPVMAYSKGAIA
FT                   VDARIILKHS"
FT   gene            127472..128377
FT                   /locus_tag="Desmu_0133"
FT   CDS_pept        127472..128377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0928 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3584)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64452"
FT                   /db_xref="InterPro:IPR021979"
FT                   /db_xref="UniProtKB/TrEMBL:E8R719"
FT                   /protein_id="ADV64452.1"
FT                   /translation="MSSTPIEELQREIENATTQIGEIREKIRLLKDQRFKLIGELKTER
FT                   GEKQKYLNDIRVLKERLRKIKEERRQLIEEYRRLAEERRSKIEELKALREVLAEKKNTI
FT                   QSMSKEARTPSNILRGEIERLEWILQTRVLSIEEENRIIQKIKRLTALLEKAEKLRKER
FT                   NEVLEIRAFYSSLKIQVRDLSGKLQSLREKIGKLTDERDRLKQQLEEVVKKYQGLKNSI
FT                   EAKQNTVNEVSKEIEELSARLEELREKVNNLNRELEKAKLGMMLNAKKQEILEKKQDKK
FT                   RLTIDELKIIYGEPEDFLEE"
FT   gene            complement(128478..129320)
FT                   /locus_tag="Desmu_0134"
FT   CDS_pept        complement(128478..129320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0134"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="COGs: COG0020 Undecaprenyl pyrophosphate synthase;
FT                   InterPro IPR018520: IPR001441; KEGG: dka:DKAM_0927
FT                   undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase; PRIAM:
FT                   Di-trans,poly-cis-decaprenylcistransferase; SPTR:
FT                   Undecaprenyl diphosphate synthase; TIGRFAM: undecaprenyl
FT                   diphosphate synthase; PFAM: Putative undecaprenyl
FT                   diphosphate synthase; TIGRFAM: undecaprenyl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64453"
FT                   /db_xref="GOA:E8R720"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:E8R720"
FT                   /protein_id="ADV64453.1"
FT                   /translation="MERGVLMPREGSIRGTLTAIFYRLGMKALQPLYEVYEKWLWMQIR
FT                   GGPFPRHIGIIPDGNRRWARRLGFDPSLGHIYGYERMKEVLKWIWDLGIRYVTIYAMST
FT                   ENCKYRSNGEREHLFNLARKGLRELRELRDIHERKVRVKVFGTLDLVPSDIVELAKELE
FT                   KETEKYDSYQLNIALCYGGRQEILDAVKAVVRDVIDGKITVDDISEEAFSKYLYTSEAP
FT                   DPDLIIRTSGEERISNFLLWQSAYSELYFCDVYWPEFRKIDFWRAIRSYQMRERRFGR"
FT   gene            complement(129544..130236)
FT                   /locus_tag="Desmu_0135"
FT   CDS_pept        complement(129544..130236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0932 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64454"
FT                   /db_xref="InterPro:IPR041461"
FT                   /db_xref="UniProtKB/TrEMBL:E8R721"
FT                   /protein_id="ADV64454.1"
FT                   /translation="MPSLTVDKIDEYLGKPVNDPYGRRVGYIIGFYSDADGNVTSLEIS
FT                   FNEFGFKQVTVDMFRFENGSIILLPEWEYTAILLENRLERVKKRVAALEELNSKKEIPV
FT                   HTYEEFKKKLDESLIKLKEEAKGVKEELRKRIHEIEDMIVELEKAITAVKVSYISGEIP
FT                   EKAYKASMDHLRRNLDILNSEKASVKKHLDKIEALENLPVDAAVKVSVAGETPSKSSQP
FT                   MQVVVVES"
FT   gene            complement(130307..130834)
FT                   /locus_tag="Desmu_0136"
FT   CDS_pept        complement(130307..130834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0796 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64455"
FT                   /db_xref="UniProtKB/TrEMBL:E8R722"
FT                   /protein_id="ADV64455.1"
FT                   /translation="MPTIKTRVVTILYLLIQGARLKQHPGNMYREVWVLDKWSIPFKEG
FT                   CLEVRRKGDSLEVRGGNFTIELRPRVISVDGSTGISIEGIYGSRRKVIYIRYEGIKTLD
FT                   HCNEKIEEVDLGDYIVKSTYLFTGSYITIITPGYLLVDYVVITDDSAAVVVQGKRSTYF
FT                   EESGRRVTIYVV"
FT   sig_peptide     complement(130772..130834)
FT                   /locus_tag="Desmu_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            130996..131868
FT                   /locus_tag="Desmu_0137"
FT   CDS_pept        130996..131868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0797 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64456"
FT                   /db_xref="UniProtKB/TrEMBL:E8R723"
FT                   /protein_id="ADV64456.1"
FT                   /translation="MQFICKASSAYCYMVDSMLKALGLTPLRTTGGEQPVGNIVFYAGR
FT                   IDGELEGFLNSVAGHGLRVIIGVEHGGVVEKRVLKKIINIRRAGLEILVTASTMKDYRV
FT                   LREEMPDVNVVYIPLHAPGSSVMRDLLPSDGGIATHSDECGRIVEVAGELEAVGFNPLI
FT                   VNFSEKECSASSPWVINVATDSVFNLSSRIVIGVILDESASSYMVFDALYRNSRPLIVC
FT                   SDMDIPVDSQMVIKTGRCSVDELASTIISLFSRIEYYRRIGSERPASTVAGRGMDALKE
FT                   FIDGMRRQV"
FT   gene            complement(131872..132096)
FT                   /locus_tag="Desmu_0138"
FT   CDS_pept        complement(131872..132096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0798 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64457"
FT                   /db_xref="UniProtKB/TrEMBL:E8R724"
FT                   /protein_id="ADV64457.1"
FT                   /translation="MPKTVSVLLRRELLKRDLELLDIYRFSDREVVRIKDRVSGKVMVH
FT                   VLKTRLPSILSQEDLARIASEIASTVRSR"
FT   gene            132361..133119
FT                   /locus_tag="Desmu_0139"
FT   CDS_pept        132361..133119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0139"
FT                   /product="diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /note="COGs: COG1798 Diphthamide biosynthesis
FT                   methyltransferase; InterPro IPR004551: IPR000878; KEGG:
FT                   dka:DKAM_1445 probable diphthine synthase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; PRIAM: Diphthine synthase; SPTR:
FT                   Probable diphthine synthase; TIGRFAM: diphthine synthase;
FT                   PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases; TIGRFAM:
FT                   diphthine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64458"
FT                   /db_xref="GOA:E8R725"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E8R725"
FT                   /protein_id="ADV64458.1"
FT                   /translation="MLAFIGIGYSRRHLTQESLELLRSAEKIYIDTYTSMYEDGYEWIR
FT                   DVNPSAEIIVARRRDLEGDAITRIVEESVRKNVAIVCAGDPFTATTHDAIRVEALKRGV
FT                   EVRVATGISIVSLVHSRIGLQAYRFGKIVTLVYPDNFKPYSVVETIYDNLSRNLHTLIL
FT                   LDLRLEEGVAMTIPEAVEILGGLDDKGLILDQVGVAVARLGWSSELVKAGRVRELGKHR
FT                   YPPPPHSLIITAKLHPVELESLRYIAGLQL"
FT   gene            133215..134264
FT                   /locus_tag="Desmu_0140"
FT   CDS_pept        133215..134264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0140"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR022272:
FT                   IPR002491; KEGG: dka:DKAM_1448 iron compound ABC-type
FT                   transporter, periplasmic component; PFAM: periplasmic
FT                   binding protein; SPTR: Iron compound ABC-type transporter,
FT                   periplasmic component; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64459"
FT                   /db_xref="GOA:E8R726"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E8R726"
FT                   /protein_id="ADV64459.1"
FT                   /translation="MSKQIALAYMAIVVLAISLVTPASAGVTLQDSTGRTISITETPRR
FT                   IVSLSPSITETLAYLGGLDTVVGADSLSLSDEWFNISTILRARNVTDVGGYWWSAIRSE
FT                   EILAASPDLVLAEKGAHIPLLDFFKNYNVTVVYLEGGASRSIQDVLSDMYTVALILNKT
FT                   SLLAEFSGKLEAEFQKYRELVAERYKGVSILFVIDLTGGIWVAGKGTYIDDIVERLGLV
FT                   NACRDIYSWTSISLEKAVELNPDVIVVASMGGINISIRLLDESGLTRLGKPIVVLNQSE
FT                   TDILMRPGPLLLYAPQVVYNALSRANITGGAAESGSQGMTLNGLLAATVVIVAAVIVAV
FT                   VVLVVFKRR"
FT   sig_peptide     133215..133289
FT                   /locus_tag="Desmu_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            134261..135196
FT                   /locus_tag="Desmu_0141"
FT   CDS_pept        134261..135196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0141"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   dka:DKAM_1447 iron compound ABC transporter, permease
FT                   protein; PFAM: transport system permease protein; SPTR:
FT                   Iron compound ABC transporter, permease protein; PFAM:
FT                   FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64460"
FT                   /db_xref="GOA:E8R727"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E8R727"
FT                   /protein_id="ADV64460.1"
FT                   /translation="MRKAASSLFIVFSASTILLLVFMDFNGIQRVPALLDYRFNRVLSA
FT                   LLSGAIIGLAGVLLQSSLRNPLVDHYVIGVGSGALVFTYIFILWTGGYTLNASFFSMLG
FT                   GFTAMVLTILLAEKLSGSATSYILAGIGMNSVFSGLSILLSYVAVREYPYVHALLVGSF
FT                   IVATAEKTQVLLIVLAVSLLTVFLIAKPLNTLEVSDEFSMVAGFNPRLTRLASVVLAGA
FT                   STSIVTSMYGLIGFIGLVTPHIARYVSGTSDNRVVAPLAMLTSSAVLYLTDFISRRLFA
FT                   VMWGEVPAGAVASLIGAPIFIYLLVSRRGA"
FT   sig_peptide     134261..134359
FT                   /locus_tag="Desmu_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            135198..135947
FT                   /locus_tag="Desmu_0142"
FT   CDS_pept        135198..135947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0142"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: dka:DKAM_1446 iron compound ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Iron compound ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64461"
FT                   /db_xref="GOA:E8R728"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R728"
FT                   /protein_id="ADV64461.1"
FT                   /translation="MLRGKDVVVEYRGGLKALWKASFQIPGNKVTCLMGPNASGKTTLL
FT                   RAVARLVEYRGSILIDGLEASRMPLAVLSKILSYGSPTSVSTSLSLRVREILEMALYPL
FT                   KNIDVEKAVEEASMELDITMLLDRYVGELSSGELQRVVIASALVKNPRYLLLDEPDAHV
FT                   DVGFKPVLSRVLRRRAASSTIVVATHDPVFASCTCDHVIVLRSGSIVFEGGFDELLENL
FT                   GVLEETYGVGFTVSNAPNGRRIILPYY"
FT   gene            136156..136725
FT                   /locus_tag="Desmu_0143"
FT   CDS_pept        136156..136725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0143"
FT                   /product="isochorismatase hydrolase"
FT                   /note="COGs: COG1335 Amidase related to nicotinamidase;
FT                   InterPro IPR003881: IPR000868; KEGG: dka:DKAM_1450
FT                   isochorismatase hydrolase; PFAM: isochorismatase hydrolase;
FT                   SPTR: Isochorismatase hydrolase; PFAM: Isochorismatase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64462"
FT                   /db_xref="GOA:E8R729"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E8R729"
FT                   /protein_id="ADV64462.1"
FT                   /translation="MRPALLIVDMLKEFVHGRLKSPEATQIIPAISRIASIARSKGIPV
FT                   IYLADHHYPFDHELSIWGPHAMQGDPESDIIDELKPGPGDIVLYKRSYSGFRETGLDYI
FT                   LRDLGVDTVILTGIHTHICVLHTAIDAFYNRYKIIVVEDAVSAFNKGDHEWALNYMRTV
FT                   LGSTILSSREVVSLLEGGAVVKNDRL"
FT   gene            136712..137299
FT                   /locus_tag="Desmu_0144"
FT   CDS_pept        136712..137299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1449 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64463"
FT                   /db_xref="UniProtKB/TrEMBL:E8R730"
FT                   /protein_id="ADV64463.1"
FT                   /translation="MIDCRLLGSLRNLSAESGFTGVEIVAVILGVFKEGYGRVAVSRKT
FT                   GIGERRIRNVYEYLNTLKTIKPGVYEAVVGGLVNSLVETDTAGEYHATVVSPVDPGLLR
FT                   AVESRVVELRDWIIVETRSRDCIEVIGVVDKGVSFPRLPPDLVVKYAGILPGHARVNYS
FT                   IVILWRKYIPILYESAVLSALANMCVSEEPAL"
FT   gene            137425..137694
FT                   /locus_tag="Desmu_0145"
FT   CDS_pept        137425..137694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0145"
FT                   /product="protein of unknown function DUF504"
FT                   /note="InterPro IPR007547; KEGG: dka:DKAM_1452 protein of
FT                   unknown function DUF504; PFAM: protein of unknown function
FT                   DUF504; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF504)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64464"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/TrEMBL:E8R731"
FT                   /protein_id="ADV64464.1"
FT                   /translation="MGRRRGELENWLRRIVFGGRRSDYTVYVRFRTENGEVLKPIPGSL
FT                   IEDFRGGYIYTRDEVIPLHRVEEIRDSHDTLVYRRSDAGKKHSL"
FT   gene            complement(137691..138971)
FT                   /locus_tag="Desmu_0146"
FT   CDS_pept        complement(137691..138971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0146"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /EC_number="1.4.1.4"
FT                   /note="COGs: COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase; InterPro IPR006095: IPR014362: IPR006097:
FT                   IPR006096; KEGG: dka:DKAM_1451 Glu/Leu/Phe/Val
FT                   dehydrogenase, C terminal; PFAM: Glu/Leu/Phe/Val
FT                   dehydrogenase; Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; SPTR: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   PFAM: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64465"
FT                   /db_xref="GOA:E8R732"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R732"
FT                   /protein_id="ADV64465.1"
FT                   /translation="MHEYASLYENDPVYQMAVKQLREAASLLGLPDEVVEVLRHPEKLV
FT                   QVKITIRRDNGKLETYLGWRSQHNSALGPYKGGVRYGEDVTPGEVVALSMWMTWKTSLA
FT                   GIPYGGGKGGVRVNPKALSQRELEELSRKFFAGIAKDVGPDVDIPAPDVYTNPQTMAWY
FT                   FDEYSKIVGYQAWGVVTAKPVELGGLYARVVSTGYGVALTAREAAKKWIGGLEGKTVAV
FT                   HGFGNVGMYAAKYLAEWGARVVAVSDSSGYIYDPKGLDVEEAIRVKETTGKVTNYKKGD
FT                   VKVSANHMELLELPVDILVPAATQDVITKENVNKIKAKVISEGANGPTTPEAEKILHEK
FT                   GVIIVPDILANSGGVTMSWIEWSHNRMGCWLTDEEALSRLDKMMSVNFERVFNDWRKRF
FT                   STHPMRTAAYAIAVDRVVKAMKLRGWI"
FT   gene            139122..139358
FT                   /locus_tag="Desmu_0147"
FT   CDS_pept        139122..139358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1453 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64466"
FT                   /db_xref="GOA:E8R733"
FT                   /db_xref="UniProtKB/TrEMBL:E8R733"
FT                   /protein_id="ADV64466.1"
FT                   /translation="MSRKRIAGALLISGTVVLATLYTYLVFFTPISIQATVLKLTVYVF
FT                   VMVLLLSLFIVGYTLFKTNFFPPEEVERELSKE"
FT   sig_peptide     139122..139226
FT                   /locus_tag="Desmu_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(139395..140498)
FT                   /locus_tag="Desmu_0148"
FT   CDS_pept        complement(139395..140498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0148"
FT                   /product="Polyprenyl synthetase"
FT                   /note="COGs: COG0142 Geranylgeranyl pyrophosphate synthase;
FT                   InterPro IPR000092; KEGG: dka:DKAM_1455 polyprenyl
FT                   synthetase; PFAM: Polyprenyl synthetase; SPTR: Polyprenyl
FT                   synthetase; PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64467"
FT                   /db_xref="GOA:E8R734"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E8R734"
FT                   /protein_id="ADV64467.1"
FT                   /translation="MSQGIDYSELLNYAVRIVEDNLRAVFSRIREEASSISPLTLDAVE
FT                   IASDYTLRGGKRLRAFLTLVGYWSKEWGSGDPSLITSLMTGIELLQSYLLVHDDVMDRD
FT                   EIRRGGPTVHSWFRDKCIREFKTGDCTHYGDSQAITVGDFLEATAVEYVSRAGINGEVL
FT                   SKLLGTYAAGLRKVAYGQYLDVLFSYRSLHEVSERDVLLVHRLKTASYTIELPLHMGAI
FT                   ASGKYNERLLGELSSYAIPAGIAFQLRDDIIGLYGDPRQTGKPVGSDVKERKKTLLVVK
FT                   AYELGSEEVKRRLSEIYDAPGTDVTLDHVKYVQDVVRETGSLEYSEMLIRRYVDEAAKV
FT                   LEDSREMSKQAADVLKWLLVKLAYREK"
FT   gene            140658..141311
FT                   /locus_tag="Desmu_0149"
FT   CDS_pept        140658..141311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0149"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /note="COGs: COG0269 3-hexulose-6-phosphate synthase and
FT                   related protein; InterPro IPR001754; KEGG: dka:DKAM_1456
FT                   hexulose-6-phosphate synthase; PFAM: Orotidine 5'-phosphate
FT                   decarboxylase; SPTR: Hexulose-6-phosphate synthase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase / HUMPS family;
FT                   TIGRFAM: 3-hexulose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64468"
FT                   /db_xref="GOA:E8R735"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8R735"
FT                   /protein_id="ADV64468.1"
FT                   /translation="MDRILQVALDLTKLPEAVEIATKIASHTSCRNIWLEVGTPLLKAW
FT                   GLIAVKAVKNLSNCFVVVDTKTMDVPAIEGGMLLDAGGDAFTVLGVADDDVVKEAVETA
FT                   RARGKLVVADLISHPDPLKRAVELDRLGVDVVLYHVGISVQRSRRVTVAQLLREIEGLR
FT                   RNVSARIAVAGGIKPGDVKGLIASGADIVVVGGAITKAENPVQVVERILEEMNT"
FT   gene            141344..142111
FT                   /locus_tag="Desmu_0150"
FT   CDS_pept        141344..142111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0150"
FT                   /product="ribonuclease HII"
FT                   /note="COGs: COG0164 Ribonuclease HII; InterPro IPR004649:
FT                   IPR001352; KEGG: dka:DKAM_0016 ribonuclease HII; PFAM:
FT                   ribonuclease HII/HIII; SPTR: Ribonuclease; TIGRFAM:
FT                   ribonuclease HII; PFAM: Ribonuclease HII; TIGRFAM:
FT                   ribonuclease H, mammalian HI/archaeal HII subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64469"
FT                   /db_xref="GOA:E8R736"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8R736"
FT                   /protein_id="ADV64469.1"
FT                   /translation="MSAGDTIEIGVDEAGRGPFVGDMVIVGVIGPSRVFESLVSIGLKD
FT                   SKALEPVARRELFWEILSSNVDIVAWLVSPFTIDRGNMNELEYIRICRILKLLSYSRLA
FT                   RSKPGNSLRIYVDEVKGYGESVRECAMRIYGEHVEVVMEPEADARYPAVSAASVIAKVI
FT                   RDRNIDVLGKITGGLGSGYPSDPASRAWLATIYGRWDKPPVFIRRSWGIVRDIAPGWHI
FT                   VKHVKHGRRRSRSLLDFMEGSRHGDESTGRGQG"
FT   gene            142077..143237
FT                   /locus_tag="Desmu_0151"
FT   CDS_pept        142077..143237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0151"
FT                   /product="small GTP-binding protein"
FT                   /note="COGs: COG1163 GTPase; InterPro IPR005225: IPR006073:
FT                   IPR002917: IPR004095; KEGG: dka:DKAM_0015 GTP-binding
FT                   protein; PFAM: TGS domain-containing protein; GTP-binding
FT                   protein HSR1-related; SPTR: GTP-binding protein; TIGRFAM:
FT                   small GTP-binding protein; PFAM: GTPase of unknown
FT                   function; TGS domain; TIGRFAM: small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64470"
FT                   /db_xref="GOA:E8R737"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:E8R737"
FT                   /protein_id="ADV64470.1"
FT                   /translation="MVTNLPAEAKAKWIKVMEAKTPEEKIRALEDFLSSVPKHKGTEKL
FT                   RLWATRRLAELRDEIEERRKKKTGRGAVFFVEKEGDVQVVVLGPPNTGKSMLVNKLTGA
FT                   RTVIADYPFSTTQPVPGMLKYEDIYIQLIDTPPLSRGSGLINKIIGLARNADGLLIVLD
FT                   ATRDIIADFEELRGLLEDSGVVLSKPLGRVVIEAYRSGRQGIRFTLMGKLLNATLDDVR
FT                   RLLEEYRIHNAHVKIYGEVTLDDVEQALFENTTYKPSVVFVNKVDLVSGVDEVVKVLGE
FT                   KSGLPVIAGSAFTGLGLNKVGEALFTQLELIRVYTKSPNTDPSSKPLVLRKGATIRDVA
FT                   ESIHRDFVKNFVYAKVWGKSVHYPGERVGLEHVVEDGDIVEIHIRG"
FT   gene            complement(143471..143809)
FT                   /locus_tag="Desmu_0152"
FT   CDS_pept        complement(143471..143809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0014 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64471"
FT                   /db_xref="UniProtKB/TrEMBL:E8R738"
FT                   /protein_id="ADV64471.1"
FT                   /translation="MLVLSLRKLDEAVGRFIEEAVVEGCRILVTDAETIRLLRVSNMLG
FT                   SMRHLEIVVFNRGNPEEESLRIIAVYTPSEAYICDQRGSLNPLSRVLRKLGIPVKVCED
FT                   EHPRGSDM"
FT   gene            143912..144274
FT                   /locus_tag="Desmu_0153"
FT   CDS_pept        143912..144274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0013 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64472"
FT                   /db_xref="UniProtKB/TrEMBL:E8R739"
FT                   /protein_id="ADV64472.1"
FT                   /translation="MISDLAEFLRRHGFKVIAYRDALRVPDEELPIYLEVKLDAGKIYT
FT                   AIGFTEELREILEEKASGGESIEDIVEDALSRLNTCALLVKKWADERRLVTIFRLREGS
FT                   VELMDLLEELREEMEG"
FT   gene            144274..145644
FT                   /locus_tag="Desmu_0154"
FT   CDS_pept        144274..145644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0154"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterProIPR016066:
FT                   IPR005841: IPR005844: IPR005845: IPR 005843; KEGG:
FT                   dka:DKAM_0012 phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase; SPTR:
FT                   Phosphomannomutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64473"
FT                   /db_xref="GOA:E8R740"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8R740"
FT                   /protein_id="ADV64473.1"
FT                   /translation="MELGRLFGTDGVRGVVNEELNPELVVRLGLAIGSFFDKGSRILVA
FT                   MDSRAGGELIKNIVAGALMSTGVKVYDAGLAPTPALQYAVKSNGFDGGVMVTASHNPPE
FT                   YNGIKVIGSHGIEVDRDEEEAIEELYWENRFRRVSWRELSHHVEKYPLVIEEYVKAVVS
FT                   HVDRDLIKSRNYRLLVDPANSVGSLTTPLIARELGVKPIVVNGTLDPLFSGRLPEPTVE
FT                   NLAETSKLVREVGVALGVAHDADADRVIMIDEKGVVHWGDRTAALLARYLREKGLKGRV
FT                   YTAVSSSVIVEEVLRPLNIDVVWLKVGSVDIAHTMRRNGDALCGFEENGGFMYPPHQYV
FT                   RDGGMTTALFLEMLATYGVPASQLFESLPKYHTVKKKYKMSRESALAVVEKVKEAFRNE
FT                   RLITIDGVKVVSSDYWLLVRPSGTEPLLRVMIEAKTIERLDEVSQLVDSLISEVTGR"
FT   gene            145641..146072
FT                   /locus_tag="Desmu_0155"
FT   CDS_pept        145641..146072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0155"
FT                   /product="protein of unknown function DUF343"
FT                   /note="InterPro IPR005651; KEGG: tag:Tagg_0186 hypothetical
FT                   protein; PFAM: protein of unknown function DUF343; SPTR:
FT                   Putative uncharacterized protein; PFAM: Trm112p-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64474"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:E8R741"
FT                   /protein_id="ADV64474.1"
FT                   /translation="MMRYWGLDVLVCVHCKHHPLELTVIESEEQSIDVEKVEAPVCKEY
FT                   CGYLREKIDRNKAYPCRECLRKGIRTGVLYCPNCGRWYPIKNGVVYMLTDNRRNPERDR
FT                   EFLRMFKDRIPGRILEHGKPVNLHGVEEGGEKQGYLGHK"
FT   gene            complement(146054..147442)
FT                   /locus_tag="Desmu_0156"
FT   CDS_pept        complement(146054..147442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0156"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680; KEGG:
FT                   dka:DKAM_0010 amidohydrolase; PFAM: amidohydrolase; SPTR:
FT                   Amidohydrolase; PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64475"
FT                   /db_xref="GOA:E8R742"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8R742"
FT                   /protein_id="ADV64475.1"
FT                   /translation="MREKVDILISDALIVTMNSERRIIDHGYIAVRDGRIIDVGVGDGT
FT                   SKYTGEETINGRGRVVTPGLMCAHTHFYGLLLTGSPWFSKIEPPTDFQQNLQRIWWALD
FT                   VELTYEDAYASALIGSILFAKSGVTNFFDNISSPNAIDGVLDYIEKGVNEVGIRGIVSF
FT                   EATQRRSLEEGVRGLRENERFIVKNNRDPGRLVKGAIYLHASFTVTDELFKLAHETAGK
FT                   YGALIAIHTAEGLVDVYHNIERYGLRPVERMKKLGFLGSNVHLVHAVNITEDELHIIKE
FT                   TGVHVAHNPLSNMLNAVGVARVPEMLRLGVNVGIGNDGYVFDQFENMRATYLIHKLWNR
FT                   DPRVLTPLQVFEMSTVNVARMFHVEGELGSIEVGKKADLVVLRPEAPSTPVNSQTVMGH
FT                   IVNSFSSRDVDTVIVDGRIIVRNRKLTRVDEEKAVEYVHRVVERLWDRLMEKGRYQLDY
FT                   LCPR"
FT   gene            complement(147535..149868)
FT                   /locus_tag="Desmu_0157"
FT   CDS_pept        complement(147535..149868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0157"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="COGs: COG0474 Cation transport ATPase;
FT                   InterProIPR018303: IPR001757: IPR000695: IPR004014: IPR
FT                   008250: IPR005834; KEGG: dka:DKAM_1201 H+-transporting
FT                   ATPase related protein; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   H+-transporting ATPase related protein; TIGRFAM: ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; PFAM:
FT                   E1-E2 ATPase; haloacid dehalogenase-like hydrolase; Cation
FT                   transporter/ATPase, N-terminus; TIGRFAM: plasma-membrane
FT                   proton-efflux P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64476"
FT                   /db_xref="GOA:E8R7I1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I1"
FT                   /protein_id="ADV64476.1"
FT                   /translation="MRGLTGLSSSEVEEKLRIYGFNTVPEKKESTLKIFVKKLQGLTAY
FT                   TIEAAAVISFILGRYIDAAIMILLLLLNAFIGVLHEQRAGKAVEMLKSRLKIVVKALRD
FT                   GEWRDIPSEYIVPGDVVKVRLGDIIPADGVVLEGHLLVDESTLTGESMPVEKNPGDPVY
FT                   AGTAVARGEAIIRITATGPRTRYGRTVELVEAGKPRLLIEEITSSITRWLLAVDVFFVV
FT                   LVVVRLLITQTPVVDALPFTLTLLIASIPIALPAMTTITLALGSVELARAGVIVRRLEA
FT                   VEAASMMEVICLDKTGTITENKLVVKDIIPLREGFTEHDVILYAALASEPDGRDPIDKA
FT                   ILEKAGELGVDLGSVSVMEFKPFSPESKRSEALVSMGGRILKAVKGAPQVLVDVDTTLD
FT                   RERFNEAVRTLGDRGMRPLAVGVEENGSLRVIGLIGIYDKPREDSQRFIEEIKSMGVKP
FT                   VMVTGDNYYVAKSIARSVGIEGRVVSLKGVPREELADLLDSAGVFAEVVPEDKYEIVRL
FT                   YQSKGKVVGMTGDGVNDAPALKQADLGVAVSNATDIAKSVASVVLTKPGLGNIVDVIRL
FT                   GRVVYRRIVVWAINKIVKTFQVVYFVSASTLLLGAPILTPTHMILMLFLYDFVTLSIST
FT                   DRLRPSSKPEKWNVRRLVKVSVILGLVKIAELFLALYLGLHVLSLQLEQARTFVFYTLL
FT                   TSGLFNILNFRETGWFWHSKPSKVMTIALTTDILAGTIIAWKGWIIQPIPPPVILIAFV
FT                   YTVAVTLILTDAVKIAVFKLFKYS"
FT   gene            complement(149942..150835)
FT                   /locus_tag="Desmu_0158"
FT   CDS_pept        complement(149942..150835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0158"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: dka:DKAM_0009 permease of
FT                   the drug/metabolite transporter (DMT) superfamily; PFAM:
FT                   protein of unknown function DUF6 transmembrane; SPTR:
FT                   Permease of the drug/metabolite transporter (DMT)
FT                   superfamily; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64477"
FT                   /db_xref="GOA:E8R7I2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I2"
FT                   /protein_id="ADV64477.1"
FT                   /translation="MDASSMREGRGKAMGIASLVAATVLWGSSFPFIKLSVMDIEPLTY
FT                   AATRSLVAILLLTPLLLAKATRGVIHTGSLYRGVIIGVAYLLGLYLQAAGTVYTTPSIS
FT                   AFITGLNSVHVHVYIALVKKSYSVMDGVALLLAVSGLYVLTSPSGGLTIGVLLVFLGSI
FT                   AWAAQILLVSRFNSSSIMELLYGMFLPGALMYPLVSASTEGVSLRVLVYIAYLAAACTV
FT                   GATFLQVWGQRYVSPLTAALIFLLEPVFALFFSLIMGLEEPEPYKLVGGGLIVASTYLA
FT                   SATELSHEEKRLADAG"
FT   sig_peptide     complement(150755..150835)
FT                   /locus_tag="Desmu_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(150926..151903)
FT                   /locus_tag="Desmu_0159"
FT   CDS_pept        complement(150926..151903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0159"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="COGs: COG0549 Carbamate kinase; InterPro IPR003964:
FT                   IPR001048; KEGG: dka:DKAM_0008 carbamate kinase-like
FT                   carbamoyl phosphate synthetase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PRIAM: Carbamate
FT                   kinase; SPTR: Carbamate kinase-like carbamoyl phosphate
FT                   synthetase; TIGRFAM: carbamate kinase; PFAM: Amino acid
FT                   kinase family; TIGRFAM: carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64478"
FT                   /db_xref="GOA:E8R7I3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I3"
FT                   /protein_id="ADV64478.1"
FT                   /translation="MKTDARPDTIVIALGGNAFQTKGDKGTAEEYWRNAYTAADLIVRL
FT                   VEEKYGVVVTHGNGPQVGIIAEWMSLGLKNKNIPPMPLDVAGAMSQGWLGYMLQQALYN
FT                   KLAEKKLLGSLVKGVVTVITQTLVDRNDPAFKDPTKYIGPWYEKDEAEKLSKELGWVFK
FT                   PDPRGGYRRVVASPDPIGQVEIDAIKTLVEQGFIVIADGGGGIPVYRGDDGLLHGVEAV
FT                   IDKDLGAERMASALEADVLLILTDVEKAYLNYGTPNAKPLDVLRVSEALKYYREGHFKP
FT                   GSMGPKILAGVRFVQNGGKMAVIAHLKQAYDALKGNAGTRIIPD"
FT   gene            152079..152813
FT                   /locus_tag="Desmu_0160"
FT   CDS_pept        152079..152813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0160"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="COGs: COG0396 ABC-type transport system involved in
FT                   Fe-S cluster assembly ATPase component; InterPro IPR003439:
FT                   IPR003593: IPR010230; KEGG: dka:DKAM_0007 FeS assembly
FT                   ATPase SufC; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: FeS assembly ATPase SufC; TIGRFAM: FeS
FT                   assembly ATPase SufC; PFAM: ABC transporter; TIGRFAM: FeS
FT                   assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64479"
FT                   /db_xref="GOA:E8R7I4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I4"
FT                   /protein_id="ADV64479.1"
FT                   /translation="MLEARGIVVEVDGRRVVNGVDVEVAAGRVVALMGPNGSGKTSLVY
FT                   ALMGHPAYRIVEGSVMIDGVDYTLKPAHERALAGVFLVFQNPVDLPGVTLEALIKSSLN
FT                   KRLGKGDLSGNIPGLSERVRSEAKLIGLKEELLARDLNVGFSGGEKKRSEILQARILRP
FT                   KYLILDEPDSGLDVDGVRIVADYVREVVDSGGGVLLITHNPTLLRYVNPDIIHVMHGGR
FT                   IVVSGGVEIAERIASEGYNWLR"
FT   gene            152819..154225
FT                   /locus_tag="Desmu_0161"
FT   CDS_pept        152819..154225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0161"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR010231: IPR000825; KEGG: dka:DKAM_0006 FeS assembly
FT                   protein SufB; PFAM: SufBD protein; SPTR: FeS assembly
FT                   protein SufB; TIGRFAM: FeS assembly protein SufB; PFAM:
FT                   Uncharacterized protein family (UPF0051); TIGRFAM: FeS
FT                   assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64480"
FT                   /db_xref="GOA:E8R7I5"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I5"
FT                   /protein_id="ADV64480.1"
FT                   /translation="MAVELSKSLEHGEMEPAEYRKEIELKGRISRDIVEEISRLKKEPE
FT                   WMRLHRLRALEEFYRLPSPNWLPWIRSIDLDEVASYYVKPETTGASSFEELPDEIRRIY
FT                   DALGLPEAYAKYLAGLSTVLDSENVYTVMKDLLKELGVVMVPMDEAVQKYPDMVKKYFG
FT                   RVFPYTDHKFAALHHALWSGGVFVYVPKGVRVPYPVEAFFFIGSELEGQFEHTVVVADE
FT                   GSEITFIEGCSAPRLKKFSFHDGMVELYAHKEARVNFVTVQNWSRNIVNFNNKRGIAEE
FT                   NAVIEWIEGSIGSKVTVTYPTTILKGRGARTASTVIGISNGDTVKDTGSKVIHAAPSTS
FT                   SRIVSKSISGRGGVNVYRGLIQVNKGASNSKSYTQCDSLILDEKSSSSTYPIIHVMEED
FT                   ADIGHEATTIRVTDDQLFYLASRGLSEKEALSLIVLGFVKDIFPRLPFEYVAMLSKVIQ
FT                   LEFRELGGVG"
FT   gene            154225..155232
FT                   /locus_tag="Desmu_0162"
FT   CDS_pept        154225..155232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0162"
FT                   /product="SufBD protein"
FT                   /note="COGs: COG0719 ABC-type transport system involved in
FT                   Fe-S cluster assembly permease component; InterPro
FT                   IPR000825; KEGG: dka:DKAM_0005 ABC transporter, membrane
FT                   component; PFAM: SufBD protein; SPTR: ABC transporter,
FT                   membrane component; PFAM: Uncharacterized protein family
FT                   (UPF0051)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64481"
FT                   /db_xref="GOA:E8R7I6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I6"
FT                   /protein_id="ADV64481.1"
FT                   /translation="MQLQTGDSPTIKRYIDKSVIEELARRILAREASLNTILTIEGSMS
FT                   ETKIYDPASSTAVFESLPSPLKPPAVYRVKSLGGESEIAVTGFREDSLNIGYIELILDK
FT                   AGITVLRIQESRGSRFTGLRIIVADGVSHEVVILYESLRDAVDLSEIKVEQGDSSRLTL
FT                   TAFFKPGSLMHVVAESRSGKGSALSKTMIIDAASGSRVELEDSSRINTPGSSVESYIKA
FT                   RLGGGSIAALRGKGVVARGAVDSKVVYGIESLITDTESKVYMHPFLEINTNRVAEARHY
FT                   ARNYIITLDKVFYMGTRGLDPGEATMLLIRGFMTMGLSGKAREIIAERIASKGP"
FT   gene            complement(155237..155464)
FT                   /locus_tag="Desmu_0163"
FT   CDS_pept        complement(155237..155464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0004 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64482"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I7"
FT                   /protein_id="ADV64482.1"
FT                   /translation="MSLRLDLSEGGGCSDNPLSRLIAVLKEGVGELEVKTRSNIIPRAL
FT                   AEMLGDKYGYKVEVSVVNGEEVVYLFKRKQ"
FT   gene            156289..156657
FT                   /locus_tag="Desmu_0164"
FT   CDS_pept        156289..156657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0164"
FT                   /product="adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="COGs: COG1586 S-adenosylmethionine decarboxylase;
FT                   InterPro IPR017716: IPR003826; KEGG: dka:DKAM_0003
FT                   S-adenosylmethionine decarboxylase; PFAM:
FT                   S-adenosylmethionine decarboxylase related; SPTR:
FT                   S-adenosylmethionine decarboxylase; TIGRFAM:
FT                   S-adenosylmethionine decarboxylase proenzyme; PFAM:
FT                   S-adenosylmethionine decarboxylase; TIGRFAM:
FT                   S-adenosylmethionine decarboxylase proenzyme, Bacillus
FT                   form"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64483"
FT                   /db_xref="GOA:E8R7I8"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I8"
FT                   /protein_id="ADV64483.1"
FT                   /translation="MEALTTKKVIGKHVYGELYECDPEILMDMEKLINIVEKAAEIGGF
FT                   TLLDVKAWKINPGVSVVGIVLESHISIHTWPEYSFATVDVYTCGVKGDPVKAFKYIVHA
FT                   LKARRHTLKVASRDYEDN"
FT   gene            156657..157832
FT                   /locus_tag="Desmu_0165"
FT   CDS_pept        156657..157832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0165"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR003042: IPR002938; KEGG: dka:DKAM_0002 putative
FT                   dehydrogenase (flavoprotein), FixC; PFAM: monooxygenase
FT                   FAD-binding; SPTR: Putative dehydrogenase (Flavoprotein),
FT                   FixC; PFAM: Lycopene cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64484"
FT                   /db_xref="GOA:E8R7I9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7I9"
FT                   /protein_id="ADV64484.1"
FT                   /translation="MVKADVCIVGAGPAGLSVASHLKLRDAVVIEEHGKPGIPKHCSGL
FT                   VGVETARLIEKYVGRVVDSSYNTVYFNAFGRLYKVSYRDDFVFHVNRPLLEEKLSSLVE
FT                   RKGHRVSYGVVARPRGVDSILAGGVEFKCNTLLIAEGAVGRFRRFFVNPYSGFIIGIQS
FT                   LFRVRNIEMDSIYIYYSEFTPGFFSWIIPLDQDTALIGGGFTRVDAGLVEKATRRVVEA
FT                   YGVRLGGVVERFGGIIPMQRPIPDPVIAGKAVFHGDSVPLIKPYTGGGLHYIFKLSERL
FT                   ARHIDEGDIAGYRGVYSKSIRGLLLEHQVVSILRSTLIELPVPFVAGLNKLNLFKPPDY
FT                   DKHHLLLVKSVPLMLTGLLPFLAGATRLEQGAQESMEGHVKLHVEEVREAG"
FT   gene            complement(157837..159126)
FT                   /locus_tag="Desmu_0166"
FT   CDS_pept        complement(157837..159126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0166"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="COGs: COG0174 Glutamine synthetase; InterPro
FT                   IPR008146; KEGG: tag:Tagg_0520 glutamine synthetase
FT                   catalytic region; PFAM: glutamine synthetase catalytic
FT                   region; SPTR: Glutamine synthetase catalytic region; PFAM:
FT                   Glutamine synthetase, catalytic domain; Glutamine
FT                   synthetase, beta-Grasp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64485"
FT                   /db_xref="GOA:E8R7J0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J0"
FT                   /protein_id="ADV64485.1"
FT                   /translation="MTGNVLHILFTDIAGVHRQVSIAVDGVPETLEGIRAGIDGSSIPG
FT                   YGRIERSDLFVEPASSTIVDLSSFNGGYMTTGRIVTHTGEPHPWDPRSIAGKTVEKAWE
FT                   NGYVFRAGCELEFYITGKVGFYLGRRRQGLLVSASKGGVAGQVVKSHYVSEIPLEVEEA
FT                   LSDVIRVLGNNGISVSKIHRENGFLNQYELSLSHRDPLGLGDSILLSVASVKRVLNTHG
FT                   FNGVFMPKPFADDYGSGLHIHVSMWIGDRNIFFDGGELTDAGRYFIGGILDHARSLTAF
FT                   TNPSVNSFRRLIEGFEAPVYISWGIGNRSTMVRVPLNGGRIEVRTPDASMNPYLGISAI
FT                   LLAGLDGLRKKTDPGSPVDYNMYDKPSTSSRLPRSLEEAVESLLSDHEYLKPLFPRDML
FT                   EYYAELKLREARRNRSIPSVADYVDLEHLV"
FT   gene            159219..159677
FT                   /locus_tag="Desmu_0167"
FT   CDS_pept        159219..159677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0167"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COGs: COG1522 Transcriptional regulators; InterPro
FT                   IPR000485: IPR019888: IPR019887; KEGG: tag:Tagg_0521 AsnC
FT                   family transcriptional regulator; PFAM: Transcription
FT                   regulator AsnC-type-like; SMART: Transcription regulator
FT                   AsnC-type; SPTR: Transcriptional regulator, AsnC family;
FT                   PFAM: IclR helix-turn-helix domain; AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64486"
FT                   /db_xref="GOA:E8R7J1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J1"
FT                   /protein_id="ADV64486.1"
FT                   /translation="MSYVKMDELDREVLKALQEDSRQSLRSIAERLGRPVSTVHERVRR
FT                   LIDKGVLKGFTVLVDYGRLGYTVKALILMNVDGKHIIDVERHVSQHPNVLVVYDITGEF
FT                   DVAVIAVFKEIRELDEFIKWILQNPYVKQTRTSIVFRTIKESIHLPLK"
FT   gene            complement(159691..161142)
FT                   /locus_tag="Desmu_0168"
FT   CDS_pept        complement(159691..161142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0168"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudA"
FT                   /EC_number="1.8.1.-"
FT                   /note="COGs: COG0493 NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductase; InterPro IPR006004:
FT                   IPR013027: IPR000103; KEGG: kcr:Kcr_0346 glutamate synthase
FT                   (NADPH), homotetrameric; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: Glutamate
FT                   synthase (NADPH), homotetrameric; TIGRFAM: glutamate
FT                   synthase (NADPH), homotetrameric; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM: glutamate
FT                   synthase (NADPH), homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64487"
FT                   /db_xref="GOA:E8R7J2"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J2"
FT                   /protein_id="ADV64487.1"
FT                   /translation="MSTGGSRVKKKRVPVPRREPAERIRDFNEVVLGYTLEQAMEEASR
FT                   CLQCPLNFAPCVKGCPVHVNIPGFLRKLREGDVKGALEIIMETNPLPGITGRVCPQEEQ
FT                   CERNCIMGRIGDRINIGKLERFVADYARKHGIRPEVKIPPSTGKKIAIVGSGPAGLTAA
FT                   AELRKMGHEVRVFEALHEPGGVLVYGIPEFRLPKEIVRYELEYLSKIGVEILTDVVVGK
FT                   TLSLRDLLTEYDAVFLGTGAGTPNFLNIPGVNCLNIYSANEFLTRVNLMKAYLFPEYDT
FT                   PIKKPNRVAVIGGGNTAMDAARSALRLGSREVYVLYRRTKELMTARQEEVENAEEEGVK
FT                   FMFLVSPVEFVCDDKGRVKAVRLIKMRLGEPGRDGRPRPIPIPGSEFELEVDAVIIAIG
FT                   QTPNRILFKDIPELKLTEKGTIVVDEKYRTTVKGVFAGGDAIRGESTVVKAMGDGWKAA
FT                   RSIDEYLKTGEWPPEIKPHDFEAEN"
FT   gene            complement(161145..161990)
FT                   /locus_tag="Desmu_0169"
FT   CDS_pept        complement(161145..161990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0169"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /EC_number="1.8.1.-"
FT                   /note="COGs: COG0543 2-polyprenylphenol hydroxylase and
FT                   related flavodoxin oxidoreductase; InterProIPR017927:
FT                   IPR012165: IPR008333: IPR001433: IPR 019480; KEGG:
FT                   kcr:Kcr_0345 ferredoxin-NADP(+) reductase subunit alpha;
FT                   PFAM: oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; Dihydroorotate
FT                   dehydrogenase, electron transfer subunit, iron-sulphur
FT                   cluster binding domain; SPTR: Oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; PFAM: Oxidoreductase
FT                   FAD-binding domain; Iron-sulfur cluster binding domain of
FT                   dihydroorotate dehydrogenase B; Oxidoreductase NAD-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64488"
FT                   /db_xref="GOA:E8R7J3"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J3"
FT                   /protein_id="ADV64488.1"
FT                   /translation="MPKYVITAKRKLAPRVNWFRIQAPLIARRAQPGQFVIVRLHEKGE
FT                   RIPLTLFDWNANEGFIELVVQEVGKTTMEMGRYNVGDHVLNITGPLGNPTHIDMYGVVV
FT                   IVCGGVGSAVCYPVAKALRERGNKVISIIGFRTRELVILEEEFRRISDEVIVTTDDGSY
FT                   GVKGFTTDALRSLLESGVKPGLVYTAGPVIMMKKVAEITRRHGVLTYASLNPIMVDGTG
FT                   MCGACRVTVEGRTVFACVDGPDFDAHKVDFDELAKRLAQYTEEERIALEKYLNTVSRGG
FT                   "
FT   gene            162113..163075
FT                   /locus_tag="Desmu_0170"
FT   CDS_pept        162113..163075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0170"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="COGs: COG2905 signal-transduction protein containing
FT                   cAMP-binding and CBS domains; InterPro IPR000644; KEGG:
FT                   dka:DKAM_1472 putative signal transduction protein with CBS
FT                   domain; PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; SPTR: Putative signal
FT                   transduction protein with CBS domain; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64489"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J4"
FT                   /protein_id="ADV64489.1"
FT                   /translation="MHVPTPRKPRPHRRVDPYRWLRSDGTPNFSDRVFRAEKELHLIAR
FT                   RNPRVVYPSTTLLKALEEMSLYGRSLIVSDSGRRLRGLLTLGDIVSYLGGGEYYRIVAE
FT                   RHAYNIYSALERETVDTIMVKNPIHLYVDDTLTRVLESMIIHGIGVVPVLDRDGAVYGI
FT                   ITEHDLVRYLYGIATTGLKVAEAMSRPVVTIGIDASLKKALEKMTTYGFRRLPVTSGDN
FT                   VAGMLTAMDVVKYFGDHRALRDAASGDIREVHSKPVEELMSRELVTVKPGDDLATAIQE
FT                   MMDKDVSSVLVVDDEGVLQGILTERDVLYALTIAGYRSV"
FT   gene            163077..163904
FT                   /locus_tag="Desmu_0171"
FT   CDS_pept        163077..163904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0171"
FT                   /product="CBS domain containing protein"
FT                   /note="InterPro IPR000644; KEGG: dka:DKAM_1471 CBS domain
FT                   containing protein; PFAM: CBS domain containing protein;
FT                   SPTR: CBS domain containing protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64490"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J5"
FT                   /protein_id="ADV64490.1"
FT                   /translation="MSLAEFIDPDPLVVDKNDSLSTYLRLLSKRENDKAVVMENRRING
FT                   RQVKTVAGVVTGRDILGKIVSERLRLSSPGRLRVSGFMSTQPFTIKPDASIRDALTAMA
FT                   SKSIGILPVVDGFNFKGAVYRRSLLKLAFHIGDPASKAASRVFLRTRLGDSLLMLRQSM
FT                   LESGEGFAVVVDDEGKPCGYITVMDLAYAFATFLENVPEKHRKERISELVVRDYYRRDL
FT                   PVVKEDAELGRVAETLYEKRSRGVLVTGERGVVGVVREHDLISYLALTSLGIG"
FT   gene            163904..164455
FT                   /locus_tag="Desmu_0172"
FT   CDS_pept        163904..164455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0172"
FT                   /product="protein of unknown function DUF82"
FT                   /note="COGs: COG1656 conserved hypothetical protein;
FT                   InterPro IPR002782; KEGG: dka:DKAM_1470 protein of unknown
FT                   function DUF82; PFAM: protein of unknown function DUF82;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64491"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J6"
FT                   /protein_id="ADV64491.1"
FT                   /translation="MTTGEAKFIVDAMLGSLARWLRILGYDTVYGSRMEDWLILRRAEL
FT                   EGRIILTRDRGLHHKALKRGLKSILLQDDDLASMLAKVSGLTGVRLYVDYERTRCPEDN
FT                   TPLRKVDKEEVKDKVPPRVYSMHEDFWVCPRCGKVYWVGNHWKMIESILGDARGKLGFF
FT                   KGQLKRGMVNEPGAPFRADA"
FT   gene            164421..165092
FT                   /locus_tag="Desmu_0173"
FT   CDS_pept        164421..165092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0173"
FT                   /product="AMMECR1 domain protein"
FT                   /note="COGs: COG2078 conserved hypothetical protein;
FT                   InterPro IPR002733; KEGG: dka:DKAM_1469 AMMECR1 domain
FT                   protein; PFAM: AMMECR1 domain protein; SPTR: AMMECR1 domain
FT                   protein; PFAM: AMMECR1; TIGRFAM: uncharacterized protein,
FT                   PH0010 family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64492"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J7"
FT                   /protein_id="ADV64492.1"
FT                   /translation="MNPVHPSELTLEEGSLLVKIARDAIEAYVTRGERIDVSMYRLGEK
FT                   LLRPGMTFTTIERLDESGRPHLRGCIGFLAPLQSLVESTVESAIEAAVNDPRFNPVEPW
FT                   ELDKLIIEVTVLSQPSIVDVGDRWVLPSLIIIGRHGLVAEKGWFKGTLLPVVPVEYCWD
FT                   EETFLAETCVKAGLRPDCWLDKSTKIHLYEGRVFREREPRGEVYERDMNKEYRSLCSRK
FT                   T"
FT   gene            165165..165995
FT                   /locus_tag="Desmu_0174"
FT   CDS_pept        165165..165995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0174"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="COGs: COG0171 NAD synthase; InterPro IPR003694;
FT                   KEGG: dka:DKAM_1467 NAD+ synthetase; SPTR: NH(3)-dependent
FT                   NAD(+) synthetase; TIGRFAM: NAD+ synthetase; PFAM: NAD
FT                   synthase; TIGRFAM: NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64493"
FT                   /db_xref="GOA:E8R7J8"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J8"
FT                   /protein_id="ADV64493.1"
FT                   /translation="MKRITVESLLSIPLEDAAETIVGFLKSYFAGAGAEKAVVGLSGGL
FT                   DSSVTLRLLVDALGANKVTAAIMPDTRVTPPEDTRDAAELAGSLGVEYFIIPIDTVVDS
FT                   YSVIPGFDAGNRLATGNLRARIRMNILYYIANRLNGIVVGTGDRSELLLGYFTKYGDGG
FT                   VDVLPLACLYKTQVRELGRRLGLPARILGKPSSPRLWKGHLAEEEIGLSYEAVDLVFYS
FT                   LIDLGLSISEAVDATGLPVEVFERVLSLHRRSRHKRRLPPFPSLPWLQEPVKEI"
FT   gene            complement(165982..166410)
FT                   /locus_tag="Desmu_0175"
FT   CDS_pept        complement(165982..166410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1466 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64494"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7J9"
FT                   /protein_id="ADV64494.1"
FT                   /translation="MAYITFRNSIVEVDGKAYSAPLVVLRGVFTGELALSRERVEGSLT
FT                   VEDGVDVSVEDEAVFITQAVDLKGPTTSIGIREASRGVLVSIDNGRYKGAEATLILEKA
FT                   RAVVNLVFHPLNIKVVVENPYIEVEHRLFGVAVKARSL"
FT   gene            complement(166524..167051)
FT                   /locus_tag="Desmu_0176"
FT   CDS_pept        complement(166524..167051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0176"
FT                   /product="ABC-type thiamin-related transport system,
FT                   permease component 1, predicted"
FT                   /note="COGs: COG4721 membrane protein; InterPro IPR017195;
FT                   KEGG: dka:DKAM_1465 ABC transporter, permease protein;
FT                   PFAM: ABC-type thiamin-related transport system, permease
FT                   component 1, predicted; SPTR: ABC transporter, permease
FT                   protein; PFAM: ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64495"
FT                   /db_xref="GOA:E8R7K0"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K0"
FT                   /protein_id="ADV64495.1"
FT                   /translation="MEKYTLVDILVLGVIAAIYGVLFYIWWDVYYAVKAVGGPVAARLV
FT                   TYGLWFMPAPLAASLIRKPGSAVLGEVLPALLESIIPTPGGLTNLIYGVAQGVFSEASY
FT                   AGFLYKKYGLLQAILAGALPALPAFALDAALFGDIYPVNEAVIVVSAIAVSGALYGAIA
FT                   HSVARVVSGRGS"
FT   gene            167206..168051
FT                   /locus_tag="Desmu_0177"
FT   CDS_pept        167206..168051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0177"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="COGs: COG1831 metal-dependent hydrolase (urease
FT                   superfamily); InterPro IPR001130; KEGG: dka:DKAM_1464
FT                   TatD-related deoxyribonuclease; PFAM: TatD-related
FT                   deoxyribonuclease; SPTR: TatD-related deoxyribonuclease;
FT                   PFAM: TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64496"
FT                   /db_xref="GOA:E8R7K1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K1"
FT                   /protein_id="ADV64496.1"
FT                   /translation="MLFSDAHLHTNPVKGMGASRVSERFKREGGWFMALVALPPYHYGI
FT                   EEVGVDSYRRVLEILNREAQVARSHGLRVARLMGLHPAEIDEYYRRGVKGRKLYELASS
FT                   VLDLIRSALKAGLLDGIGEVGRQHYATSVERIVLSEMVMMNALEISREYDVVIHLHLEQ
FT                   GGWVTAFSVERLRRLLVPGHGKIVLHHSSSETVLAAEELGLAYTIPVKGFDEKLASRRP
FT                   VNAMVESDFIDDPERPGAAAYPWEIPRVLKGQLERGVIDEEYVYRIMVENITRYYGVAP
FT                   "
FT   gene            168108..168371
FT                   /locus_tag="Desmu_0178"
FT   CDS_pept        168108..168371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_1058 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: HIT zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64497"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K2"
FT                   /protein_id="ADV64497.1"
FT                   /translation="MKCEICGEREAVYTCRLCGRRVCGDDYDSVKGVCKVCSEAMCEIC
FT                   GRQLAIGYCKYCGRIGCEDCLIQVSTVEYVCKDCAFKYRLKH"
FT   gene            168413..169408
FT                   /locus_tag="Desmu_0179"
FT   CDS_pept        168413..169408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0179"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="COGs: COG0309 Hydrogenase maturation factor;
FT                   InterPro IPR011854: IPR000728: IPR010918; KEGG:
FT                   dka:DKAM_1463 AIR synthase related protein domain protein;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; SPTR: AIR synthase related
FT                   protein domain protein; PFAM: AIR synthase related protein,
FT                   N-terminal domain; AIR synthase related protein, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64498"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K3"
FT                   /protein_id="ADV64498.1"
FT                   /translation="MVKHGKPSWNTMSFLLSLLPIEDPDLVVGPRQGEDAAVLRLRDGF
FT                   LVAHVDPITTGVRKAGYLAVHVAGNDIAVRGVAPRWFMPVTLIPAHYSEADVEELFRDM
FT                   GAALREIGGVAIGGHTEVTPGLDRPIIAMTAIGYTNGRVISTRDAREGDHVVIIGRIGG
FT                   EGAGVIAWDFEDLLLGKGVPENIIKRAKGFIYDVSIVKTALAVKDYVNTMHDATEGGVI
FT                   QALREVASASGKDIIVDADAFQIEKEVEEISQRIGVNPLRLLSSGCIVASVPPGNLDAL
FT                   LSRLRGLGVGFSVVGHVVKGGGRVIVESKSGGRIVVDTDVVDEIYKLWNQ"
FT   sig_peptide     168413..168484
FT                   /locus_tag="Desmu_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            169429..169941
FT                   /locus_tag="Desmu_0180"
FT   CDS_pept        169429..169941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_1462 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64499"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K4"
FT                   /protein_id="ADV64499.1"
FT                   /translation="MSEALTGIDRAVKSLNTLSRNIRSRVLGSQELDAKTASTASHLVE
FT                   IIESIAVSLQRLENKLKTGESGQGVVRLAPYTYVITGRGGVVLMRTRPEYIILSVDSEH
FT                   GSVSVKARKTLLTAEPGRILMKTRGVGVEVNPLNIDDYKAKRNELKNALRSLEKVVNFK
FT                   LASLLEH"
FT   gene            complement(170095..170721)
FT                   /locus_tag="Desmu_0181"
FT   CDS_pept        complement(170095..170721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0181"
FT                   /product="conserved protein implicated in secretion"
FT                   /note="COGs: COG5491 Conserved protein implicated in
FT                   secretion; KEGG: dka:DKAM_1461 conserved protein implicated
FT                   in secretion; SPTR: Conserved protein implicated in
FT                   secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64500"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K5"
FT                   /protein_id="ADV64500.1"
FT                   /translation="MSYYKREETVGEKLRKLFTNDKDPMEKKAIIAQYRIKTAIGRISN
FT                   YLEKLSDRDRELFEMIVESLTKKDELRAKMYAKEVAEIRKVSKQLLTVQYALEHAALKL
FT                   ETFIIYGGAVNEVAPVIGVMREAVNILKGVAPDIWIDLQYAVRELETAVGAGVVDLTTD
FT                   IGVGMDSEAKKVLEEARIVAEQKMKEKFAELPKAIVPEGEGVKSA"
FT   gene            170887..171189
FT                   /locus_tag="Desmu_0182"
FT   CDS_pept        170887..171189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_1062 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64501"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K6"
FT                   /protein_id="ADV64501.1"
FT                   /translation="MDSELRKYITCWNNCSLRHIEALAMLGLVVKAEAVECGDRGFMKI
FT                   NATLFDGGHVDSACFHSEEVKQSLRIINIYIGFARSKGSLGKLTVVDTKGASQEA"
FT   sig_peptide     170887..170988
FT                   /locus_tag="Desmu_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(171600..172286)
FT                   /locus_tag="Desmu_0183"
FT   CDS_pept        complement(171600..172286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0183"
FT                   /product="GTP cyclohydrolase III"
FT                   /note="KEGG: dka:DKAM_1459 GTP cyclohydrolase III; SPTR:
FT                   GTP cyclohydrolase III"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64502"
FT                   /db_xref="GOA:E8R7K7"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K7"
FT                   /protein_id="ADV64502.1"
FT                   /translation="MPRYTVVRVEEVERYAMRVGYGARRRRLNELFSRVEELLNNTLEP
FT                   YGGIAFNTGVEGEYIALTNGVDREQHLDLLFKLDWETPHGVRVASLKASNPVVALLSSS
FT                   SYFRRGERFLFEEDDGGVGEEYWVAMIALPRLRGYEAHVAANTLGYSISRAMERYGGLV
FT                   VEKTSGAVTIIGGGGLEALAGELREIGPVGIGVSQRGLNAYRNAVKALQRLLDGVAEER
FT                   VCVLRD"
FT   gene            172347..174167
FT                   /locus_tag="Desmu_0184"
FT   CDS_pept        172347..174167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0184"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR017932: IPR000583: IPR001347; KEGG:
FT                   dka:DKAM_1458 glutamine-fructose-6-phosphate transaminase;
FT                   PFAM: sugar isomerase (SIS); glutamine amidotransferase
FT                   class-II; SPTR: Glutamine-fructose-6-phosphate
FT                   transaminase; PFAM: SIS domain; Glutamine amidotransferases
FT                   class-II; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64503"
FT                   /db_xref="GOA:E8R7K8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K8"
FT                   /protein_id="ADV64503.1"
FT                   /translation="MGGIFGVVCSTNVPRGLVVTVLRRLIYRGYDGAGAVFPVNGVLEV
FT                   RKAPGHLDSVVKQVDLEDIPSNMVLAHTRYASRGWPVYENTHPLLDCTGRIAVVGDGII
FT                   DNYEDYRARLEKEGHVLRSRTDTEVAAHLLEKYYRIEGDWLKAVLRVGAELKGLYSLAF
FT                   MVLGVDGILFVQNGQPLVIGMGSHCVFLSSDIPSLYGLADTAYIVDDGVAGLIGLDRQV
FT                   LYRISTGEQLGLQALQSKRVKYGVEHVDKAGFPHYMLKEIYEIPEAVYRVTLSIMDKYL
FT                   RLASMIIHGARDIYIVANGSSLHAGMVATYYFNELAGISVTPVSAAEFPYSVLETVSTG
FT                   SVIIAVSQSGETSDVINSVKQAKQRGAVIVGVTNNVGSRLALESNVYLPIGAGPEIAVP
FT                   ATKSFSATVVAMLLLAMYSGIYTGRQSFNEYNSLVGEVRESSKELKTILTRLDTEIATI
FT                   LDSMPLFNNTYVAGSGITYPIALEGALKLKEAALIHAEGMQLGELRHGPLTLVGRGFPV
FT                   ILIEPFEDSAKSLYLKVAREIANRDAVLLAISTESGPREGRGIYIEVPARRHLYPVIVA
FT                   LPLQLLAYRIGVRLNRPIDRPPGLAKAITT"
FT   gene            174290..175396
FT                   /locus_tag="Desmu_0185"
FT   CDS_pept        174290..175396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0185"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COGs: COG0180 Tryptophanyl-tRNA synthetase; InterPro
FT                   IPR001412: IPR002306: IPR002305; KEGG: dka:DKAM_1457
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; PRIAM: Tryptophan--tRNA ligase; SPTR:
FT                   Tryptophanyl-tRNA synthetase; TIGRFAM: tryptophanyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (W and Y);
FT                   TIGRFAM: tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64504"
FT                   /db_xref="GOA:E8R7K9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7K9"
FT                   /protein_id="ADV64504.1"
FT                   /translation="MGVKLDPWGHYAIEDYVKLLAEFGIHPIDEVLGSLPRKHMYFERR
FT                   VIFGHRDFNLWLDALKHGEKVAVLTGFMPSGRPHLGTAMVYEELRFLQSLGAHVKIVIA
FT                   DAEAYIVRREERSDVVKRGVDFIAHAIAWGIDPEKAEFYYQTAMDNEYYRLIQMFSRKI
FT                   SMAEMEAIYGELTPGKIVASLTQAADILHLQLDKYGGYRHVVVPVGADQDPHLRLTRDL
FT                   ADRFEQELGLKRPSSIYHKLLRGLDGNKMSKSRPEFAIHLDDDPDLAEKKLLNALTGGR
FT                   ATADEQRRLGGEPWKCSIYELYVYHLVGDDSELREVYDECVTGRVLCGQCKRRAVERLK
FT                   RRLIEHQERYREVLSSGIVDKVLRKPSF"
FT   gene            complement(175423..175836)
FT                   /locus_tag="Desmu_0186"
FT   CDS_pept        complement(175423..175836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0186"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002068; KEGG: smr:Smar_1280 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64505"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L0"
FT                   /protein_id="ADV64505.1"
FT                   /translation="MGFDPLDEFVKKMRELVRDLENTMRRQLAMEAEAIEPLYTVNQYP
FT                   DRYEVIIDMPLADLSVLSVSIRDQRLTVECALREKIRFERWSVHRSVEHRAYRLELRLP
FT                   PDVIPEEAVVEKSEAKSMIRVRIPRRPLRGLNA"
FT   gene            complement(175851..176633)
FT                   /locus_tag="Desmu_0187"
FT   CDS_pept        complement(175851..176633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0187"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1938 protein of ATP-grasp superfamily;
FT                   KEGG: tag:Tagg_0179 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: PAC2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64506"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L1"
FT                   /protein_id="ADV64506.1"
FT                   /translation="MDKPVRTLRFDTISIYEYSEALRQDGPPRFLILSFPDTGLVSSIA
FT                   GRHLVVSEGFSIVGEIDAPSLSHISVVHNGRAVSPIQIYYSEASRILMVLSEVPLPLGI
FT                   MHPLIDSILTYLHGLGMENVVTVSGLAVPNRFELEKPNVFLLSTGEWRGLKELGFEELK
FT                   EGFITGPYAALMKEARRRGVNALVIFVESFYDIPDPESAAVGLQALSKVTGLEVDVSRL
FT                   ISEAELLKLKMRDLMRQTREAMSSLEKDLEKKMPLMYT"
FT   gene            176850..177248
FT                   /locus_tag="Desmu_0188"
FT   CDS_pept        176850..177248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0188"
FT                   /product="Uncharacterized conserved protein UCP008210"
FT                   /note="COGs: COG4755 conserved hypothetical protein;
FT                   InterPro IPR014450; KEGG: dka:DKAM_0017 hypothetical
FT                   protein; PFAM: Uncharacterised conserved protein UCP008210;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in archaea (DUF2153)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64507"
FT                   /db_xref="InterPro:IPR014450"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L2"
FT                   /protein_id="ADV64507.1"
FT                   /translation="MDGFFDNLDSWVKRQNTVREMFKRAEQNYEELDRLALITLSRLAF
FT                   QHMEKTIEAFDQWLKDPMITSHMPREMLVELWSRLRVILYELIELDIDHTSKFSEHLKK
FT                   LAAENAINPLFAFEKEEKEGRRGVSPTI"
FT   gene            complement(177257..177733)
FT                   /locus_tag="Desmu_0189"
FT   CDS_pept        complement(177257..177733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0018 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64508"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L3"
FT                   /protein_id="ADV64508.1"
FT                   /translation="MPKEKKEQAQTGGVEKGKEIRIVTRPVVTPGDLEKNPRAIKLLYI
FT                   ISLSNGISEKALMSLLYLMKQSGYDLGYSFTLLTQNPTSRDVLNELTMLKYLGFVEVNA
FT                   HKKLVATGSGKEFLDSHMGIIGGDAENIRKLFNDLKPKIAPLDVEVDVKSRKKA"
FT   gene            complement(177847..178668)
FT                   /locus_tag="Desmu_0190"
FT   CDS_pept        complement(177847..178668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0019 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64509"
FT                   /db_xref="GOA:E8R7L4"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L4"
FT                   /protein_id="ADV64509.1"
FT                   /translation="MNPVIEAVSRDLRAVLGKVRETGVPEHRVQRVENLLNALNAVRMP
FT                   QVVTAELFRAYMYTVPLIKELEAGLQAGSGELEVYMLLDRIEEKLMGLGEAARRSYIKE
FT                   KLQLSIPVLMSLASYALFTMAEPTPLNTASLLASLAGVLLFYINTFAGLLSVVAVAFSS
FT                   ALLSALMNELRIDVLMLEAMIAVSALLHIYIVRESRSTRYVDRVTRSLQSVDSLVASYL
FT                   KPADAGSVASLLNTVISRRTGGIPELLRYKAAVMLMNGYSVEEVEKRLLEG"
FT   gene            178901..180253
FT                   /locus_tag="Desmu_0191"
FT   CDS_pept        178901..180253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0191"
FT                   /product="TBP-interacting protein TIP49"
FT                   /note="COGs: COG1224 DNA helicase TIP49 TBP-interacting
FT                   protein; InterPro IPR003593: IPR003959: IPR010339; KEGG:
FT                   dka:DKAM_0020 TatA binding protein (TBP)-interacting
FT                   protein (TIP49-like); PFAM: TIP49 domain-containing
FT                   protein; AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; SPTR: TATA binding protein (TBP)-interacting
FT                   protein (TIP49-like); PFAM: TIP49 C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64510"
FT                   /db_xref="GOA:E8R7L5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L5"
FT                   /protein_id="ADV64510.1"
FT                   /translation="MSEIRVEPVSRRRISAHSHIMGLGLDEKGKAKMVGDGLVGQTEAR
FT                   EAAGIVVKMIREGRIAGRGILLVGPPGTGKTALAVAIARELGEETPFVIMSGSEVYSTE
FT                   KKKTEILMEALRKALGVKLREVRKVYEGVVKEVKIRRARHPMVPYLTVPVEARIVLATR
FT                   DEELALTVPEEVTQQILEIGVRKGDVIWIDAETGRVHRVGRSREVEGARTYDVETKRIV
FT                   EVPKGPVKKEKEIVNVLTLHDLDAIYAAQRSMISFFGLTFEREIPSEVRRQVDETVKKW
FT                   IDEKKAEIIPGVLFIDDAHMLDIEAFSFLTRAMESEFAPILILATNRGIARIRGTDIES
FT                   PHGMPLDLLDRLLIIPTRPYTPEEIREIIKIRASEEEVNISSEALEKLVEIGSKTSLRY
FT                   AVQLLEPARIIAEERGSDRIDVEDVEKARKLFIDVSVSTEYLKQYEKLFMK"
FT   gene            180279..181424
FT                   /locus_tag="Desmu_0192"
FT   CDS_pept        180279..181424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0192"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="COGs: COG0076 Glutamate decarboxylase and related
FT                   PLP-dependent protein; InterPro IPR002129; KEGG:
FT                   dka:DKAM_0021 pyridoxal-dependent decarboxylase; PFAM:
FT                   Pyridoxal-dependent decarboxylase; SPTR:
FT                   Pyridoxal-dependent decarboxylase; PFAM:
FT                   Pyridoxal-dependent decarboxylase conserved domain;
FT                   TIGRFAM: tyrosine decarboxylase MnfA"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64511"
FT                   /db_xref="GOA:E8R7L6"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L6"
FT                   /protein_id="ADV64511.1"
FT                   /translation="MNTAGNPEKARRWLEEARSRTPHHSDGSILGSMTTAPHPIGVEAF
FT                   KEFIHVNGNDPVIYPVVEEASRILIEGVGALLGAEHGIHTSGGTESNILALYIGRRISR
FT                   GRENTVVAPSSVHRSIDKACLLMGCRLVKIPVDPLKPVDPGVLEEYVRKHKPFAVVVTA
FT                   GTTEAGVVDPVKEAGEIAEEHGVFLHVDAAYGGLLIPFLHRRGYLAEDLRMYPGVSSIS
FT                   VDMHKNGCAPIPSSILFLSRRDYIEEACFEMEYMPRGRSCGLLGTRPGGAVIAAAAVFM
FT                   TIGAKGYEENAVRMMENALYLHENLSHLPMITSYKPILPLNVFKSTIYTYEELFKALLD
FT                   RKLYVYKSPSLQALRVVVMPHVEKAHLDRLINALKSIHGVQ"
FT   gene            181428..182312
FT                   /locus_tag="Desmu_0193"
FT   CDS_pept        181428..182312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0193"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="COGs: COG0478 RIO-like serine/threonine protein
FT                   kinase fused to N-terminal HTH domain; InterProIPR008266:
FT                   IPR018935: IPR000687: IPR015285: IPR 018934; KEGG:
FT                   dka:DKAM_0022 RIO-like serine/threonine kinase; PFAM:
FT                   RIO-like kinase; RIO2 kinase, winged helix domain protein;
FT                   PRIAM: Non-specific serine/threonine protein kinase; SMART:
FT                   protein of unknown function RIO1; SPTR: RIO-like
FT                   serine/threonine kinase; PFAM: RIO1 family; Rio2,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64512"
FT                   /db_xref="GOA:E8R7L7"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L7"
FT                   /protein_id="ADV64512.1"
FT                   /translation="MVNPGEIYRSLTSDDFKVLAAVEKGVSRGREYVPLEMLEKISGLH
FT                   EEKLVLILGKLHELKLVKRKTISGYKAYRLTYMGYDMLAFRALVAGNILEAIGDRIGVG
FT                   KESEIYLGLAPGGLKVAVKVLRIGRTSFRRTKLLRSWSSRPHMSWYDESKLAAEREFKA
FT                   LKALSSVNALVPVPIGYNRHVVVVEYVEGVELYTRPDLSRPGEVLDLIVETIGKAYRDV
FT                   GIVHGDLSEYNIIVTADEKPYIIDWPQYVYRDEPNAVTLLRRDLSYIARFFSKVYGLHV
FT                   DVEALFNRVVNPG"
FT   gene            182533..184443
FT                   /locus_tag="Desmu_0194"
FT   CDS_pept        182533..184443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0194"
FT                   /product="protein of unknown function DUF460"
FT                   /note="COGs: COG2433 conserved hypothetical protein;
FT                   InterPro IPR007408; KEGG: dka:DKAM_0023 DUF460 domain
FT                   containing protein; PFAM: protein of unknown function
FT                   DUF460; SPTR: DUF460 domain containing protein; PFAM:
FT                   Protein of unknown function (DUF460)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64513"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L8"
FT                   /protein_id="ADV64513.1"
FT                   /translation="MGVDIQPGSSPNSRRQPLYSVVILRGGELVASFEDIELHRLLRLV
FT                   LEYHVDTIAVDNIYELAPSENALRKILELLPSGVRVVQTTGLPGGSRSIGDIARELGMD
FT                   PRVQTPLKTAYINALAAYKGIGQEVKVFAEKTRIVITKGRSVSQGGMSRDRFLRGIRAS
FT                   IVQATKEVKRVLDENGFDYDMVIKRSKGGLEKSVFIVYAPRDSLHGLVKQFRYKNVRIM
FT                   IKPYRSRRLLEVGEEKTRIPVIVGVDPGMGIGVAVLTLDGVPLLVTSMKSPDRDDVVAA
FT                   VSELGRPIIVATDVSRPPETVVKLAAMLNAVLYAPDQDMSVDDKNRIAREYMDRYSVDI
FT                   PDAHARDALAAAVKAYNKYRNTIEEAKSKLAGIRDVDRYQLIAEVLRGRPLSEVLEEYF
FT                   KRNIPRRQPIVEEKPTTQQGCGKLREKVSALEALVRRLIEDVEKRDSYIRDLELELRLM
FT                   RSRKPGVEEYERKISSLIEEIEALRRRIDDKDAVIRELYGKLLTLEGNIVKLGRGELIM
FT                   LPRAGSQAVRQGSISRGVYMDKVLEIPAELREALTNVRGFIASPIVEVDPLKERIPVVK
FT                   PETVVEIGDYVLVDKGVVEKAEELWRRINELVELEKHERILRMIEDYQRSRLKKQTPNT
FT                   G"
FT   gene            complement(184430..185674)
FT                   /locus_tag="Desmu_0195"
FT   CDS_pept        complement(184430..185674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0195"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG1812 S-adenosylmethionine synthetase;
FT                   InterPro IPR002795; KEGG: dka:DKAM_0024
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase (MAT); PRIAM: Methionine adenosyltransferase;
FT                   SPTR: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase (AdoMet synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64514"
FT                   /db_xref="GOA:E8R7L9"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7L9"
FT                   /protein_id="ADV64514.1"
FT                   /translation="MNVGARRNIEIELLRMASVSSMKVELVERKGVGHPDYIADSASEA
FT                   ASRALSKYYLKEFGTILHHNLDKTLLVGGQSNPRFGGGILLEPIYIVVAGRATTEVRTE
FT                   DGLVKIPFGRIIVEAVKEWIKKNMRYLDPEKHVIVDYMVRKGSADLVTVFEAGKSSVPL
FT                   ANDTSIGVGYAPLSSLEKLVLQSERLLNSPEFKSKVPAVGEDVKVMGLRRGKEIVLTIA
FT                   AAIIDREVRDKYEYLKVKEDIVEAVSDLSSKIVPDYNVRIHVNTADIPERDSFYLTVTG
FT                   TSAEHGDDGATGRGNRANGLIPPMRPISLEATAGKNPVNHVGKIYNVVARRIAERVYEI
FT                   YNGVFSDIYVELLSQIGKPIDQPLVASIKLIPSDSSMTEIPGHIKSEINGIADEELANI
FT                   KRVTEMVLNDQVTLY"
FT   gene            complement(185763..187760)
FT                   /locus_tag="Desmu_0196"
FT   CDS_pept        complement(185763..187760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0196"
FT                   /product="protein of unknown function DUF814"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616: IPR008532; KEGG:
FT                   dka:DKAM_0025 protein of unknown function DUF814; PFAM:
FT                   protein of unknown function DUF814; Fibronectin-binding A
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Domain of unknown function (DUF814);
FT                   Fibronectin-binding protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64515"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M0"
FT                   /protein_id="ADV64515.1"
FT                   /translation="MLKKAMDILDVYAWVGRHGASLTSCFVDNAYHCKSYWILKLRCPS
FT                   GVTHLKIEPAVRIHLSQSIPEEKDIDGFTRFLRSRVRDSRILSVRQPWWERIVVLETGA
FT                   REKPLRHYIEVVPRGQWVVADPSDRIIYSTRFTEYRDRVIKPSETYKPPPFKGSDPWDS
FT                   ATLRDRLKEGRDLVRALVTAWGLPGHIAEEILYRAGLLEAKNKRVSEIPSPDVERLIEE
FT                   YGSIVREASTGMGYLVYSGENTLDIYTSYNPLLFRDVYNNSVKQVEDINTAIDAYFTEY
FT                   EAELERQRRLDELAAAVKEIEARIKRQEEVIRGYREEVEKIGRILQLIYGNYASVNEAL
FT                   ECARSTRAVKGWEHIAKDCPGVVGVYKDKGIVVLRVNGEVLELSIRKGLDKQVVELEKK
FT                   RGELVGKIESAVKVLEEMRRQLNEASSTMSIEDKTVRRLSPTLWYERFHWLFTRNGFLA
FT                   IGGRDQSQNEMVVRKYLGDNDVFIHADIHGGSAVVLKSRGLHSVEDVVDASYLAACYSR
FT                   AWRAGFSFIEVFWVPGSQVSKTPPSGEYLPRGAFMIYGSKNFLSIPLRLAVGARFFSDD
FT                   IYGDYIKVIVGSEELVSRQAIAYAVLTPGDEDVRDVSESIREFLEKAVLEYKGARYRIG
FT                   LAEVESRIPGPSRIIGLHRGAVSEASGQST"
FT   gene            187932..188207
FT                   /locus_tag="Desmu_0197"
FT   CDS_pept        187932..188207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0026 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64516"
FT                   /db_xref="GOA:E8R7M1"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M1"
FT                   /protein_id="ADV64516.1"
FT                   /translation="MDIEDKIWLSRLVTGIVYGVVTYILVLLMGPVEASAITWGLSPMV
FT                   YYATVMYVAVKYRPVKRMHLYLRGLLSFYTAWLSTVFILYDLTHPS"
FT   sig_peptide     187932..188039
FT                   /locus_tag="Desmu_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            188349..188981
FT                   /locus_tag="Desmu_0198"
FT   CDS_pept        188349..188981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0198"
FT                   /product="protein of unknown function DUF431"
FT                   /note="COGs: COG2428 conserved hypothetical protein;
FT                   InterPro IPR007364; KEGG: dka:DKAM_0027 protein of unknown
FT                   function DUF431; PFAM: protein of unknown function DUF431;
FT                   SPTR: Putative uncharacterized protein; PFAM: Predicted
FT                   SAM-dependent RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64517"
FT                   /db_xref="GOA:E8R7M2"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M2"
FT                   /protein_id="ADV64517.1"
FT                   /translation="MEGAGCGKPVVVVEHLEEGLSPWILLEYRHLSSIYGSQCVVFTNM
FT                   PLRYHRIMARYGKPVAESIVDMVDRGLVRREDVIVLDPASPRELTYRDLSTARYVVVGG
FT                   ILGDHPPRRRTWELLTSRLTGARAFNIGSGQYSIDGAVYYIHYMYLNKGVDGYRYVDGV
FT                   SIETPEGVVRLPFRYPLVDGKPLISGDLVYYIVNKRLPDHVWSEVKG"
FT   gene            188988..189434
FT                   /locus_tag="Desmu_0199"
FT   CDS_pept        188988..189434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0199"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4900 metallopeptidase; KEGG: ape:APE_1561
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64518"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M3"
FT                   /protein_id="ADV64518.1"
FT                   /translation="MGLPRYEPAPDVCRAIEAIRDALGDELGYIDVERVRCYRSIGART
FT                   RALARIHGVERLLLVALGIKPIYVIEVVSEKFYRLGLEDRVKVLIHELLHIPRSFSGGL
FT                   RPHGRYVNNRRVASLYRRLVEKGGVKIICERVNDASWCTGGTGE"
FT   gene            189418..190251
FT                   /locus_tag="Desmu_0200"
FT   CDS_pept        189418..190251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0200"
FT                   /product="protein of unknown function DUF91"
FT                   /note="COGs: COG1637 nuclease of the RecB family; InterPro
FT                   IPR010916: IPR002793; KEGG: tag:Tagg_0198 hypothetical
FT                   protein; PFAM: protein of unknown function DUF91; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64519"
FT                   /db_xref="GOA:E8R7M4"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M4"
FT                   /protein_id="ADV64519.1"
FT                   /translation="MAPVNEPLILEKPDPAALPDLIRRAIGERNTVIVIGECSVEYEGR
FT                   STSRLGKGDRVLMIKQDGSVLVHRPTGYSPVNWQPDTSVIEAWINERGELSILAVRSKP
FT                   REVLNISFSRVDSVIIARLRDDAEFTMYLDEAEMKRVLVGNPELIEPGFRVVEDEKRLG
FT                   SGQADIYGVDKEGRPVIVELKRITASRDAVLQLYGYVKAYEATYGKRPRGILIAPSFSP
FT                   SAIETLLRLQLEYRQVDLRELYRLAVEKGLRRSLLEYGRRPGERERGTGEKTRHE"
FT   gene            190244..190822
FT                   /locus_tag="Desmu_0201"
FT   CDS_pept        190244..190822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0201"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro IPR013216;
FT                   KEGG: dka:DKAM_0095 putative methyltransferase; PFAM:
FT                   Methyltransferase type 11; SPTR: Putative
FT                   methyltransferase; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64520"
FT                   /db_xref="GOA:E8R7M5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M5"
FT                   /protein_id="ADV64520.1"
FT                   /translation="MSNPALDQTGGDDAWRYDATASSYDELYRVEQYSKYGVLVALLTR
FT                   YMDSATLLDAGCGTGLLVEYLAERGLDRYARYICLDPSVGMISRLSEKPVDYRVIPVVG
FT                   YAEEIPLRDSSIDIVVSVTAWSNIGGKREATREFKRVTGRGGLIIVSSHVKHHSTPPAL
FT                   FDACFKKIAEHIDEFYVCVKNSATQPETF"
FT   gene            190879..191160
FT                   /locus_tag="Desmu_0202"
FT   CDS_pept        190879..191160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0202"
FT                   /product="Small nuclear ribonucleoprotein, LSM family"
FT                   /note="COGs: COG1958 Small nuclear ribonucleoprotein
FT                   (snRNP) homolog; InterPro IPR006649: IPR001163; KEGG:
FT                   dka:DKAM_0094 small nuclear ribonucleoprotein, LSM family;
FT                   PFAM: Like-Sm ribonucleoprotein core; SMART: Sm-family
FT                   ribonucleoprotein; SPTR: Small nuclear ribonucleoprotein,
FT                   LSM family; PFAM: LSM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64521"
FT                   /db_xref="GOA:E8R7M6"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M6"
FT                   /protein_id="ADV64521.1"
FT                   /translation="MSNVSRGYRPPSPMKVLKSAEGQIILVRIKGGYEYIGTLDLIDGT
FT                   MNIVLSDCTEYSSEGKPTSRYGRIIIRGSHVEFISTNYGQVAPDKVAF"
FT   gene            191466..192341
FT                   /locus_tag="Desmu_0203"
FT   CDS_pept        191466..192341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0203"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1237 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily II; KEGG: pho:PH0874
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein PH0874; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64522"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M7"
FT                   /protein_id="ADV64522.1"
FT                   /translation="MDTAIPRRVEVFVLADDYAGMTRGLLAQHGVSYLVKATMEEGSEV
FT                   TVLFDTGYNGEAVLRNMEVLGLSFDDVDYIVLSHNHYDHANGLPTLLKTAGRKRLVPVI
FT                   VGKGFFHRSVALKPRLRVLNHEWTREEAEALGARFIEVDGRLDLAPGVSIPGLIGLGER
FT                   LGFENNSTSYYIVANGSLVEDWVSHEVSLAVRSRKGILLLVGCSHPGVASIARKASSVL
FT                   GDRIHMVMGGFHLVDADEHRIARTIQALRELGVEKVVAGHCTGLKAEAMLLQAYGSDFT
FT                   RIHTGLSVSI"
FT   gene            complement(192345..193187)
FT                   /locus_tag="Desmu_0204"
FT   CDS_pept        complement(192345..193187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0204"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1856 Uncharacterized homolog of biotin
FT                   synthetase; InterPro IPR006638: IPR007197; KEGG:
FT                   dka:DKAM_0077 biotin synthase-related protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Biotin synthase-related protein; PFAM:
FT                   Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64523"
FT                   /db_xref="GOA:E8R7M8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M8"
FT                   /protein_id="ADV64523.1"
FT                   /translation="MKYFLHIEKFTSVSITGSACWLNCRFCRGKYLRHMTHLSRDRAGE
FT                   ILRGLYESGVRGILVSGGFTREGYLPIEGFIDVLRDARRKYGFIYNAHLGLQRDRSTLE
FT                   ALRGIIDVVDYEFTLSNYIAKYVRGLPVNVEAYLESLKLMSDAGLHVVPHLYLWHPGFS
FT                   KEVFRREVKAVEDLGLNEVTLLAYIPEPGEATTPQAGTVLENLREARRLFNGRIYLGCM
FT                   RPHYIKRELDTAAVDEGLVDRIANPYHPLLDDSSEIYDACCSLPENLLQGFKTSIGRR"
FT   gene            complement(193184..194107)
FT                   /locus_tag="Desmu_0205"
FT   CDS_pept        complement(193184..194107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0205"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG2516 Biotin synthase-related protein;
FT                   InterPro IPR006638: IPR007197; KEGG: dka:DKAM_0076 biotin
FT                   synthase related protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Biotin synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64524"
FT                   /db_xref="GOA:E8R7M9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7M9"
FT                   /protein_id="ADV64524.1"
FT                   /translation="MLVRASIGTLAKLGLSSVRMSDEPTTAYFLQYSDNGCLGKCGFCN
FT                   QSRMTVGRQDWLGKIVWPLVESSLILRSWRDVFKRICFQTVLKKGFITEAKSFIQGISG
FT                   VSRLPISLAITPVPKGVLEEFKELGVSELGVGLDTATRELFAKWGKPYTWEIYWSFIEN
FT                   AVEVFGRGRVYVHLIVGLGERLREAVDTLIKIYSAGARAALFNYFDTGSMKSIDKKYYR
FT                   VVQLAVELLENGENPLDYIDVDAGVFKRQPPVDVFKALYTRGCPGCNRPFYTDLPSSIY
FT                   NYPSRRTLEKHRQIVIEELRSIGVMV"
FT   gene            194222..194980
FT                   /locus_tag="Desmu_0206"
FT   CDS_pept        194222..194980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0206"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="COGs: COG0095 Lipoate-protein ligase A; InterPro
FT                   IPR004143; KEGG: dka:DKAM_0075 lipoate-protein ligase A;
FT                   PFAM: biotin/lipoate A/B protein ligase; SPTR:
FT                   Lipoate-protein ligase a; PFAM: Biotin/lipoate A/B protein
FT                   ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64525"
FT                   /db_xref="GOA:E8R7N0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N0"
FT                   /protein_id="ADV64525.1"
FT                   /translation="MRLRVVMDLEGAPVSWSMGMDEAMLELRLQDRIPDTLRLYVIKPS
FT                   AVTIGYFQKVEESVDLGYASSRGIDVTRRISGGGSVYHDASGEVTYGIVLPARGVFSDV
FT                   RESYEAICRGLVESLRILGVDAAFAPVNDIVVNGRKISGSAQARRKGFLLQHGTMMYAT
FT                   DLDEASRVLRAPQAKLQAKGVRSIRERVVTLREALQRDIDKRDVAEAMVKGFAKALGAE
FT                   VFLDEYREDELKLAEELSLKYRSSEWVFKR"
FT   gene            194986..195276
FT                   /locus_tag="Desmu_0207"
FT   CDS_pept        194986..195276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0074 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Bacterial lipoate
FT                   protein ligase C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64526"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N1"
FT                   /protein_id="ADV64526.1"
FT                   /translation="MRFVKTVRGEKTVEIEVEVSDCRIKRVVFSGDFFAYPDDVVEKLE
FT                   EALKDCGSDECVGEAFKEARKALLIGVEWDVLENEVRNALKTLCSSSPAED"
FT   gene            complement(195273..196013)
FT                   /locus_tag="Desmu_0208"
FT   CDS_pept        complement(195273..196013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0208"
FT                   /product="zinc/iron permease"
FT                   /note="COGs: COG0428 divalent heavy-metal cations
FT                   transporter; InterPro IPR003689; KEGG: dka:DKAM_0073
FT                   heavy-metal cation transporter, ZIP family; PFAM: zinc/iron
FT                   permease; SPTR: Heavy-metal cation transporter, ZIP family;
FT                   PFAM: ZIP Zinc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64527"
FT                   /db_xref="GOA:E8R7N2"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N2"
FT                   /protein_id="ADV64527.1"
FT                   /translation="MERETLLFGELLSNTGFILVSSIVGILPVLAGFKPPVRWIDASLG
FT                   FSGGVMIAVSFSMLYEGELSAYKLVFFTAGFAVMWLLEALIPHEHLVKGYEGPRVMKAR
FT                   LKIAWLIAFSMILHNVPEGLAVGSSTVRNPVLGFSVAVAIGVQDVVEGFMAGLPYVITG
FT                   DRGRAFLLSLIAALAEALASLGAGFLGIVEAGALAPLTCFSSGAMVFIVSHEIIPETHR
FT                   EHSSESTAGFLLGVMAATVLELLL"
FT   sig_peptide     complement(195921..196013)
FT                   /locus_tag="Desmu_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(195985..196806)
FT                   /locus_tag="Desmu_0209"
FT   CDS_pept        complement(195985..196806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0072 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64528"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N3"
FT                   /protein_id="ADV64528.1"
FT                   /translation="MEKAASNIASCLKTGACSIRDAANALLETVLNEDGSMLPASALAA
FT                   LCSLKQVVERDVYIQLIEEIASRIGSARLLSSLEHVALSGLVNGDQGVDCSISLLDALS
FT                   ETKLTHQVHDVLEKILGKAITVENPGRRLVELVEEIIDGPFEGIPPLESAMFMEAIRRA
FT                   RGSTWIPVKVRTIREASVVKNPGYLLEQRYLHALISLLEDVLDDLIKNPGEGVEALYSD
FT                   LNTAFTHLYKNCVTLMPHTSCSRLLSEVSGKLTALGSMVQSLHGEGDIVVR"
FT   gene            196881..197249
FT                   /locus_tag="Desmu_0210"
FT   CDS_pept        196881..197249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0210"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: dka:DKAM_0553 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; PFAM: Dinitrogenase iron-molybdenum
FT                   cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64529"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N4"
FT                   /protein_id="ADV64529.1"
FT                   /translation="MIVCIPAMTSGGRNYVSLHFGKAPYFAFYEVSDTGFKQLSLERNP
FT                   FATMGSGSSKGQAIARYLVSKGVEAVIAYEVGPGAFQHLRDHGIRVFVVEKTLPIEEAL
FT                   KLFIEGALTEAKEPVERD"
FT   gene            197368..197610
FT                   /locus_tag="Desmu_0211"
FT   CDS_pept        197368..197610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0211"
FT                   /product="FeoA family protein"
FT                   /note="InterPro IPR007167; KEGG: dka:DKAM_0071 FeoA family
FT                   protein; PFAM: FeoA family protein; SPTR: FeoA family
FT                   protein; PFAM: FeoA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64530"
FT                   /db_xref="GOA:E8R7N5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N5"
FT                   /protein_id="ADV64530.1"
FT                   /translation="METTLDSAPPGSRVRISSILHHGGWVHRLYQLGVFPGVIVEVVHN
FT                   EGRGPVVIRVNGSEVVLGKGLARRIVVEQLREETG"
FT   gene            197629..199716
FT                   /locus_tag="Desmu_0212"
FT   CDS_pept        197629..199716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0212"
FT                   /product="small GTP-binding protein"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR005225: IPR006073: IPR002917: IPR011619: IPR
FT                   011642; KEGG: dka:DKAM_0070 ferrous iron transport protein
FT                   B; PFAM: GTP-binding protein HSR1-related; Ferrous iron
FT                   transport protein B domain-containing protein; nucleoside
FT                   recognition domain protein; SPTR: Ferrous iron transport
FT                   protein B; TIGRFAM: small GTP-binding protein; PFAM:
FT                   Ferrous iron transport protein B; Ferrous iron transport
FT                   protein B C terminus; Nucleoside recognition; TIGRFAM:
FT                   ferrous iron transporter FeoB; small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64531"
FT                   /db_xref="GOA:E8R7N6"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N6"
FT                   /protein_id="ADV64531.1"
FT                   /translation="MEGKVIKVLFIGQPNVGKSSIFNMVTKSHVEVGNWPGKTVAVNKG
FT                   EVSFKGYKLILYDLPGIYGFTTLTQEELVAREAILLEKPDVVVVVVDSTIPERTMNLAI
FT                   QVLELTGRVVLVFSKTDLAHGRGIHINYEGVARELNVPVVPVSIVSGFEVERLLDEIIN
FT                   VAEGRKGRREPLRIDYNGLNEYVDSLEEMLSRSGRLKEYPARWVAVRLLEGDSVLEEVV
FT                   KSTLSSDEFKRVEELLGEARRLIGVPAERITEARFKLINAIASKHIVKVKVKPRGPSPS
FT                   IFYKPVVSILIALGIYLSIFMLVFTLNTGFPLNTILSAMGFENAASIVEEYSLSGLVEK
FT                   SFTALTSMLEPMSHVNPALYSFIVDGVIGGVASILVFLPLIIVMVIVQVIVEDSGLAPR
FT                   LAVASHSFFSKMGLSGHAFFPFMLGFGCNVPAVLATRTNPNSVERLRLLLTLSFIPCQA
FT                   RLVVLLAFTSAVSRLFSGLILLSSYLLAVAVFLVVNYVLYKLSRSDAKEPQLLMEVPAF
FT                   HRPLARVVYWKTLATVKHFAKRAGLVIFAGSMFVWFITSFTTSLTYTGNMDESIASIAS
FT                   RGLQFITAPLGITGGNAWIIALSIITGFIAKELVVSTLLVATGSDTVRGAMSVLGLSDL
FT                   QLFSLAVFTTLYMPCLATVATIYSESRSVKTTLTAVAISLVAAYIVTAAAGSIASLLTG
FT                   G"
FT   gene            complement(199696..200709)
FT                   /locus_tag="Desmu_0213"
FT   CDS_pept        complement(199696..200709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0213"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR007159: IPR008170; KEGG: dka:DKAM_0069 phosphate uptake
FT                   regulator, PhoU; PFAM: PhoU family protein; SpoVT/AbrB
FT                   domain-containing protein; SPTR: Phosphate uptake
FT                   regulator, PhoU; PFAM: PhoU domain; SpoVT / AbrB like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64532"
FT                   /db_xref="GOA:E8R7N7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N7"
FT                   /protein_id="ADV64532.1"
FT                   /translation="MYKRRLQKMGAASLGVSLPKKWLRHYRLKQGDEVDIEVLPDYTLL
FT                   IRPSFVKSRAGYSCQVFKYDDSSPNASIMRLVSLYINGVDSIKVLCGSTCNSFKEKIYR
FT                   LLERNIIGLEIIEEGEGYITVACLVDILSLPLSEVLRKMGRLVPAMMRDVESSITSGTE
FT                   LDIEERDSLIDKLYLYSVRQLNMVMQGRLLLEKTGLKSMGEAISIANLLKILERMGDHA
FT                   AQLYRWSRSRPHSMDSRREAGLLLGEVRAAAEKILGEYLAALENPEEMPSLEDTIMELR
FT                   ILEDKVRKPGLDPSLVISLTRIIAYLRDVAEVVTDIVVSREMQESTCSEGLTTGEQ"
FT   gene            200840..201961
FT                   /locus_tag="Desmu_0214"
FT   CDS_pept        200840..201961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0214"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="COGs: COG0226 ABC-type phosphate transport system
FT                   periplasmic component; InterPro IPR005673: IPR006059; KEGG:
FT                   dka:DKAM_0068 phosphate ABC transporter, phosphate binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Phosphate ABC transporter, phosphate binding
FT                   protein; TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64533"
FT                   /db_xref="GOA:E8R7N8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N8"
FT                   /protein_id="ADV64533.1"
FT                   /translation="MREPLLQSVALITATLAFSIALYFIITPPAAHPYAHQGSISRVLN
FT                   GAGSTLAAPQVIEWARSFKEATGIVVEYSPVGSGAGRAMFFNGTAVFAVSDPPLDKETY
FT                   LEYKGRVLQFPVLAGAVVVTYNLPEIPSGTRLNLTGEVLALIYKGEVSRWCDERIKSIN
FT                   PAVAGLLPDKEIIVVHRSDSSGTTRVFTGYLHKVAPDIWGSKLVGFTVEWPVDATGRGL
FT                   GGKGNEGVASIIKANPYSIGYVEASYALYTGMPIARLMNKAGFYTEPSKEAVLSAINSV
FT                   VDQLPDTPLGDFSSVLDALLDAPGSGSYPIVTFSYMFVYRDYGDPYTARALGEFIRYIL
FT                   TQGQGMLLPGYYPLPGRVVEIGLKAVDALGRGG"
FT   sig_peptide     200840..200932
FT                   /locus_tag="Desmu_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            201963..202871
FT                   /locus_tag="Desmu_0215"
FT   CDS_pept        201963..202871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0215"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0573 ABC-type phosphate transport system
FT                   permease component; InterPro IPR000515; KEGG: dka:DKAM_0066
FT                   phosphate ABC transporter, inner membrane subunit PstC;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; SPTR: Phosphate ABC transporter, inner
FT                   membrane subunit PstC; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64534"
FT                   /db_xref="GOA:E8R7N9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7N9"
FT                   /protein_id="ADV64534.1"
FT                   /translation="MRGVDRAFHILLLPSLVSLVILTLLTVHVIVSSLPALITQGPWLL
FT                   VESRWDPVEHVYGLLPALTGTLLTGLISVLIATPISLSLMFLIGDMLPSPASRILHRLL
FT                   EAMGSLPTVIYGLWGGFALSQILRDSIYLPIHAYLGFIPLFSCRPLSGQSIMTAGIVLG
FT                   LSMTPYASSLLVNGYRSLPGKYVEAAYALGFYRFETYRLIAGVMKPLVVAAAMLSLSRA
FT                   LGETTIVALSIGNAYLASPCVFNPGTTVSAWIVNQFESSFIYPGASSALYTGVLVVMAL
FT                   SLVLSYIGVSLINRWQGVIHG"
FT   sig_peptide     201963..202061
FT                   /locus_tag="Desmu_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            202864..203712
FT                   /locus_tag="Desmu_0216"
FT   CDS_pept        202864..203712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0216"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0581 ABC-type phosphate transport system
FT                   permease component; InterPro IPR018062: IPR000515; KEGG:
FT                   dka:DKAM_0065 phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Phosphate ABC
FT                   transporter, inner membrane subunit PstA; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64535"
FT                   /db_xref="GOA:E8R7P0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P0"
FT                   /protein_id="ADV64535.1"
FT                   /translation="MARDARHTANIAGLAAVAVVGGIGVASLLSLLYSVVANGLPPLLM
FT                   EGASFITGLPATPMGSSIGGIAPALIGTIASSAIATVLALLLSLFTSLFTREYPYSRTA
FT                   GFIEAVVRAFNGVPTIVASMFTYTIIVVRMGRPSVLAASIALFIAVLPTAHYYLSSALR
FT                   SVEERYREAAFSLGFRRIHVLRYIYLGIARRQVASGVLMTFIRATGETAPLLFTMGFLT
FT                   NTVFQGLDQPGNAVSLLIFNYALSPYSNYHEAAWAASLLLLLAVLTPALAIEFLMREVR
FT                   K"
FT   sig_peptide     202864..202974
FT                   /locus_tag="Desmu_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            203712..204464
FT                   /locus_tag="Desmu_0217"
FT   CDS_pept        203712..204464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0217"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /EC_number="3.6.3.27"
FT                   /note="COGs: COG1117 ABC-type phosphate transport system
FT                   ATPase component; InterPro IPR017871: IPR003439: IPR003593;
FT                   KEGG: dka:DKAM_0064 phosphate import ATP-binding protein
FT                   PstB; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Phosphate import ATP-binding protein pstB; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64536"
FT                   /db_xref="GOA:E8R7P1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P1"
FT                   /protein_id="ADV64536.1"
FT                   /translation="MPHIVEARGLTVRLGGRVVLSNLDIGVKSNTISVIMGPSGSGKST
FT                   LLRVFNRLIDLNPEAEVSGVVRIMNRDLYEWNPYELRRHVVLVQQEPTPFPNLSIFDNV
FT                   ALPARLNKVAGSRGELERLVKWALESVMLWDEVKDRLEKPPTILSGGQKQRLCMARALA
FT                   LRPEILLLDEPTANIDPANTVKIEESLKALKNDVTIILVTHMPHQAARVGDYVYILYGG
FT                   RVVEEGPVNDVFIHPRHEVTIKLLEKGG"
FT   gene            204466..205071
FT                   /locus_tag="Desmu_0218"
FT   CDS_pept        204466..205071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0218"
FT                   /product="PhoU family protein"
FT                   /note="InterPro IPR008170; KEGG: dka:DKAM_0063 phosphate
FT                   transport system protein PhoU; PFAM: PhoU family protein;
FT                   SPTR: Phosphate transport system protein PhoU; PFAM: PhoU
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64537"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P2"
FT                   /protein_id="ADV64537.1"
FT                   /translation="MNPELARLRSQASRLYLEAVGLVRDLSRLLEPGDSVRGMMDEEIH
FT                   EKTEILFISCNELFNSVLVFIARNQPLGPELVEASNLLYLVYDIYRYARYAREIFLADK
FT                   KGVRLSTPGLREIVAPALGIAVEAMEKAYKAYFEDCTECVEELKRLGEESDRLYMAQLE
FT                   KTSANTMLRNTDAIALLVLRHIERIVDHAERISTLPKK"
FT   gene            205136..205225
FT                   /locus_tag="Desmu_R0012"
FT   tRNA            205136..205225
FT                   /locus_tag="Desmu_R0012"
FT                   /product="tRNA-Gln"
FT   gene            205365..206081
FT                   /locus_tag="Desmu_0219"
FT   CDS_pept        205365..206081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0219"
FT                   /product="Ala-tRNA(Pro) hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /note="COGs: COG2872 metal-dependent hydrolase related to
FT                   alanyl-tRNA synthetase HxxxH domain; InterPro IPR018165:
FT                   IPR018164: IPR012947; KEGG: dka:DKAM_0059 threonyl/alanyl
FT                   tRNA synthetase; PFAM: Threonyl/alanyl tRNA synthetase SAD;
FT                   Alanyl-tRNA synthetase, class IIc-like; SPTR:
FT                   Threonyl/alanyl tRNA synthetase; PFAM: Threonyl and Alanyl
FT                   tRNA synthetase second additional domain; tRNA synthetases
FT                   class II (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64538"
FT                   /db_xref="GOA:E8R7P3"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P3"
FT                   /protein_id="ADV64538.1"
FT                   /translation="MTELVYQYDSYIKECDAVVEAVQGNKVFLDRTVFHPRSGGVENDT
FT                   GFIIAGDVRVRVLNVYYDKETGDVAHEVDDASSITIGSRVKLLLDWDRRYRLMRLHTAA
FT                   HVLSAVMYMDHGALITGGNITPEYGYDDYSLQTFSSGVFEEAVRKANEIVARNIEVKVY
FT                   WLPREEAMRIPGVVKLAGRMPPNVEKLRIVEIPGVDIQADGGPHVRHTSEIGVIKLLRT
FT                   ENKGKNKKRLYFSVEP"
FT   gene            206127..206234
FT                   /locus_tag="Desmu_R0013"
FT   tRNA            join(206127..206165,206185..206234)
FT                   /locus_tag="Desmu_R0013"
FT                   /product="tRNA-Ser"
FT   gene            complement(206317..207912)
FT                   /locus_tag="Desmu_0220"
FT   CDS_pept        complement(206317..207912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0220"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="COGs: COG0504 CTP synthase (UTP-ammonia lyase);
FT                   InterPro IPR017926: IPR004468: IPR017456: IPR000991; KEGG:
FT                   dka:DKAM_0057 CTP synthetase; PFAM: CTP synthase-like;
FT                   glutamine amidotransferase class-I; PRIAM: CTP synthase;
FT                   SPTR: CTP synthase; TIGRFAM: CTP synthase; PFAM: Glutamine
FT                   amidotransferase class-I; CTP synthase N-terminus; TIGRFAM:
FT                   CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64539"
FT                   /db_xref="GOA:E8R7P4"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P4"
FT                   /protein_id="ADV64539.1"
FT                   /translation="MVKYVFVTGGVLSGLGKGVVAASTGLLLKSLGYRVTAVKVDPYLN
FT                   VDAGTMNPYMHGEVFVTEDGGETDLDIGHYERFLGVELSRRNNITSGQIYHEVISKERR
FT                   GEYLGQCVQIIPHVTNEIKERIRETAREQGADVVIVEIGGTVGDIEGLPFLEAARQMRF
FT                   EEGSSNTLFLHVALAPVLASGEVKTKPVQHSIQELRRIGIQPDAVVVRSSRTLDEEARY
FT                   KVALFGNIPVEAVFSNPDIDLIYRVPLILHREGLTRYVASRLGLEYREPDLSAWESLVE
FT                   KYSKASRRVKVAMVGKYTRVRDSYISIVEALRHAGIWSDVRVELQWFEATEIEADKSLT
FT                   SRVLEADGIIVLPGFGRRGSEGKIHVIKAAREAGKPLLGICFGMQLMTVEAARNLAGLE
FT                   NANSTELDPATPHPVIDLLPEQRGIGQLGGTLRLGARKIIIEPGSLAWSIYGTREVYER
FT                   HRHRYGLNPKYIDILEKAGLRVTGWSEEGHAEIIELKEGKVFYYGTQAHPEFKSKPLKP
FT                   SPVYKRFIEALSST"
FT   sig_peptide     complement(207850..207912)
FT                   /locus_tag="Desmu_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            207970..208512
FT                   /locus_tag="Desmu_0221"
FT   CDS_pept        207970..208512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0221"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG2236 phosphoribosyltransferase; InterPro
FT                   IPR000836; KEGG: dka:DKAM_0058 phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; SPTR:
FT                   Phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64540"
FT                   /db_xref="GOA:E8R7P5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P5"
FT                   /protein_id="ADV64540.1"
FT                   /translation="MQTKVRTRYVAWRVLHGLLRDLATRINSGYRPDIIIAVAKGGLIP
FT                   ARILVDLLGVEEMGLIEVKFYKGVGEAREKPYVTFTALPPIDGKKLLVVDDIADSGRTL
FT                   QVVADVLSRFKYMDLRFATLYVKPWSTIMPDYYGEIVEEWIVFPWEICEATGEGVRLEG
FT                   IDVEDVLNYCVEKTGTH"
FT   gene            208666..208750
FT                   /locus_tag="Desmu_R0014"
FT   tRNA            208666..208750
FT                   /locus_tag="Desmu_R0014"
FT                   /product="tRNA-Leu"
FT   gene            208881..209687
FT                   /locus_tag="Desmu_0222"
FT   CDS_pept        208881..209687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0222"
FT                   /product="photosystem I assembly BtpA"
FT                   /note="COGs: COG0434 TIM-barrel enzyme; InterPro IPR005137;
FT                   KEGG: pab:PAB1665 hypothetical protein; PFAM: photosystem I
FT                   assembly BtpA; SPTR: Uncharacterized protein PYRAB10620;
FT                   PFAM: BtpA family; TIGRFAM: membrane complex biogenesis
FT                   protein, BtpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64541"
FT                   /db_xref="GOA:E8R7P6"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P6"
FT                   /protein_id="ADV64541.1"
FT                   /translation="MLFTSKFVIGVIHLPRLPSTLYRAEGLEQVVERAVSEAMTLEELG
FT                   FSGVLVENYGDYPYEKRVLDPLTISAMSIVVREVVKSVSIPVGLNLLRNSGREAYAIAI
FT                   ATGARFIRVNALTETLVTDSGILEPEAPLLRVLRANYPGISVFGDVMCKHGVSLNTVLY
FT                   AGTREDAVRVAVEDLVERGGADYVVVTGARTGEAPGLDMVSLVKRYSSRPVVIGSGSNP
FT                   GNLGALLSVADGVIVGSYIRVGGRAGNPLDPARARAYISAFKSATG"
FT   sig_peptide     208881..208949
FT                   /locus_tag="Desmu_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            209818..210765
FT                   /locus_tag="Desmu_0223"
FT   CDS_pept        209818..210765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0223"
FT                   /product="Transcription initiation factor IIB (TFIIB)"
FT                   /note="COGs: COG1405 Transcription initiation factor TFIIIB
FT                   Brf1 subunit/Transcription initiation factor TFIIB;
FT                   InterPro IPR000812: IPR006670: IPR013137: IPR013150; KEGG:
FT                   dka:DKAM_0056 transcription initiation factor IIB; PFAM:
FT                   Transcription factor TFIIB cyclin-related; SMART: Cyclin
FT                   domain protein; SPTR: Transcription initiation factor IIB
FT                   (TFIIB); PFAM: TFIIB zinc-binding; Transcription factor
FT                   TFIIB repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64542"
FT                   /db_xref="GOA:E8R7P7"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P7"
FT                   /protein_id="ADV64542.1"
FT                   /translation="MFTDTPTQSPEAQSSGEESKKPKCPQDKIVYDAAHGEYVCQDTGE
FT                   VIEEKVIDERPEWRAFTPEERGRRARTGGPVTAAVHDMGFATSIDYTDRDAAGRRLTEK
FT                   KHELVKLRKWQARTRILTSVERNLAQAMNELDRLADVLNLPSYVKEEAARIYREAVDRG
FT                   LVRGRSIESVIAAAIYLACREMKVPRSLDEITRHTRIGRKEIARCYRLLLRELRIKVST
FT                   TDPADYVPRIVHGLGLPGQAVKLAIEIINTAKEHGVTGGKDPAGLAAAAVYMAAERLGE
FT                   KKTQKEIAHIAGVTEVTVRNRYKELAKVLGVEYE"
FT   gene            complement(210713..212047)
FT                   /locus_tag="Desmu_0224"
FT   CDS_pept        complement(210713..212047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0224"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: pcl:Pcal_0427 IS605
FT                   family transposase OrfB; PFAM: transposase IS605 OrfB;
FT                   SPTR: Transposase, IS605 OrfB family; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: Putative transposase DNA-binding
FT                   domain; Probable transposase; TIGRFAM: transposase, IS605
FT                   OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64543"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P8"
FT                   /protein_id="ADV64543.1"
FT                   /translation="MGGEGFLTLCVVFRVSPEPVGEPLLLSLLRRYRDALNYSIKRIHG
FT                   YMEENGLKKTPGDGAVHGLLYEELKSRFGLPSRIAVDCYREAKSILKSWLGNGGNGGLP
FT                   RARRPRMWLTEKQGYRVRDGYVEIIGGLRLKIIGWDRRYDQYPSRQAVLTYRSGKFLLR
FT                   VAKRVPKPQPISPVDVLAVDVNEKYIVAGNHRVEYRFETAVEKAVRYRELAERLQRKYS
FT                   NGSYRAWLRRRGIRDRVRRFHEKARSIIEDWARKVSREIALTARRDGYAVAREDLTYLV
FT                   ESLRRLPRQHKTKLILLGYRRLGYWLDWQCEKHGVPHIAVDPRNTSSTCPLCGSRLIEN
FT                   GYRRMKCPNCGFEADRDTVAVLNIRRKALLQMGGSLTTPTAPQMTDVAPNRCGEPVNRP
FT                   KGNPFRAGRRSDLGDASLTAWLNDSTYTATRIPRQALWRAPYTCS"
FT   sig_peptide     complement(211997..212047)
FT                   /locus_tag="Desmu_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(212127..212444)
FT                   /locus_tag="Desmu_0225"
FT   CDS_pept        complement(212127..212444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0225"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="COGs: COG0023 Translation initiation factor 1
FT                   (eIF-1/SUI1) and related protein; InterPro IPR001950:
FT                   IPR017228; KEGG: dka:DKAM_0055 translation initiation
FT                   factor SUI1; PFAM: translation initiation factor SUI1;
FT                   SPTR: Translation initiation factor 1 (EIF-1/SUI1); PFAM:
FT                   Translation initiation factor SUI1; TIGRFAM: translation
FT                   initation factor SUI1, putative, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64544"
FT                   /db_xref="GOA:E8R7P9"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7P9"
FT                   /protein_id="ADV64544.1"
FT                   /translation="MEKNMDETPCGGLPPELCEQASLEQSLVKIRLDTRKFGKAVTIVD
FT                   GLPNDKEFLKQVAKALKTKLATGGTFKEGRIELQGDHRHRVKQILIEDFGIPPENILVI
FT                   D"
FT   gene            212533..212682
FT                   /locus_tag="Desmu_0226"
FT   CDS_pept        212533..212682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0226"
FT                   /product="DNA-directed RNA polymerase, subunit P"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: dka:DKAM_0054 DNA-directed RNA polymerase
FT                   subunit P; SPTR: DNA-directed RNA polymerase subunit P"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64545"
FT                   /db_xref="GOA:E8R7Q0"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Q0"
FT                   /protein_id="ADV64545.1"
FT                   /translation="MVKYKCGRCGYVFDDEEMKRIFGRQVKCPNCTYEIVYKIARPYRI
FT                   VKAI"
FT   gene            complement(212675..213547)
FT                   /locus_tag="Desmu_0227"
FT   CDS_pept        complement(212675..213547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0227"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="COGs: COG0010
FT                   Arginase/agmatinase/formimionoglutamate hydrolase arginase
FT                   family; InterPro IPR020855: IPR006035: IPR005925; KEGG:
FT                   dka:DKAM_0053 agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; SPTR: Agmatinase;
FT                   TIGRFAM: agmatinase; PFAM: Arginase family; TIGRFAM:
FT                   agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64546"
FT                   /db_xref="GOA:E8R7Q1"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Q1"
FT                   /protein_id="ADV64546.1"
FT                   /translation="MNWRLMLQPSTRFACMEPGVSVGVLVGVPMDYTSTYKPGSRFAPD
FT                   SVRNAACNIEFYSLATGRLMENEGLIDLGNIVLPPGDVEGSLRIIGDVVKGVVDEYPGM
FT                   LLGFLGGEHLITYPIVKALKSSVDTLVVFDAHLDMRGEYLGSRVNHASFLRRLVEDGVR
FT                   VIHIGSRAYSGDELEFLKKTRDVTVYSILEALKGPLALGDLGKTYISIDMDVLEPSYAP
FT                   GVGNPEPFGLTPLHLLELLKRIVEASSRVIGFDIVEVNPLVDVNDVTSIMAGKLVFELA
FT                   ALAGSARTR"
FT   sig_peptide     complement(213506..213547)
FT                   /locus_tag="Desmu_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            213624..215372
FT                   /locus_tag="Desmu_0228"
FT   CDS_pept        213624..215372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0228"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="COGs: COG0423 Glycyl-tRNA synthetase (class II);
FT                   InterPro IPR006195: IPR002315: IPR002314: IPR004154; KEGG:
FT                   dka:DKAM_0052 glycyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein;
FT                   SPTR: Glycyl-tRNA synthetase; TIGRFAM: glycyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; tRNA synthetase
FT                   class II core domain (G, H, P, S and T); TIGRFAM:
FT                   glycyl-tRNA synthetase, dimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64547"
FT                   /db_xref="GOA:E8R7S1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S1"
FT                   /protein_id="ADV64547.1"
FT                   /translation="MSGGNEQDVYSNILELAKKRGIFWGSFEIYGGLAGFYDFGPVGVL
FT                   LKRGLIDAWLRTFVYSNDLVVEVETPMINPRIVFKASGHEESFMDPVVECLKCGRIYRA
FT                   DHLIKEAAGVEVEGWSPEEMRKVIVEHGIKCPECGGDLGKPFYTLLLFKTEIGPYKGEV
FT                   GYLRPENAQGMFINFANVLRMMRNKLPLGIAQVGRVARNEISPRQGLLRLREFTIMEFE
FT                   FFFDPEEASKESAEYIREVEDRKVRVLTSEARLKGVEEPAEYTVRELVEKGIVKTPWLA
FT                   YWMGVGEAFVESLGVPREKVRFIEKHPHERAHYSLQTFDQEVYTEKYGWIEVAGYAYRT
FT                   TYDLSRHMQYSKADLTFFKRYEKPVERTVSKAYPDPARIGVLYGEGRARIMEKLASRTP
FT                   EDLYRELSGKGYVEVEGVRIPPDAFIVKQEVERVHGEKIIPHVVEPSFGVERLLYVVLE
FT                   HAYTVRDGKVVLRLPRHLAPYHVAVFPLVAGRRPEHARIVEVARDIYRRLVKKGFRAIY
FT                   DDDGSIGRRYARADEVGVPFAVTVDYQTLEDGTVTVRDRDTALQERVSVDRLEEYFLEK
FT                   YGRQPL"
FT   gene            215448..215840
FT                   /locus_tag="Desmu_0229"
FT   CDS_pept        215448..215840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0051 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64548"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S2"
FT                   /protein_id="ADV64548.1"
FT                   /translation="MSQPQSEGGKETPEQQKVDVSKLASIIPPASELRKKEKKLSEKRI
FT                   RIRFDQSLNEPVARIPSALASMLDIKSDDTVEIVVAGRKKFLFKAVVFESTDENTVYIY
FT                   PKEVEKNGVADNSIATLRKSQAKSGR"
FT   gene            215837..216214
FT                   /locus_tag="Desmu_0230"
FT   CDS_pept        215837..216214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0050 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64549"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S3"
FT                   /protein_id="ADV64549.1"
FT                   /translation="MMTHLNELVAYMRSLVDDYERLIDQAKIIRADHDGERVRLFIAHA
FT                   DRVLDSSRRILPEAKTVMASGSSDVLVKHISVYYRMIKYVSIRYMVDLLEEALPSLTGN
FT                   PGTLAEMQRLLAGFRELRDTL"
FT   gene            complement(216198..217784)
FT                   /locus_tag="Desmu_0231"
FT   CDS_pept        complement(216198..217784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0231"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR006638: IPR006158: IPR007197; KEGG: dka:DKAM_0049
FT                   radical SAM domain protein; PFAM: Radical SAM domain
FT                   protein; cobalamin B12-binding domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: Radical SAM domain
FT                   protein; PFAM: Radical SAM superfamily; B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64550"
FT                   /db_xref="GOA:E8R7S4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S4"
FT                   /protein_id="ADV64550.1"
FT                   /translation="MLVVDALARSTGRRYSTHDVVGAGPRLVAGILSERTEAMLLPYER
FT                   VVGDKGVLAEASYLFISIMSSDLGALDRLVTYARRVNPSLKVVAGGPASFQYASLLMEH
FT                   GVDYVIVGEAEIPLPRFLDCIVEEKCDPSTVPALGFRVNDSVRLTSSHIHTPRDVLSSI
FT                   KPWTRVDETLVHPQVYRIYVEVVRGCSNYSRPMVKGHGGLNCVFCGNCRSDVGVKRLTC
FT                   PAGIPPGCGFCSVPSMFGPARSRSIESIVREVEELVEHGARRIVLSAPDFLDYGRDLLV
FT                   EGVLTHPCEPPANINAIEGLLSGISSLGPVSQGKVVVMIENIKACLVNEDVARVLGRYL
FT                   RGTPIHIGLETGNDVFNERVLGKPVRVRHVLEAVRLLKGHGLRPYVYLMHSLPLASKTV
FT                   YEDTIRVVNELGRIGVEKITLYKYTPLPNTAFEKLPPESKGVEKYIAELKTAVTRHNTR
FT                   QKMMLLGSTLEAYVVENSGKLYGYPARHGPVIFLGSAPRKGLNGCLTLVEVTGVGDRYV
FT                   KGRILRVKECP"
FT   gene            complement(217860..218297)
FT                   /locus_tag="Desmu_0232"
FT   CDS_pept        complement(217860..218297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0232"
FT                   /product="tRNA intron endonuclease"
FT                   /note="COGs: COG1676 tRNA splicing endonuclease; InterPro
FT                   IPR016442: IPR006676: IPR006678: IPR006677; KEGG:
FT                   shc:Shell_1338 tRNA intron endonuclease; PFAM: tRNA intron
FT                   endonuclease, catalytic domain-containing protein; tRNA
FT                   intron endonuclease domain-containing protein; SPTR: tRNA
FT                   intron endonuclease; TIGRFAM: tRNA intron endonuclease;
FT                   PFAM: tRNA intron endonuclease, catalytic C-terminal
FT                   domain; tRNA intron endonuclease, N-terminal domain;
FT                   TIGRFAM: tRNA intron endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64551"
FT                   /db_xref="GOA:E8R7S5"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016442"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S5"
FT                   /protein_id="ADV64551.1"
FT                   /translation="MAKPRDRSVNAPLELSLIEALYLVEMNRVAVLQGDRQLAQGELRD
FT                   IALGKIPRFEELYAVYRDLRRRGLIPRRGLKFGCDYLVYRHGPGIDHAPFGVQVFRVNE
FT                   IVDPVELVRMGRLLHSVRKKLVIAIYNEGAVAYHLLEWWRP"
FT   gene            complement(218405..219073)
FT                   /locus_tag="Desmu_0233"
FT   CDS_pept        complement(218405..219073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0233"
FT                   /product="putative phosphate transport regulator"
FT                   /note="KEGG: dka:DKAM_0048 putative phosphate transport
FT                   regulator; SPTR: Putative phosphate transport regulator;
FT                   PFAM: Protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64552"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S6"
FT                   /protein_id="ADV64552.1"
FT                   /translation="MSETPEPGSLAELTAIEYLNNMMSILSDEVSLLTALMNQYSTGTD
FT                   IEKTYEKMRLIKQRGEETKIMLMEYLVKNSEVMMYSSSYIEMVRTIDRFIQHADSVAYR
FT                   LVIASKNNIGIRGDLKSTLDSMLQRIRQQVDLIRDALAKLSTHPRRSIDHVDEVLKLED
FT                   DVDRVFRELIFKVYETYAGSVTGLMVLKDLIEYVEELSDLLKYLGEEIRYLALVKTVAK
FT                   "
FT   gene            219256..219693
FT                   /locus_tag="Desmu_0234"
FT   CDS_pept        219256..219693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0046 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64553"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S7"
FT                   /protein_id="ADV64553.1"
FT                   /translation="MSYSSGGQWRDRHQRDDRRPRYDRGWHHGRTGQGNLQHLEEKRLE
FT                   PQPIGERCNPLCPFFTCSRNALMVTSKPVRGKMIRVAQCRLTGGDCISGECQYASCKLN
FT                   ALLPDGRCAKALEKKAKHTSDEEMFKQIKQMEDYDLYDLIK"
FT   gene            complement(219686..220270)
FT                   /locus_tag="Desmu_0235"
FT   CDS_pept        complement(219686..220270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0235"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="COGs: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; InterPro IPR004507: IPR003382; KEGG:
FT                   dka:DKAM_0045 3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
FT                   PFAM: flavoprotein; SPTR: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: Flavoprotein; TIGRFAM: polyprenyl
FT                   P-hydroxybenzoate and phenylacrylic acid decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64554"
FT                   /db_xref="GOA:E8R7S8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S8"
FT                   /protein_id="ADV64554.1"
FT                   /translation="MGNPSLIIAMTGASGIIYALRLLERSSLLKSKYREIHVIYTSNAV
FT                   KVALHEENLDLPGFLSKATGVDAVYRDDDLTSRLASSSNLVSTDMVIVPASMNTVAKIA
FT                   NGIQDNLVTRVADSILRLRNRLIVVFRETPLSAIDLFNLYRLALSGAIVVPASPGFYIR
FT                   PGSVEDLVDFIVGKVLDVLGVEHNLYKRWAT"
FT   gene            220379..220681
FT                   /locus_tag="Desmu_0236"
FT   CDS_pept        220379..220681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0038 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64555"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7S9"
FT                   /protein_id="ADV64555.1"
FT                   /translation="MYFIRGIPVRVLNAMVNELRRNGLWAERHSYSIRIMYNGVFIASL
FT                   HLYPGFNEAVLRLISGDPDAVSTARNTVVGVLKKYLPEYVVKEVELGRAGGTYNH"
FT   gene            complement(220649..221722)
FT                   /locus_tag="Desmu_0237"
FT   CDS_pept        complement(220649..221722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0237"
FT                   /product="translation factor SUA5"
FT                   /note="COGs: COG0009 Putative translation factor (SUA5);
FT                   InterPro IPR006070: IPR010923: IPR004388: IPR005145; KEGG:
FT                   dka:DKAM_0039 putative translation factor; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain-containing protein;
FT                   SPTR: Putative translation factor; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein; PFAM: yrdC domain; SUA5
FT                   domain; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64556"
FT                   /db_xref="GOA:E8R7T0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T0"
FT                   /protein_id="ADV64556.1"
FT                   /translation="MTIVLRTDAVNPDKEVIDKAAEILLNRGLVAFPTETVYGLGAVAY
FT                   YEDAVLKVFKAKMRPPDNPLIIHVSSLDMLNEVATGIPDDAYRLIEKFWPGPLTLILPR
FT                   HPSIPRVVTGGLDTVAVRMPGHPVALKLIDATGRPVAAPSANISGRPSPTTGEHVIRDL
FT                   MGRVDAIIDAGETFFGVESTVVNILEDPPVLLRPGAYPVEEVEKALGKKIVIPEFARGL
FT                   AYSEIALAPGMKYRHYSPEAKLILVEAEGSYEYIAGRVIEAARSLGGVGELCVISSSET
FT                   MHYYRSLSNVKAVFTLGSRVNLYEVARNLFKVLRLVDEAGCRVVFSESFPETGIGLAVM
FT                   NRLRKASSMIIRASSPP"
FT   gene            221818..222612
FT                   /locus_tag="Desmu_0238"
FT   CDS_pept        221818..222612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0238"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction; InterPro IPR020588: IPR010624:
FT                   IPR004504: IPR014774; KEGG: dka:DKAM_0040 putative
FT                   circadian clock protein, KaiC; PFAM: Circadian clock
FT                   protein KaiC central region; SPTR: Putative circadian clock
FT                   protein, KaiC; PFAM: KaiC; TIGRFAM: KaiC domain protein,
FT                   PAE1156 family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64557"
FT                   /db_xref="GOA:E8R7T1"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T1"
FT                   /protein_id="ADV64557.1"
FT                   /translation="MNTERIPSGVPGLDELIDGGIPRGFMVAVVGEPGTGKTAMSIQFI
FT                   AKGLETGDKAVYVTTEESRESILRQAERFNIGLKPYIEEGRLVVVDALMGEYGDVWSLK
FT                   ELDVEELVSTVIEAKKYLGPGHARLVVDSMSAFWLDKPAMARKYSYHVKRVLSKWGFTM
FT                   LVTSQYAVTTQLGFGFGIEHVADGVIRLRKSVVKGFLKRFLVIEKMRLTNHDQRVFEIE
FT                   VVDGVGVRVNGPVKASRWDLALPPDVVARLIESGFDRLEYEG"
FT   gene            complement(222609..225053)
FT                   /locus_tag="Desmu_0239"
FT   CDS_pept        complement(222609..225053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0239"
FT                   /product="domain of unknown function DUF1726"
FT                   /note="COGs: COG1444 P-loop ATPase fused to an
FT                   acetyltransferase; InterPro IPR000182: IPR013562; KEGG:
FT                   dka:DKAM_0041 predicted P-loop ATPase fused to an
FT                   acetyltransferase; PFAM: domain of unknown function
FT                   DUF1726; GCN5-related N-acetyltransferase; SPTR: Predicted
FT                   P-loop ATPase fused to an acetyltransferase; PFAM: Putative
FT                   ATPase (DUF699); Acetyltransferase (GNAT) family; Domain of
FT                   unknown function (DUF1726)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64558"
FT                   /db_xref="GOA:E8R7T2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T2"
FT                   /protein_id="ADV64558.1"
FT                   /translation="MGKAVPASFLKFLTQCGKAAGKLVKHRVRGMIVISGSSPEKLASL
FT                   SARLISFYLKKWRRLDKGRPGFTGLYVYHDEFDDALVMREEFEKLVRGVKNLDMQFTIY
FT                   EKSDKYLGATVSVLVMDLTHDLKPNDLGRLIGIVEGGGIIILLTPPWDKWDEAKTIFKM
FT                   NLTVPQYPEPRHIFIKWVKKHLLEFDGIGIYDADGNRVLKKLELKSEFKPYERKITIPE
FT                   DSLFPSEIYEHALTMDQVRVLKIMEEFYEKPKPGKKKVFVLIADRGRGKSCAIGIGAVG
FT                   LIHLLRKIKPKPRILVTAPEPGNIQSLMALAMRVLDKLGYRYEVIKREGYVIELRSDKF
FT                   SIEYWEPLAIPRINGDVVIVDEAAGIHVPLLYKIWESHRRIVFSSTIHGYEGAGRGFSV
FT                   RFLKKIKSDENTILYEYEMTEPIRYNYGDPIEEWQFKTLLLDAEPADLSEEDLRDIEAG
FT                   NLTYVKYEPEELFSREDELRQLFGIYVLAHYRNEPDDLGMIADAPHHTVRAVKTSSGRI
FT                   VCAVQIAREGPIDDETALELLKGSKIPGNIIPDRFLKHLRYMDFAKTTGWRIVRIATHP
FT                   AVQGKGIGSWVLGKIKEEAAELGLDWVGSGFGVNEQLLRFWVKNGYVPVHISPDRNPVS
FT                   GEYTVLVIQPISEVALKLVEKARGEFKLKMLNSIPVNYREMEPEIALMFLDSEPYVYRE
FT                   KPLHLFTPVTLDRLWTYCQGPMTFEAAADIMFKLARIHWLISPESRPKLTRLQEVVLLA
FT                   KALQGLTWDELHGVTRVPVKELQKEGHEIACTYFKYLTGLNPDEYTPGVRDYSYGFSEL
FT                   SF"
FT   gene            complement(225115..227355)
FT                   /locus_tag="Desmu_0240"
FT   CDS_pept        complement(225115..227355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0240"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR003960: IPR003593: IPR005938: IPR003338: IPR
FT                   004201: IPR003959; KEGG: dka:DKAM_0042 cell division
FT                   control protein 48, AAA family; PFAM: AAA ATPase central
FT                   domain protein; AAA ATPase VAT domain protein; cell
FT                   division protein 48 CDC48 domain 2; PRIAM:
FT                   Microtubule-severing ATPase; SMART: AAA ATPase; SPTR: Cell
FT                   division control protein 48, AAA family; TIGRFAM: AAA
FT                   family ATPase, CDC48 subfamily; PFAM: Cell division protein
FT                   48 (CDC48), N-terminal domain; ATPase family associated
FT                   with various cellular activities (AAA); Cell division
FT                   protein 48 (CDC48), domain 2; TIGRFAM: AAA family ATPase,
FT                   CDC48 subfamily; 26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64559"
FT                   /db_xref="GOA:E8R7T3"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T3"
FT                   /protein_id="ADV64559.1"
FT                   /translation="MSTQRKGEKSIKLRVAEARQRDIGRKIARIDRETMAKLGVSLGDF
FT                   IEVTGPKGSEIVKVWQAYPEDEGSGLIRIDGFVRRKIGVSPGDYVTVKPVYVEPATRVV
FT                   LAPVGDLPVYGDLAPYLKKQLLGNPVKRGDIVEAPIFGMLLRFAVTSTQPPSVVYITEN
FT                   THVEVKTEPVRPEALGEGVSRVTWEDIGDLEEAKQKIREIVELPMKYPELFEHLGIEPP
FT                   KGILLYGPPGTGKTLLAKALANEIGAYFITINGPEIMSKFYGESEERLRKIFEEAQANA
FT                   PAVIFIDEIDSIAPKREEVTGEVEKRVVAQLLTLMDGLKERGKVIVIGATNRPDAIDPA
FT                   LRRPGRFDREIEIPPPDKRARKEILAVHTRNMPLTEDVDLDKIADMTHGYTGADIAALA
FT                   KEAAMNALRRFMKEEGIEIEKGQPIPAEKLEKLKVTMEDFLVAMKSVQPSLIREVFVEV
FT                   PNVRWDDIGGLDDVKQELREAIEWPMKYPGVFEKMGIEPPKGILLFGPPGTGKTLLAKA
FT                   VATESGANFIAIRGPEVLSKWVGESEKAIRQIFRRARMVAPAVVFFDEIDSIAGVRGSD
FT                   PSGVTDRIVNQMLTELDGIQPLRKVVVIAATNRPDLLDPALLRPGRFDRLIYVPPPDYN
FT                   ARLQIFKVHTRKMPLGEDVNLEELARKTEGYTGADIAAVCREASMIALRENYAATGRLD
FT                   VTKIGMSHFMKALEKIPPSLSRSDIEMYERLARELKRVSGSGSFKRLSLTYG"
FT   gene            227443..228192
FT                   /locus_tag="Desmu_0241"
FT   CDS_pept        227443..228192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0241"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction; InterProIPR020588: IPR010624:
FT                   IPR003593: IPR004504: IPR 014774; KEGG: dka:DKAM_0043
FT                   hypothetical protein; PFAM: Circadian clock protein KaiC
FT                   central region; SMART: AAA ATPase; SPTR: Putative circadian
FT                   clock protein, KaiC; PFAM: KaiC; TIGRFAM: KaiC domain
FT                   protein, Ph0284 family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64560"
FT                   /db_xref="GOA:E8R7T4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T4"
FT                   /protein_id="ADV64560.1"
FT                   /translation="MVERVKTGVPGLDEILNGGIPRRNVVLLSGGPGTGKTILALQFLW
FT                   SGLQLGEPGIYVALEEHPVQVRVNMRGFGWDTRQFEQEGKFAVIDAFTGGIGEAAKREK
FT                   YVVKETDSVEELIDVLRTAIREVNAQRVVVDSVSTLYLLKPSIARNVVLQLKKVLSGMG
FT                   TTSLLVSQVSVTERGFGGPGVEHAADGIIRLDLDEVDGELVRSIIIWKMRGTSHSMKRH
FT                   VMEITDKGIVVHPDKVLKTRRYVLMQE"
FT   gene            complement(228205..228552)
FT                   /locus_tag="Desmu_0242"
FT   CDS_pept        complement(228205..228552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0044 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64561"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T5"
FT                   /protein_id="ADV64561.1"
FT                   /translation="MGPPLLSGVAMRLLLIVGDNELSEIVVESVSHAVKTIELSSGAKI
FT                   RLEIMRDNEVVYPTIKINGLSPIVITKPPNIVEIVKILRAHVEISELLRGKGPGGVRSH
FT                   GVSGSLAEMSP"
FT   gene            228621..229337
FT                   /locus_tag="Desmu_0243"
FT   CDS_pept        228621..229337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0243"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG1318 transcriptional regulator protein;
FT                   InterPro IPR000792; KEGG: dka:DKAM_0036 transcriptional
FT                   regulators-like protein; PFAM: regulatory protein LuxR;
FT                   SPTR: Transcriptional regulators-like protein; PFAM:
FT                   Biogenesis of lysosome-related organelles complex-1 subunit
FT                   2; TIGRFAM: probable regulatory domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64562"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T6"
FT                   /protein_id="ADV64562.1"
FT                   /translation="MSGETTPGEKTQVGGAQGSSGEVIDLTNVPLKPLGKREISQLEMA
FT                   LIIGTLYRPEILELIRDPVERSTWVDSLAVAAGAYARMKAGLPVSQIAEELGRSETTIR
FT                   SHLNMKTKAGKLVHETYEKLKKGELKLVVPFIRTPVAGCEEQVKALEGELEKQRNRLKE
FT                   LEAKISELTEAVKQREEEIQGLRSGAEALKRELEERVKELESCRSNVDSMRKTLEDAAR
FT                   LLQEALSMLQHVANHG"
FT   gene            229389..229661
FT                   /locus_tag="Desmu_0244"
FT   CDS_pept        229389..229661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0035 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64563"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T7"
FT                   /protein_id="ADV64563.1"
FT                   /translation="MGVILVKMDENGRVLDYTTDALKMDGKKFNTILGRAVDLARIELL
FT                   AFRSLGMSDVKSISITTTDFTVTIGRGAGGNLVIVTLKDEATAST"
FT   gene            complement(229658..230377)
FT                   /locus_tag="Desmu_0245"
FT   CDS_pept        complement(229658..230377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0245"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="COGs: COG0084 Mg-dependent DNase; InterPro
FT                   IPR012278: IPR001130; KEGG: dka:DKAM_0034 TatD-related
FT                   deoxyribonuclease; PFAM: TatD-related deoxyribonuclease;
FT                   SPTR: TatD-related deoxyribonuclease; PFAM: TatD related
FT                   DNase; TIGRFAM: hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64564"
FT                   /db_xref="GOA:E8R7T8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T8"
FT                   /protein_id="ADV64564.1"
FT                   /translation="MIIDAHIHCHELGRDELSRYAGRYILVCVSDDPASSRATLELAEE
FT                   YKGVTPCIGIHPWNVKNHGLSDLRSLLKEAVERGVKCLGEVGLDKRFTPESFSRQLEFF
FT                   REIAGYAREYGFALNIHAAGAWREVFEEVYGRDLDKVYFHWYTGPLDLLNNIVEAGYYV
FT                   GLNPAWRLQAKHREVIASVPLRNVLTESDAPYEYRGLKMTPEMITGSLELLASIHGVSV
FT                   EEVESTIWGNYVKILGA"
FT   gene            complement(230367..230912)
FT                   /locus_tag="Desmu_0246"
FT   CDS_pept        complement(230367..230912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0033 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64565"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7T9"
FT                   /protein_id="ADV64565.1"
FT                   /translation="MVTLEACVPGPGGECSRVEYSMRGNTVYVETDSPYVLFKHDSSLR
FT                   LLCEGSSMQVLQWAGERYTLWRMRPRGRCVTVPGGVMEDHGEYYVFTVGEQPSSWRLGN
FT                   AGRLLALALRLAGYTPIVVFDDDIASQLVNAVHGSNESLNEAKARRLLGEEAALKLREC
FT                   INILGERIIHERCLQHDY"
FT   gene            231086..231760
FT                   /locus_tag="Desmu_0247"
FT   CDS_pept        231086..231760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0247"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="COGs: COG0546 phosphatase; InterPro IPR005834; KEGG:
FT                   dka:DKAM_0032 phosphatases-like protein; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR:
FT                   Phosphatases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64566"
FT                   /db_xref="GOA:E8R7U0"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U0"
FT                   /protein_id="ADV64566.1"
FT                   /translation="MRIRLVVMDYDLSMVYNLSDFYEAYSGALKSYGGGFISFDEFLNL
FT                   LNEDRLSERIPGGVREEEFWLLFRRIYVSRHPIPMDGVVDLLRLLKSLPVKIAVVSGRE
FT                   TSGEYIWRDLRMLGLDEYVDEVYTVSDLQRLNGLEEYLFDKSWIISYILRKHGVAPCNA
FT                   LCIGDFTTDLLSCRKLGIPFIGVNKDEYRGMLLKKRGAAIVVKNLFEVVQWIPELEKDS
FT                   TC"
FT   gene            complement(231750..232031)
FT                   /locus_tag="Desmu_0248"
FT   CDS_pept        complement(231750..232031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0031 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64567"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U1"
FT                   /protein_id="ADV64567.1"
FT                   /translation="MANLSEEEIEELARRVRLKILHEDEEVVLMTAPNEEQLEEIIKEL
FT                   LGYKPMNLREIHTVLSGIASEDKIRRALNSLLDRGEAYITSDGRYIST"
FT   gene            232152..233459
FT                   /locus_tag="Desmu_0249"
FT   CDS_pept        232152..233459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0249"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1032 Fe-S oxidoreductase; InterPro
FT                   IPR020612: IPR006638: IPR006158: IPR007197; KEGG:
FT                   dka:DKAM_0030 Fe-S oxidoreductase family protein; PFAM:
FT                   Radical SAM domain protein; cobalamin B12-binding domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: Fe-S
FT                   oxidoreductase family protein; PFAM: Radical SAM
FT                   superfamily; B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64568"
FT                   /db_xref="GOA:E8R7U2"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U2"
FT                   /protein_id="ADV64568.1"
FT                   /translation="MTATRLILYYDKKTRYSVNALIAAADRVPGVRVEVADTPGRLMEE
FT                   VEEASRNREKCVVGYSLLTTMLVDESFLNTLKTILHHAESHGCLTIAGGPHASGDPVGV
FT                   LRSLGFKVVFIGEAEETIREFLGELVNDGDPLRVKGLAFYEDDRLVFTGRRKPVDLDNY
FT                   DPFPYWRGLINPVEVTRGCPYGCSYCQVSYMHGAFYRHRSIGRIVYYVRELARLGVRDY
FT                   RFITPDSLSYGLSTVRREPDVGLIDELLSSLHEVARDVGGRIFYGSFPSEVRPEHVTGE
FT                   AVRVLRRYVSNREIIVGAQSGSDRVLSMVRRGHSVDDVLNAVRVISENGFTPSVDVILG
FT                   IPGETREDQEETLRLIERILGMGGRIHVHYYLPLPGTPLGLKTPAPVPADVEARISRLI
FT                   GSGKAYGSWFNQKELSRRILELHRRGLIAPSQRANA"
FT   gene            complement(233486..233920)
FT                   /locus_tag="Desmu_0250"
FT   CDS_pept        complement(233486..233920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0250"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: dka:DKAM_0029 putative transcriptional
FT                   regulator, AsnC family; SPTR: Putative transcriptional
FT                   regulator, AsnC family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64569"
FT                   /db_xref="GOA:E8R7U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U3"
FT                   /protein_id="ADV64569.1"
FT                   /translation="MSDKTASEKETALLKYLLKHSGQEIYQSQLSKELGVDPKVVSRIL
FT                   IKLEKAGVVERTPVTYEGRKTFLVKPVRDKLVKAMEDSGIDPYTLREAFDTVADIPCVK
FT                   CPYIYKCYEGGYYDPATCQWLTEYLKTKAAAPRTLAAGSS"
FT   gene            complement(234018..234668)
FT                   /locus_tag="Desmu_0251"
FT   CDS_pept        complement(234018..234668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0251"
FT                   /product="Translin"
FT                   /note="COGs: COG2178 RNA-binding protein of the translin
FT                   family; InterPro IPR002848; KEGG: dka:DKAM_0028 haloacid
FT                   dehalogenase superfamily protein; PFAM: Translin; SPTR:
FT                   Translin; PFAM: Translin family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64570"
FT                   /db_xref="GOA:E8R7U4"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U4"
FT                   /protein_id="ADV64570.1"
FT                   /translation="MESIVGVIKGDLEAIDSILSRKDAVREEAYRLVRELTRSSGDIIV
FT                   LVHRGMGREAGSRLEAARNLVRRLNELLREHPDIYYTGMVYNGLSEYAEAELFYGITVE
FT                   GRAPSWRELEIPYVPYLQGLGDLVGELRRYVVELLDKGLIDEARKYFNVMEEVYINLRR
FT                   LDYPDALTPGLRHKVDVASRLVEDTRILILATRNAYAGTSLAGRETGEGVEHR"
FT   gene            234770..234855
FT                   /locus_tag="Desmu_R0015"
FT   tRNA            234770..234855
FT                   /locus_tag="Desmu_R0015"
FT                   /product="tRNA-Tyr"
FT   gene            234995..235702
FT                   /locus_tag="Desmu_0252"
FT   CDS_pept        234995..235702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0252"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="KEGG: dka:DKAM_0105 CopG domain protein DNA-binding
FT                   domain protein; SPTR: CopG domain protein DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64571"
FT                   /db_xref="GOA:E8R7U5"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U5"
FT                   /protein_id="ADV64571.1"
FT                   /translation="MNPGGGKREVRILVDEELYMELEKKALERGFRDVSSYITELLSEK
FT                   TLQQPGREGDLEKIRARLERFVQDEINKGLAPLETVRRQVSELVQRVEELEEKVKALEQ
FT                   QGERRPAETYGEARTGKPYKSGIERLRDDKVVFESTLPARVQRDRLFSYFERMGAVVLR
FT                   LGRERVAVDSGFWREFKEKLFGEVKSNSEEELKRVLGEKGYLLWKALYEDNMVIYDPKT
FT                   RSWKPASDELAGK"
FT   gene            235812..236195
FT                   /locus_tag="Desmu_0253"
FT   CDS_pept        235812..236195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0253"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: cbr:CBG15388 Hypothetical
FT                   protein CBG15388; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64572"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U6"
FT                   /protein_id="ADV64572.1"
FT                   /translation="MGKPKDLIVKWLDEAEAEMNKRPVDLGGGETEYMILLEVGRRHGV
FT                   EPLDDVCDLPEDVKEKIADVFDVDPDTLNDEEGCREFMDLVIRWDPDANRGWLGLWRLG
FT                   DTIVVVAAEYNDEKVELEYGVLT"
FT   gene            236301..237380
FT                   /locus_tag="Desmu_0254"
FT   CDS_pept        236301..237380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0254"
FT                   /product="RNA procession exonuclease-like protein"
FT                   /note="COGs: COG1236 exonuclease of the beta-lactamase fold
FT                   involved in RNA processing; KEGG: dka:DKAM_0106 RNA
FT                   procession exonuclease-like protein; SPTR: Exonuclease of
FT                   the beta-lactamase fold involved in RNA processing-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64573"
FT                   /db_xref="GOA:E8R7U7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U7"
FT                   /protein_id="ADV64573.1"
FT                   /translation="MLTAGDYRRLLELVYISEGGAVVLGRNISADGHADKPVRVVTHAH
FT                   IDHLKGLEESIRFSKTIVGTAVTLDLVEALNYVGRDLLPYYRLKRKPIGLNECMSIEGD
FT                   RMCLLPASHIPGSAQVYVEHEGFKLGYTGDFKLGEGTVVMKGLDALVIEATYGNPKHRR
FT                   PFKDVVPEMLAYLVEEGLARFRRVYIYGYHGKLQEAMLILRERGVEAPFVLPRKIFNAT
FT                   RLLEKHGFKIGNYVSEETGSSMGEGVVVFKHMNTAEYRRLDGGSLHIVLSGWEFNEPFR
FT                   RVDDYTYLIALSDHADFDDLVKYVEAGDPGLVVVDASRDGDAWSLRDALVDKGYCAIVM
FT                   PSGRVAEQLGECMGGLMKP"
FT   gene            237377..238489
FT                   /locus_tag="Desmu_0255"
FT   CDS_pept        237377..238489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0255"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dka:DKAM_0107 glycosyltransferase; PFAM:
FT                   glycosyl transferase group 1; SPTR: Glycosyltransferase;
FT                   PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64574"
FT                   /db_xref="GOA:E8R7U8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U8"
FT                   /protein_id="ADV64574.1"
FT                   /translation="MRYILVRHHMFNTYFMGPGGSEYVTLETALAFARRGFTVYIDSVT
FT                   LHTPSRLKELIHHYGLKPGEVRRVGLGDPGGDPLLIVNTSGDILSGRSDVLYLHYPSFL
FT                   SHEFYYPGLNGVFELAGKTYSLLNSIVFPFVMRKVKAYIANSSFTASFFRRYYGIEPHV
FT                   ITPPVNTDDILEAPPPARTEREAMVLSVARISPEKHVERVIYVARELSTRGVKPRFVVA
FT                   GSLSKYNKDYYEGLRELAVREGVDDIVEFKVNVARNELVELYRRSMIYLHPTPREHFGI
FT                   SIVEAMAAGTPAVIPLDSGSWRDIAMCDKGLALPYRSIGEASSAVRMLLEDSSLWMHLS
FT                   RAGATRARELDRHMFHEKLYYTLKPFIRAG"
FT   gene            complement(238563..239255)
FT                   /locus_tag="Desmu_0256"
FT   CDS_pept        complement(238563..239255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0256"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: dka:DKAM_0108 cobalt transport protein;
FT                   PFAM: cobalt transport protein; SPTR: Cobalt transport
FT                   protein; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64575"
FT                   /db_xref="GOA:E8R7U9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7U9"
FT                   /protein_id="ADV64575.1"
FT                   /translation="MRRPHVYSTFMYAVVMTLAAFLVKKPLWLAAASAVSISIGFAYGG
FT                   RRMLYLLALASIGLAGVFLNALVFANTGNVVLESGFIVVRKHAVEEFTVVSLRLLLIAG
FT                   AGGVFALTHSSSEIARGLVREIGLPYHVALAVSYALRSIPLIKRDLDEIMFMRKQRGYG
FT                   RIPLTPRGVSSVLTPLLSINYTRAVWGGVSAEVRGLRNTGGGRRVEIDSVDVLFFATIV
FT                   ALVVLAVY"
FT   sig_peptide     complement(239154..239255)
FT                   /locus_tag="Desmu_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(239252..240643)
FT                   /locus_tag="Desmu_0257"
FT   CDS_pept        complement(239252..240643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0257"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439: IPR003593; KEGG: dka:DKAM_0109 ABC transporter
FT                   related; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: ABC transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64576"
FT                   /db_xref="GOA:E8R7V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V0"
FT                   /protein_id="ADV64576.1"
FT                   /translation="MVHGDVYAEVKMAGYEAGSPILVDSRLEAWSGEACMLTGPSGSGK
FT                   TVFLLSITGILKHLLNGVVEGEVRLKGLNPLHRDEYARLPGFLGFVMQDPERQIIYPTP
FT                   LDEAIAVLEARGYSYEEAERKAIQVLDALGLRGKAGEHVENLSGGERKRLAITLSIIHD
FT                   PDIIILDEPSASLDPAGIGFIRRLVSREKSRGRVILLTEHKGGYFADLVDKAYAVRKRR
FT                   VVELAGEEIADYEKMPECRETLGSSGGVLLETRGLSAGYREPLVENADIHIRRGEVVAL
FT                   VGPNGSGKSTILKTLAGFLKPLGGEVINAARGLFYAPQNPDTVFIHGSVRRELEDASRR
FT                   TRVAFEELASMYPWYERVKGLHPLRLSHGQRRWLSILVAYAYGRDLMLLDEPTTGLDHA
FT                   LYSGLVKLVNELRGRGRSILLSTHDPRLVADVADRVYVVEDGRVREKDKCKAVESMYRA
FT                   TGVPL"
FT   gene            240782..242404
FT                   /locus_tag="Desmu_0258"
FT   CDS_pept        240782..242404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0258"
FT                   /product="amino acid permease-associated region"
FT                   /note="InterPro IPR002293: IPR004841; KEGG: dka:DKAM_0746
FT                   amino acid transporter, putative; PFAM: amino acid
FT                   permease-associated region; SPTR: Amino acid transporter,
FT                   putative; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64577"
FT                   /db_xref="GOA:E8R7V1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V1"
FT                   /protein_id="ADV64577.1"
FT                   /translation="MSEESPLTVFRAYLLKREFTWFDVFLWVVANPVASGLFYYSVSAT
FT                   GEYGYYGGVVPAAFIAAGIVFAPVALLFMIVASSLPRSASPYVLASRGLGALPGFIAAS
FT                   LYLFMSGGLLSLGFLAYSSIEVLGDGLTVSGHIAGSSILVGLGSAVRAQPYMLLAAFTL
FT                   VTVLFLAAGMGRKSVKALLHASTALPLVLYAAVMLSLFPFSRSVFTGNWDRLFNNSYSR
FT                   IVDLALNGGVVNGVSVQPLRAVSEWSGTFTVFTMAVWAYLGVENASFIAGEVREPGSSY
FT                   LKGYIAGYMVLVAMYTVTPVAVTLVAGYDFLSAYSYLYHHYPDVLKTLMGVNAPPAPCL
FT                   ATIVSVYTGNMVTSLLFTLAAFLFYFNTMLTSWVSATRILFALGEDRLMPRLTARVSRR
FT                   THVPGYANLFIYILSIAVVSASPFIRSHPSIEASFIRLMTLGYAFFLTITGLALISTLV
FT                   FAEELYERFTFKDKRVLYPIGFTTSVVGFALALSSFAGISLTDILVASTGFSLILLLFI
FT                   AVTFYMKRRGVRYSEVFSRIPPM"
FT   sig_peptide     240782..240871
FT                   /locus_tag="Desmu_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(242440..244101)
FT                   /locus_tag="Desmu_0259"
FT   CDS_pept        complement(242440..244101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0747 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64578"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V2"
FT                   /protein_id="ADV64578.1"
FT                   /translation="MSGGDGFVYQLIDFLESKGFTSGEVSVIPVSTHPWNTATVVNRLS
FT                   EELGIRDFIVLTRRELVDDVYQSLSQEPGAARGINVYVDHAVARSILRDSVFENSIVLE
FT                   HLVKSISGMVKKIYVDLSLTTGPFAITLQGTLSKMGPSSITYTYVDAIPLPGLPQYPGS
FT                   PRWIHRVYVYEDGGVAEPGEGGAGRGVREQGLLEKKIAWRGTKGVFEDVSQVFNRLADV
FT                   RIAERLTSEARRDVSEDSPVLTVNALNPVNGERKRLVSLKPVEGPDEDSVNMMMGNWRV
FT                   LADIVCGSHPDADRSSIERILMQIQRYTGAVDLIAREIEGHGSRDYEGWKLHSLLLDMH
FT                   RRLGKPVALLPDTNMFYQGLHMTLLKASIRNGRPWSPVEGIRVYIPVCAEAEINGKVAG
FT                   VSSETTGISRYSYVMALLANRAVDEIKQYYRGIHLPAVSQPCEASIAVVEQSLSEDRVV
FT                   LVTADKKAYNAWITLNVCKERATCIYIGHRNRPLNADGLYSKLYASIVLANQVYTAGSI
FT                   LPLELSTGDRRARVTLETLQGADAPVLNIVEEPGSA"
FT   gene            244172..244882
FT                   /locus_tag="Desmu_0260"
FT   CDS_pept        244172..244882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0260"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="COGs: COG0615 Cytidylyltransferase; InterPro
FT                   IPR004821: IPR007155: IPR004820; KEGG: dka:DKAM_0748
FT                   glycerol-3-phosphate cytidylyltransferase; PFAM: protein of
FT                   unknown function DUF357; cytidylyltransferase; SPTR:
FT                   Glycerol-3-phosphate cytidylyltransferase; TIGRFAM:
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; Protein of unknown function (DUF357);
FT                   TIGRFAM: cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64579"
FT                   /db_xref="GOA:E8R7V3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V3"
FT                   /protein_id="ADV64579.1"
FT                   /translation="MEREPGVIAVEECERVKAYIENVEQALQQVGSQGLQPVQEYIVEL
FT                   AREYTSDAKYYLEKNDCFTSLACIAYAEGLLDSLRHQGAVSFNWRPLTELLGRPRVLVA
FT                   GSFELLHPGHIHLLRRAWELGRVYVVVSRDSNFERFKGRRPVVGEKDRLTVVENVRYVS
FT                   KAVLGDEEDFLKPLEELKPDIVLLGPDQWISPGELKKLLEERGLSRVRVEKLESRIGEW
FT                   SSSGIIEKVKREYC"
FT   gene            complement(244992..245711)
FT                   /locus_tag="Desmu_0261"
FT   CDS_pept        complement(244992..245711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0261"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0655 Multimeric flavodoxin WrbA; InterPro
FT                   IPR005025; KEGG: dka:DKAM_0749 NADPH-dependent FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase; SPTR:
FT                   NADPH-dependent FMN reductase; PFAM: NADPH-dependent FMN
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64580"
FT                   /db_xref="GOA:E8R7V4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V4"
FT                   /protein_id="ADV64580.1"
FT                   /translation="MDGKPRILVINGSPRKYGSSMQLSIVAAKGVVDAGGIPEIVSLYD
FT                   YRIKPCMGCVSDGNKYCRFPCVIKDDDFNTLAGKLLESHGVIISTPVYWYAPSGVLKNF
FT                   IDRLTSMEHMIFHKGRSLLEGKVAGFIATGLDSGVMMAISYLAIVMSSMGAHVIPWSMA
FT                   YSHLEDITRDEQALRDSYNVGYIAAKTARALMSYEHIGYNPLVDVKELAELARRYTATE
FT                   VAERERRIGMLEDLSKD"
FT   gene            245790..246317
FT                   /locus_tag="Desmu_0262"
FT   CDS_pept        245790..246317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0262"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020084: IPR020476: IPR000086; KEGG: dka:DKAM_0750
FT                   ADP-ribose pyrophosphatase; PFAM: NUDIX hydrolase; SPTR:
FT                   ADP-ribose pyrophosphatase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64581"
FT                   /db_xref="GOA:E8R7V5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V5"
FT                   /protein_id="ADV64581.1"
FT                   /translation="MPQAGFHMGREYPSSPIGAVGAVLLRGDSILLVKRGSPPALGRWS
FT                   LPGGVIEPGERIGDAARRELREETGIDAEPLGVLWVLNNIVMDRGGRVKYHYVIVDVLF
FT                   NPDSLKGEPKPGSDAVDLKWFPLGEALRNPSVSRTVSKLLEYILEHGLSYIPIDRVDNI
FT                   AVEVGDGVYAVS"
FT   gene            246386..247093
FT                   /locus_tag="Desmu_0263"
FT   CDS_pept        246386..247093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0263"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: dka:DKAM_0751 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1393)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64582"
FT                   /db_xref="GOA:E8R7V6"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V6"
FT                   /protein_id="ADV64582.1"
FT                   /translation="MRVRQLVEAAVFTVLVYAATVVLQVYQPVTGGYFNLGESMIYVAA
FT                   LSSGPLVAGIAGGVGAALADLTTGYQVFAPGTLVIKLAEGVAAGYLARALRSRHWRIAG
FT                   GLIGSAYAAVFTGFALTLYAGTIEVGPSGLEVYVPWYIWLLAGLALGFILVYSLLSGRS
FT                   SAGEAIALITSGLIMVAGYFLYEYFVSNPLTGRPPIDAVFEIPVNIGQVVTGIVVALPV
FT                   AAWLRRAGYIEAG"
FT   sig_peptide     246386..246439
FT                   /locus_tag="Desmu_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            247129..248412
FT                   /locus_tag="Desmu_0264"
FT   CDS_pept        247129..248412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0264"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR017871: IPR018120: IPR003439: IPR003593; KEGG:
FT                   dka:DKAM_0752 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64583"
FT                   /db_xref="GOA:E8R7V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V7"
FT                   /protein_id="ADV64583.1"
FT                   /translation="MLEAHVRVAGYRDGFTIRNLDLRVQDGEALIVTGPSGSGKTTLIR
FT                   VLTGVLDRIGGFLDGEVIIDGQPVSAMEPWRIYELVAYIPQEPWYALIGYTVHSEYCYA
FT                   LSQLGVRCDHTSLEKLGLRGKLDSLTVNLSAGETQRLIWAEAFARRYRVLILDEPLVYL
FT                   DDEARGTVAKAAWEALAHGASLVVVDHDPWFWRGMPGKLLVMENGAAKYYGEWSDEALA
FT                   RVEEPEVYRRRTGSGVAVEVENLWFKYPGEKPLFKGVSFTIEKSSLAGLTGRNGAGKTT
FT                   LLKLMAGVLKPLKGSVRRFGRATYIPENPLLYFTKPTPREELLYAAGGGVDAVEEAVEL
FT                   FNLAGVLDRPLAKLSSGERRRLALASAYLGGFDIYLVDEPTGGLDQANAVRVLDALTRL
FT                   VENGGTVVVATHDKRVVSLLDDDIRVGD"
FT   gene            248412..249116
FT                   /locus_tag="Desmu_0265"
FT   CDS_pept        248412..249116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0753 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64584"
FT                   /db_xref="GOA:E8R7V8"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V8"
FT                   /protein_id="ADV64584.1"
FT                   /translation="MGVLGWLVAIVYKALFLKGDTGFKQAHWVVKALHLTLVSMAILSG
FT                   NPLVYTGAFTLFILLGLLSPGYEWAASTLILSSLISIYMSATALIASLAGVAPITLTDA
FT                   VLIALKTASLSTMLAFSFIIISPLEISSLLIKLGAGRLAALPLLTWRLMPLGLKTFVES
FT                   LQIGRVKGERVSARIPPAVAGLMEAGGFIEEYCFHRLSTGAKHPVLPYYSSKYTLILLA
FT                   GDLAIALLLYYA"
FT   gene            complement(249259..251538)
FT                   /locus_tag="Desmu_0266"
FT   CDS_pept        complement(249259..251538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0266"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1205 Distinct helicase family with a unique
FT                   C-terminal domain including a metal-binding cysteine
FT                   cluster; InterProIPR014021: IPR001650: IPR014001:
FT                   IPR011545: IPR 018973; KEGG: dka:DKAM_0754 DEAD/DEAH box
FT                   helicase domain protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; Protein of unknown
FT                   function DUF1998; SMART: DEAD-like helicase; helicase
FT                   domain protein; SPTR: DEAD/DEAH box helicase domain
FT                   protein; PFAM: Helicase conserved C-terminal domain; Domain
FT                   of unknown function (DUF1998); DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64585"
FT                   /db_xref="GOA:E8R7V9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7V9"
FT                   /protein_id="ADV64585.1"
FT                   /translation="MEPRDPLVREVDAELKSMYPGSGASVIYERVEETGEPEPGPSIRD
FT                   IGLPDPIVKALLRKGIERLYRFQYEAYRHILNGENTVISAGTGTGKTEAFLLPVIKRVV
FT                   EGDGWNPRAMVLYPTKALARDQLNRFIEYTVYPAVSFAVYDGDTPVRLRRRIASNPPSI
FT                   IVSNPDMLHTGLIYSPHVRGFAERADFMVFDELHVYEGVLGSHIHHLAERLKKSRASKP
FT                   VFIGASATIGNPREFAGELFGEEFVEVRGETWRRGVVTHVLVSSGYMSRWSVTAQLCSI
FT                   LSRKGLRFIVFVDSQQLAELLTRILRTRHGVNVAVHRAGLPADVRRDVEAKLRSGVVDG
FT                   VVATPTLELGIDIGALDAAVMASPPPSYTKYLQRAGRVGRRRRGYVFTVLGDDPIDTYY
FT                   ARMPERFFTQSIQPSVIEPFNEEVSKTHLLAYLLQVWRARVMDLPEEWKRVLGDLAAEG
FT                   FVKTVGEYVRPVPRRARLFLMEHGSLRASGPVVEVVDSGRGEVIAYRELPVALLELYPG
FT                   AIYLYTGESYMVESIDLSSKRAYARRVSGNASYTRPLYTVDVVDYDILAERRTGSGVRA
FT                   AYARVVLELRVEGVVVKDMYSGETLSTVELEEPVAYRYPTRATLIKYPVPDELGARGSA
FT                   EAFHAIEHALISAARVVCGSGLTDLGGVSYPSGDIVVYDAAVGGSGVAKLLYERLEDAE
FT                   KVAEEIMSRCDCHDGCPRCIFSPYCGNNNQVLSRRKALYVLSKLGKARIAAAAAPLEAR
FT                   AGKPVA"
FT   gene            complement(251538..251768)
FT                   /locus_tag="Desmu_0267"
FT   CDS_pept        complement(251538..251768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smr:Smar_1494 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64586"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W0"
FT                   /protein_id="ADV64586.1"
FT                   /translation="MPTGKCGVNGCGRDAARKVSYLDAKVLEEHGLLLHPVDAAPPRRP
FT                   GHVYLCEEHYKLWRKLTKRERLLRDLSRKVE"
FT   gene            251852..253252
FT                   /locus_tag="Desmu_0268"
FT   CDS_pept        251852..253252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0268"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="COGs: COG0312 Zn-dependent protease and their
FT                   inactivated homologs; InterPro IPR002510; KEGG:
FT                   dka:DKAM_0755 peptidase U62, modulator of DNA gyrase; PFAM:
FT                   peptidase U62 modulator of DNA gyrase; SPTR: Peptidase U62,
FT                   modulator of DNA gyrase; PFAM: Putative modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64587"
FT                   /db_xref="GOA:E8R7W1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W1"
FT                   /protein_id="ADV64587.1"
FT                   /translation="MGEAVDLELAVRTGLALGADFIDVRYQEYYHESLSVDNGVLRELT
FT                   TTRATGIGVRVIVNGLMGYATTNDLSPGSVKRTVEVAVKLARALRSSGMPQDIYERPVQ
FT                   RDRVASHYVENPEDVDLSEKAGLLLDMYKAGRNIPGVSSLTIPFGYERDRRVYASSRGD
FT                   YVDYTRRMIGIGVRIVASSGGSHEMLWTSESRVAGWEFIESFNWLDYVVENSRLAVEAA
FT                   GAPHVKPGRYDVVLDNEIVGLMLHEAFGHASEADIVEAGGSVLGGRIGSEVASPLVSIV
FT                   DDGRIEGGVYVPYDDEGTPKLKTYTVRKGVLSSFLHSLTTARRLGAQPTGNARIMSFRN
FT                   TILVRQTNTYMEPGDWDPVEMIRDMKRGLYVKGKGAMGGEVNPLTGAFTFTSGPSYIVE
FT                   NGEPVRLVRGVMLSGIILETLRNVDAVGRDLVVRTSVFGGCGKSGQTVRVGDGGPHVRV
FT                   RGFTIGGG"
FT   gene            253239..254600
FT                   /locus_tag="Desmu_0269"
FT   CDS_pept        253239..254600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0269"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="COGs: COG0312 Zn-dependent protease and their
FT                   inactivated homologs; InterPro IPR002510; KEGG:
FT                   dka:DKAM_0756 peptidase U62, modulator of DNA gyrase; PFAM:
FT                   peptidase U62 modulator of DNA gyrase; SPTR: Peptidase U62,
FT                   modulator of DNA gyrase; PFAM: Putative modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64588"
FT                   /db_xref="GOA:E8R7W2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W2"
FT                   /protein_id="ADV64588.1"
FT                   /translation="MEVVEAVLEKLVEAGVGKGLSEVEAYSVESSILSLTVSSNKVKEA
FT                   SRSRIVTTGLRGAIGRRVGGLALTALNVDPVEVAGELARIAGAAPEDPYWPGFPTPLHG
FT                   TSRALCLDKRIAELSEEEAVEILLNAMEAMRSAAISMHVDEAVVVEGSLNMGSQRYRVV
FT                   NSHGVDADAECTFISLWLTLSVKTSRGSSDKSVFTVRRGLDEQYLMERSREAGELAPLF
FT                   AGARPVESGVYDVILTPESAGLILSTLLTPAFSALNILESRSPLKGKVGEEVVSPVLTI
FT                   TDDPTLPLETGSRGFDDEGVGTRMKVILDKGVFKQPLHSYYTASRMGDEPTGNGFRRVP
FT                   GSPTQPGATNMVVQPVRGSLEDFTREAGRALVVYEMIGYWMSNPVNGVVKATVSHGLLV
FT                   EKGEVVKPVKGVVITGNIYEWLGRGLIGVGSDLRINNGVGSPSIWVSRVNVAGE"
FT   gene            complement(254632..255537)
FT                   /locus_tag="Desmu_0270"
FT   CDS_pept        complement(254632..255537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0270"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="COGs: COG0340 Biotin-(acetyl-CoA carboxylase)
FT                   ligase; InterPro IPR004408: IPR004143: IPR003142; KEGG:
FT                   dka:DKAM_0757 biotin--acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein; SPTR: Biotin--acetyl-CoA-carboxylase
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: Biotin protein ligase C terminal domain;
FT                   Biotin/lipoate A/B protein ligase family; TIGRFAM: birA,
FT                   biotin-[acetyl-CoA-carboxylase] ligase region"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64589"
FT                   /db_xref="GOA:E8R7W3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W3"
FT                   /protein_id="ADV64589.1"
FT                   /translation="MTSELALKLELLRLLSEHDEIPVSEAVKELGVHQDEVLGIAEELS
FT                   RYYMIKTVKSRISWSPGDNPRRFKPWGWSYLYKIVSGSTMVSARQMSPWSIVLSELQVQ
FT                   GKGRHGKTWIGNLGGLWVTFKASVAPQVAQLLPVAIPVLLVRTLRDKLVVDAEIKWPND
FT                   IVYKGRKIAGVLLEGEYVGVSIVSYIGVGLNVNNDPPLETAESIRNIVGHHVPRNRILS
FT                   YISGWISRLDKLTSRPEELRKEYMEHLSTLGRRVIAVTSNGEIKGVARDVSEYGELIIE
FT                   DERGSHRLTSGEILQLRHAD"
FT   gene            complement(255527..256225)
FT                   /locus_tag="Desmu_0271"
FT   CDS_pept        complement(255527..256225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0271"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="InterPro IPR005358; KEGG: dka:DKAM_0758 UPF0153
FT                   domain containing protein; PFAM: protein of unknown
FT                   function UPF0153; SPTR: UPF0153 domain containing protein;
FT                   PFAM: Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64590"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W4"
FT                   /protein_id="ADV64590.1"
FT                   /translation="MEDSMVEHEVPVFKCPACGLCCTFSPVSILPHEDIVLRTIADALG
FT                   LPYSSQPGYVIFEEVNRVNLAFSYVMELHNGRCIFLSGSKCMIHDVYKPLICRSYPYVP
FT                   RHVRYNIDERNKYILATADYGVSVACPVVKKDREVLEKYSGNPALVIRYLKKEYNAAVE
FT                   MENIRNTLLSLLSKLWREGIVEVSTSRRDAPVVNLYEFLRRYYPDLPGILNIDKVVDKI
FT                   KVLRGETGDE"
FT   gene            complement(256232..256780)
FT                   /locus_tag="Desmu_0272"
FT   CDS_pept        complement(256232..256780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0272"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /EC_number="2.7.7.1"
FT                   /note="COGs: COG1056 Nicotinamide mononucleotide
FT                   adenylyltransferase; InterPro IPR004821: IPR004820; KEGG:
FT                   dka:DKAM_0759 cytidyltransferase-related domain protein;
FT                   PFAM: cytidylyltransferase; PRIAM: Nicotinamide-nucleotide
FT                   adenylyltransferase; SPTR: Cytidyltransferase-related
FT                   domain protein; TIGRFAM: cytidyltransferase-related domain
FT                   protein; PFAM: Cytidylyltransferase; TIGRFAM:
FT                   nicotinamide-nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64591"
FT                   /db_xref="GOA:E8R7W5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W5"
FT                   /protein_id="ADV64591.1"
FT                   /translation="MDTERCLVIARFQPFHYGHLNAIEYCYRNYDEVIIVVGMASQSHT
FT                   PENPFTAGERLLMIRGALKWAGHDLSRYVTVTLPTLEVNRAAVHFVRQYSPPFKSVVTL
FT                   NPIIQRLFMEEGYEVIPPPVKERDTYSGSAIRRMMLANDPSWKQLVPPPVAEIIERIGG
FT                   VERIRMLYSERLPGYYATA"
FT   gene            complement(256896..257273)
FT                   /locus_tag="Desmu_0273"
FT   CDS_pept        complement(256896..257273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0768 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64592"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W6"
FT                   /protein_id="ADV64592.1"
FT                   /translation="MSAVNLAERVMKSFSRYNCFIFEESELQAVKDLIVAAELKGLIEI
FT                   RQLDPRYPYIYVATVWTKSIERDCVTQVNNLLSEGRLTQEEYKKYRVELVEQCMVSREI
FT                   EAAKRVVEALGRYIERLGRVG"
FT   gene            complement(257270..257698)
FT                   /locus_tag="Desmu_0274"
FT   CDS_pept        complement(257270..257698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0767 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64593"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W7"
FT                   /protein_id="ADV64593.1"
FT                   /translation="MLVEGSGYFKVESSRSRSGKHAASSTLLVYRRGLGLVKPGEGVAV
FT                   EEAEATPTYVVGSARLIKVSLSHGDFALYGWFVRNHLGRVKGYVSVYNHRGELVYRARY
FT                   FNGMLRRSVGNPVYAWLVRVFTEALRIPVSTTRLGDEK"
FT   gene            complement(257692..257955)
FT                   /locus_tag="Desmu_0275"
FT   CDS_pept        complement(257692..257955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0766 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64594"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W8"
FT                   /protein_id="ADV64594.1"
FT                   /translation="MIRLIVNVYFASDEYRVEVNRYSSEGRLEGSQVYNGVKQLVLSGV
FT                   TARVNRQLQNDPWSIIIEAVDPVVDVKEGGLLYIREAGGRQC"
FT   gene            complement(257964..259475)
FT                   /locus_tag="Desmu_0276"
FT   CDS_pept        complement(257964..259475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0276"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1078 HD superfamily phosphohydrolase;
FT                   InterPro IPR003607: IPR006674; KEGG: dka:DKAM_0765
FT                   metal-dependent phosphohydrolase, HD region; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; SPTR:
FT                   Metal-dependent phosphohydrolase, HD region; PFAM: HD
FT                   domain; TIGRFAM: deoxyguanosinetriphosphate
FT                   triphosphohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64595"
FT                   /db_xref="GOA:E8R7W9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7W9"
FT                   /protein_id="ADV64595.1"
FT                   /translation="MVSDPIYGYVYFNREVEEQVVNSILLQRLRYIMQLQTAHLVYPGA
FT                   VHTRFQHSLGVMHLTGLVAEDLTGKLVSIHGVDVLEGYSPETLVEAARLAGLLHDVGHA
FT                   AFGHSFEYSVLWKKNVLGELSNHEKIGLKLLELLLEDRLLEAEERYGLTGLTSMVKKLL
FT                   GERREGSPLVDAYRWIIRDGLYPTDIMDFLRRDSYYAGTSEYGYISYERLYRNTYPFIE
FT                   KGVFKAVLDRTGIGEFKQYMVAKASMYEHVYYHSVCRAFDKILDTLLEKLDEEYGLADR
FT                   VLALARGEVEGFLELTDVYMYSVLLGKALRDSTEVGRLARMMLVERKPLWRRVGGEYVL
FT                   NGYRGPRFIGEILRLIFDREWRSKVASVLVEELAGRLSSIGVAEDDLWVDVLDISPVPK
FT                   SLLYPDWGSGVPEIVLYTGKVSGRQVVPGPEVNLLEGELPLAVIFRAYVKREKYRVDME
FT                   PVVSRVVGEVLEALLGIDMGEYRRSIEEAYKSVRGIDYSRFKLTM"
FT   gene            complement(259596..259787)
FT                   /locus_tag="Desmu_0277"
FT   CDS_pept        complement(259596..259787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0277"
FT                   /product="helix-turn-helix, type 11 domain protein"
FT                   /note="KEGG: dka:DKAM_0764 helix-turn-helix, type 11 domain
FT                   protein; SPTR: Helix-turn-helix, type 11 domain protein;
FT                   PFAM: IclR helix-turn-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64596"
FT                   /db_xref="GOA:E8R7X0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X0"
FT                   /protein_id="ADV64596.1"
FT                   /translation="MSEQRTVKERLVEFLGSQGKPLMPKEISRLTGLNYNTVRARLHDL
FT                   RKEGLVERRPEGWVLRKA"
FT   gene            complement(259988..260854)
FT                   /locus_tag="Desmu_0278"
FT   CDS_pept        complement(259988..260854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0769 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64597"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X1"
FT                   /protein_id="ADV64597.1"
FT                   /translation="MFGRGRRGEAPVIQVAYVPTGFLFRDRYFTLLDLIVRNGKGVVAR
FT                   ISELILSRGLSIANITTPGLVTRDMDKGRLLILVEDCDDACGSSLAEALRKELRDIVLS
FT                   VDHYTAFNSYVFLRNTILYFAHERAYVFTQGALKEGVREMYRQLSANPGLESQVHNVLR
FT                   SLGKGIGVHLYVEWNGRVEDAGGFEKYVEQGLRFLEAVYSALGLGVVKASTSDYVNYRV
FT                   EITDNWECSALREAGIQAPSSVTLGIIEGYLGKMLGRRVAASEEKHAGAPGEACVFTAT
FT                   ALESLTD"
FT   gene            complement(260967..262283)
FT                   /locus_tag="Desmu_0279"
FT   CDS_pept        complement(260967..262283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0170 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64598"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X2"
FT                   /protein_id="ADV64598.1"
FT                   /translation="MRAQLPVVIAVTLLVLLMTTTLLYTTSTLTYYSNIQVAEEKQTIW
FT                   RAIDAQLDTVIVSAVASANKTAYQSFMNKWSSEMQRYNDINQTPTRYSRTCRAITASWP
FT                   TIYDYTSFVCPGECGLNYSKPGVNASLDRFIQGLNSTLQFYLNAVSSSVYSALQNWGTL
FT                   MRDAGITVVVYPPSVDYRVGFEGNPSIPYSRFINVLRVNVSVDVFSVEAGYKHFDKYVE
FT                   YGFNVTFVRGRLLCDSFILPVYIDAYVDVNGRRSLYIPDPSRIQLRVYSKMLERLSTSQ
FT                   TPFITLRNDSGTLYAAGSLYASYYYGNGSTLVIFKIPVNVDACKSLSLAAGLVVNSTAF
FT                   VYFDGYTIYDDTFPPPYDNPFPPPKNLSCNGYTSVTLAYLFAGLLSLDINGLTVFSGVK
FT                   IVWKIYWDTQPSGYDWIITLLASVYGDERCVFQYTAPLY"
FT   sig_peptide     complement(262194..262283)
FT                   /locus_tag="Desmu_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(262283..262672)
FT                   /locus_tag="Desmu_0280"
FT   CDS_pept        complement(262283..262672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0169 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64599"
FT                   /db_xref="GOA:E8R7X3"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X3"
FT                   /protein_id="ADV64599.1"
FT                   /translation="MKGQIQVLVSSVALGLVVATVAVLFTGIYAYTSSYRVTVRGVSVY
FT                   DVIMGKPYWTACSLADALLTKLNALRVYVNITEYSLTGGLSTVRSESCTAEIVSRTGTG
FT                   FHANYTYTVGTVYGTVVKYGVGVEY"
FT   sig_peptide     complement(262583..262672)
FT                   /locus_tag="Desmu_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(262674..263783)
FT                   /locus_tag="Desmu_0281"
FT   CDS_pept        complement(262674..263783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0168 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64600"
FT                   /db_xref="GOA:E8R7X4"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X4"
FT                   /protein_id="ADV64600.1"
FT                   /translation="MKEVVEYVLAVLIVLSILPFYNMVATQFYTPTKGRGTVAVGDIFV
FT                   SAVSLAFRDAYNNGNTSIEVAEVRSSLDSLIRRYAGSAYDEYYYYARLYSPINVTLDPT
FT                   GRTVTVYSPFNMTTYLLLVSWNGAASISLQLNPVKAGDVFKYTYNYSALSFKGVSVAVA
FT                   VSGYGSTWFIGYWLNESSTMGYIVAAPGGLLTVLADRNAGLKPTSFYNYTGFNSTIYYV
FT                   ATQGLANYTRSWTNITIKMIVSGDIVSYMEYNTTETMYLGEKKTYNSSMDAYTLYLAKG
FT                   RSYWVYSEGRSRLVENATEKASVNYPIYNMVLATIYDGARVIYAPAYRNNYTVTNAPEH
FT                   PPGDADRVSSYVTIGMFTYMVDLWSWRRS"
FT   sig_peptide     complement(263706..263783)
FT                   /locus_tag="Desmu_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(263780..266368)
FT                   /locus_tag="Desmu_0282"
FT   CDS_pept        complement(263780..266368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0282"
FT                   /product="Protein of unknown function DUF2341"
FT                   /note="InterPro IPR018765; KEGG: dka:DKAM_0167 Tfp pilus
FT                   assembly protein tip-associated adhesin PilY1-like protein;
FT                   PFAM: Protein of unknown function DUF2341; SPTR: Tfp pilus
FT                   assembly protein tip-associated adhesin PilY1-like protein;
FT                   PFAM: Domain of unknown function (DUF2341)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64601"
FT                   /db_xref="GOA:E8R7X5"
FT                   /db_xref="InterPro:IPR018765"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X5"
FT                   /protein_id="ADV64601.1"
FT                   /translation="MASPLVTHVIGGVVMVAVIIAVVNYGSIMYNTTRYNNLQQLYEEI
FT                   ASAIAVRINSAVLDAYMRGLNNTIIHLANPVEAAAGEKYNVYIGVGSSLSKLFPRVPGD
FT                   TGLYVVVSSPDNTIYGYASASMIPGVEVARGRVVINKYRTGFDAAYGYSENGVPFLCRM
FT                   PINVTERAGVDLSNYLVLVNLSLTGVNCTYLGKQYSPSRSDVRFTDSDGVTPLDYYIEY
FT                   WGSVNALIWVKIPLLKAREVKTIYMYWGNSFAQEKSNPGIFTLLSRLGEYSGIQSLLLS
FT                   GVWGVKYNNTASINIAGNGSVLTVSATYTASPGYVNIYSVQELDATGKLGWIVEALGSP
FT                   VDTGSNSQNYRAGFYAWNTTAEKYSILLIPPVIDPSTSLSNYTIIYGNWSITGEVTGEG
FT                   VNLVVNNTALQTIQVGKNTNISIAIAQRSISSTGEYASMLYKVRVDSYSGVYRGIVLSE
FT                   GLANTSNQAFAIVLTVDDKGYLQVCQLDVDRLLQGQTQLDCESTGVSVDPDGEWFYINA
FT                   TIRNPAQGQGNPELELTVYRASDGSLVYQLPRQGTQGFTGRADYIGPIVYYNGVPVGYT
FT                   GSEFDDLVAIRYGSPVDLTSIMVVGLPAGWIAELWDGDFNASGVAGSNGVAVLNVTLKP
FT                   VLGVDGPVYLYIYTGDGVLVDVFEINQVISGGTIIEYAPGIRESTSSFSAMIHASANNI
FT                   CNVNVGKGGYVYLLDTGSTCIGMGVSNVAWGWYWTSVGYFNGSFYYFIENQFNRALYSS
FT                   YSLTSTVKPASLRVVFGVSAEGLSNVKNTNTTGLFQLIMLRPFVYPEPSVSYSSGLIQN
FT                   ASFPQPPTVIVDQYSGYIVFSSDLTVDIVVAIKSTGGVVVVEVPRGVRGR"
FT   sig_peptide     complement(266294..266368)
FT                   /locus_tag="Desmu_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(266369..267145)
FT                   /locus_tag="Desmu_0283"
FT   CDS_pept        complement(266369..267145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0283"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000408; KEGG: dka:DKAM_0166 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64602"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X6"
FT                   /protein_id="ADV64602.1"
FT                   /translation="MKGVSETFSTLILVGVFTALALALIPYSYFATMSSLQKTEYEYVK
FT                   HVFKSMAAYFPNIVLAGEYAASIPAQHTSIGYTQAGRIEVYLNSSSTPVVVLNCAALTL
FT                   GAGIPGAPVGLVYGVGEYLVGDVRFVPRVYEYRSESSGLMTTSFDVCRMLLSVDVVLKG
FT                   DLQGYYYVLQLYNLTVHLAGGNGHSLRITPTGLRHVYSNIAANLWNITIVVYDYIVGVR
FT                   RSYGVADLVKAGFGEAYAGVPFSVDIVVEDVVVEVV"
FT   sig_peptide     complement(267062..267145)
FT                   /locus_tag="Desmu_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(267384..268136)
FT                   /locus_tag="Desmu_0284"
FT   CDS_pept        complement(267384..268136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0165 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64603"
FT                   /db_xref="GOA:E8R7X7"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X7"
FT                   /protein_id="ADV64603.1"
FT                   /translation="MKATRAVSEVVAAVILFTVAVAISLAVFFYTAFYTDYVKALTEYG
FT                   HVKTVLWNIADVISTQGYMDNRVLEYRYPHEVASIGYEFKRVNLTVNLTLSNGSTVTVS
FT                   RGGCYVLKAAVARPVLTNMQPTLLRGVNETLVNDTLLVPSLYEYYSNGWSILVLDACRI
FT                   YYSVKNIGGSLSLELFFFNFTSVNNEYQPPLVTGQGYLVVSPVIRVISENYNVTSVTVN
FT                   GAPLPGIPSNTILYKATIYVVNTGIMIG"
FT   sig_peptide     complement(268017..268136)
FT                   /locus_tag="Desmu_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(268146..269888)
FT                   /locus_tag="Desmu_0285"
FT   CDS_pept        complement(268146..269888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0285"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="InterPro IPR018076; KEGG: dka:DKAM_0164 type II
FT                   secretion system protein; PFAM: Type II secretion system F
FT                   domain; SPTR: Type II secretion system protein; PFAM:
FT                   Bacterial type II secretion system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64604"
FT                   /db_xref="GOA:E8R7X8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X8"
FT                   /protein_id="ADV64604.1"
FT                   /translation="MRFWDWVYKYFNWIGKRILKMFPNIGDSIKKSGIHMHSEVYAALT
FT                   GLVFIVSLAASITLTILLALLFRSPLGVAITVSIPTLVLLLMVSLPSLYASNRASSIDG
FT                   EFPFLSSYLSTMVMSGLSPYIAFERILKGSTIFKRTSELAQRFILLNRILGRDPLTAFD
FT                   ELAKRTPSSRVKETLSGYIATVKAGGDVVDYLNKRSRLLFNEMLVGMKIIADRLGGLLE
FT                   AYLAMILLTMISFTVLYFVTTGFAGVVPFGLSSEGMFFFLYIVMPLLSGVIIYLADLIQ
FT                   FKDPFMDWKPYMVFFATFIPITLLLVVFGVFFYTMLPPYHPLRMNPFTQLTGRLLLLFN
FT                   IANPPGYMYSSIALSTALIIASLPGLAYYIYSSREYKVTRGITRFLRDLVEVRKTGLPP
FT                   ERSIIELSPRDYGVFTPHLRKIAMELSIGIPLRRITDEVMRKIRSWIGQVLLFILTDSI
FT                   EVGGGTVEVLENLAWFAESVEAIEDERKRSLRTLMIVPYMGGILSAVTVIYMVGYMAKL
FT                   PIQVGTFNQAAGVVLPSIVLNNYVMGIVAGKVSSGRVIAGVVHAVLLTLITLIVMLATP
FT                   FFTG"
FT   gene            270030..271706
FT                   /locus_tag="Desmu_0286"
FT   CDS_pept        270030..271706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0286"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG0630 Type IV secretory pathway VirB11
FT                   protein involved in flagella biosynthesis; InterPro
FT                   IPR001482; KEGG: dka:DKAM_0163 type II secretion system
FT                   protein E; PFAM: type II secretion system protein E; SPTR:
FT                   Type II secretion system protein E; PFAM: Type II/IV
FT                   secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64605"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7X9"
FT                   /protein_id="ADV64605.1"
FT                   /translation="MKPRLKLPLPLKRGESGGKRVEEKAKILRESIAAIEELVQVTQRD
FT                   PSWRVLDSYYIYKPFVKITIAETPKGPTYFVEEQGLDEEDRAALEKLYEILMDEIRPPQ
FT                   RREDLADLKGYVFKEVERISDKYREKLGMVGSRRLKLMYYIERNLLGYGVLDPIMKDPN
FT                   IEDISCNGVSIPIFVWHRKYESIPTNIAFTGEEALNELIMKMAHMAGKHISIAYPILDA
FT                   MLPEKHRVAATYSKEVSTKGPSFTIRKFREKPYSIVEVIEQGNIDAVTAAYLWMLLEHG
FT                   KTFMIAGGTGTGKTTMLNALSMFIKPGMKIVTIEDTPELNLPHVNWVQLTSRETYVVGT
FT                   QSLGTSVKLYDLVKLSLRYRPDYVIVGEVRGEEASVLFQAMATGHSGASTIHAETLDYA
FT                   IKRLTSPPMNIPPTYMRLMNVFMHIQRVITRVEKGVVKVRRRITVVQEVEDYEKYRLIS
FT                   KWDPRTDKHVVNLGESMHLEDVAAKKGLDVEDVVEEVKRRAVVLEWMREEGIRDAWDVS
FT                   RRIFDYYYEPKTVYEHAVKRLAEIRGTSTEKVSEELTSPQA"
FT   gene            complement(271711..272448)
FT                   /locus_tag="Desmu_0287"
FT   CDS_pept        complement(271711..272448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0162 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64606"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y0"
FT                   /protein_id="ADV64606.1"
FT                   /translation="MSDLPGLTGLKYDSGSLDLLGDPVKEAELLLKGRYLEVLNVTLSD
FT                   FVEALSTKLAKGSYLLSCRDESSYTILLEDGVVKSVAEYFPEASVRLSGYIALRDLVKK
FT                   LASSYLECRLFSLQAPVEEPAGKKPAPEAVPRQVEPAATPRPATQEVKPPSVDEGKLHG
FT                   FLRHLRDIVRETADLYGCILQDEPAADVGNGYLVVRIKLRKKGLFGKCRDAELKAAIEK
FT                   DLPLLIELHELGVEVRLETLLVG"
FT   gene            272546..273502
FT                   /locus_tag="Desmu_0288"
FT   CDS_pept        272546..273502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0288"
FT                   /product="phosphoesterase DHHA1"
FT                   /note="COGs: COG2404 phosphohydrolase (DHH superfamily);
FT                   InterPro IPR003156; KEGG: dka:DKAM_0161 phosphoesterase,
FT                   DHHA1; PFAM: phosphoesterase DHHA1; SPTR: Phosphoesterase,
FT                   DHHA1; PFAM: DHHA1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64607"
FT                   /db_xref="GOA:E8R7Y1"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y1"
FT                   /protein_id="ADV64607.1"
FT                   /translation="MGEALIITHTDMDGVAAAALYIYLNKLEDYRVYFTEPYGLHEALG
FT                   KAVGKGFTRIALMDLGVNPPVFNRVVELLGELTGGGSRVSWFDHHVWEDEWVKAVEGSG
FT                   VVLHIDTSTCATGVVYKYSERKGSIDPLYVSSLVNGVCAGDLWRFDHWLGPYYVRLVRR
FT                   RDGDGWRRRVLETLSKGVFWDPLFEEKVVEAVEAELGLLGDGLKTVVREVDGFRICVAE
FT                   SSDTVENSFLASYLMGRFNADVAVIASSDGKLSLRSRGVNVRDIAVALGGGGHLTASGA
FT                   RIPIPFKTRLLSRLSKTMLLEHVADRVLDHRDKLRRL"
FT   gene            complement(273499..274044)
FT                   /locus_tag="Desmu_0289"
FT   CDS_pept        complement(273499..274044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0289"
FT                   /product="protein of unknown function DUF429"
FT                   /note="COGs: COG2410 conserved hypothetical protein; KEGG:
FT                   dka:DKAM_0160 protein of unknown function DUF429; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF429)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64608"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y2"
FT                   /protein_id="ADV64608.1"
FT                   /translation="MVRYAGIDLAGSPRNPSGVAVIEHSRGLRIVFIGLLYSDEDILGL
FT                   VERLKPVVAAVDAPLTPGRGYRSVDLELIKRGYRVLPPGWRGMRMLYERAVRLAGIMRG
FT                   MGVEVVETHPRSALKSSGCSDVYRLAEAVGITVNTVLSRDEEDALVASIVALKHGEGGV
FT                   LVFKACDGEVFLLRRLCD"
FT   gene            complement(274038..275408)
FT                   /locus_tag="Desmu_0290"
FT   CDS_pept        complement(274038..275408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0290"
FT                   /product="2,3-di-O-geranylgeranylglyceryl phosphate
FT                   reductase"
FT                   /EC_number="1.3.99.-"
FT                   /note="COGs: COG0644 Dehydrogenase (flavoprotein); InterPro
FT                   IPR011777: IPR003042: IPR003953; KEGG: dka:DKAM_0159
FT                   geranylgeranyl reductase; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; SPTR: Geranylgeranyl reductase; TIGRFAM:
FT                   geranylgeranyl reductase; PFAM: Lycopene cyclase protein;
FT                   TIGRFAM: geranylgeranyl reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64609"
FT                   /db_xref="GOA:E8R7Y3"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y3"
FT                   /protein_id="ADV64609.1"
FT                   /translation="MKYDAVVVGAGVAGLYSSLILASKGFRVALVESKPASRIGDKTCG
FT                   DAIGVHHFEHIGLKPPDSVVDHVYKGVRIYSPSERYEITVPGEGVSVNRVKLGQWLLRQ
FT                   ALDKGVELLDQHTVLGVTVKDNTVKSITVKKVGGGTVELEASGFIDASGAKPALRSRLP
FT                   EAWPISEKPYTTDFNIAYREVVEYDGSVNEADRDYAVIYLNTVVAPGGYWWLFPKSGDG
FT                   RVVNVGLGVIWNGLHNPRHNYDKYLKPRFPGRVIHAGGGIVPTRRPLPTMVWRNVGVVG
FT                   DAAYTVNPVHGGGIGSSLEAADIVARHMGDALEQGVVDEESMWGANIEYMKAYGAKQAG
FT                   LDVLRMYMQRLSNDDFEWIMANRLVDGSSVYDMGVKGELGERIAHTVLAVLKALSRPSL
FT                   LNQLRTVRSYMKKAVELYLDKYPSKPAELPGWMRSVEDFFEEYRRTIGFEKGERVKW"
FT   sig_peptide     complement(275334..275408)
FT                   /locus_tag="Desmu_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(275556..277085)
FT                   /locus_tag="Desmu_0291"
FT   CDS_pept        complement(275556..277085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0291"
FT                   /product="AMP phosphorylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="COGs: COG0213 Thymidine phosphorylase;
FT                   InterProIPR017872: IPR013466: IPR017713: IPR017459: IPR
FT                   000312: IPR013102; KEGG: dka:DKAM_0158 AMP phosphorylase;
FT                   PFAM: Pyrimidine nucleoside phosphorylase domain; Glycosyl
FT                   transferase, family 3-like; glycosyl transferase family 3;
FT                   PRIAM: Thymidine phosphorylase; SPTR: AMP phosphorylase;
FT                   TIGRFAM: AMP phosphorylase; thymidine phosphorylase; PFAM:
FT                   Glycosyl transferase family, a/b domain; Pyrimidine
FT                   nucleoside phosphorylase C-terminal domain; Cell division
FT                   protein 48 (CDC48), N-terminal domain; Glycosyl transferase
FT                   family, helical bundle domain; TIGRFAM: AMP phosphorylase;
FT                   putative thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64610"
FT                   /db_xref="GOA:E8R7Y4"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y4"
FT                   /protein_id="ADV64610.1"
FT                   /translation="MGLEGRPKLFEVRVVDIDLHRNLIIMNTSDARELGVVANNVVLVT
FT                   LGDKSAYATVVTSETITQPGVVALSKQTASALGVSEGDKVGVKPVGLPASFNALKKRLH
FT                   GGRLSEGEMKSIIRDVVDGVYGEAEIAAFLVSQLYSELGEEELSYLIKAMVETGSRVTF
FT                   EETVYDVHSIGGVPGNSKVALLTVPIVAASGLLIPKTSSRAITSPAGTADTMEVLARVD
FT                   LTMDEIVEIARRVKGVLAWGGKLNLAPADDIFVNIERRLSIDPDQQMVASILSKKIAMG
FT                   VERLVIDMPVGRGAKVKDASTADKLAGLFIRQAGLLGLSIKVALTYGGQPIGTTAGPAL
FT                   EAREALEALIERKGSRSLIDKAVLLAGLVLELSGRAQPGQGEDIAREVFLSGKAYEKFK
FT                   QIVEAQGGNPNVKPDDIQVGSHTFTLSSPLEGAVTHIDNAAVSLIARACGAPYDKGAGV
FT                   RLHAKVGYRVNKGDPLITLYSSSASRLETAVRLLRDLNPVVVEGMLLKTLP"
FT   gene            complement(277201..278328)
FT                   /locus_tag="Desmu_0292"
FT   CDS_pept        complement(277201..278328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0292"
FT                   /product="protein of unknown function DUF711"
FT                   /note="COGs: COG2848 conserved hypothetical protein;
FT                   InterPro IPR007841; KEGG: dka:DKAM_0138 protein of unknown
FT                   function DUF711; PFAM: protein of unknown function DUF711;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ACR (DUF711)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64611"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y5"
FT                   /protein_id="ADV64611.1"
FT                   /translation="MHHHVDQPYLIPGSPLKPVDEGSTVENIEVRAVTYFAGRHRGIRE
FT                   EYEHGINVLERAVEILREQGLRVFTKRVSMPSIGVGEALKLLEVAGNGDALVSAGYIDL
FT                   RRLTPGDASHLAGGGLYIPILAPVNDFTMDDALHFSRIIHAAAADDPVNATRIAIGFHD
FT                   ESFLTPYFPDSSSRGSRSIGLAFLYPNALDAESIDGLSESMHRVFKVFNNIAELLEKSL
FT                   GYPVYIDYSLSPWMERSVAGLLGSLGFSPLEPGFNYALHVVNKLIGMHGDRLRAVGFNE
FT                   VMLPYAEDSVLVEYGGRGLLRARDFLRYASTCVAGVDMIIVPSSVEGLARLTLDAYSLS
FT                   RVKSRPLSLRAIPVDGEPGGRVRLGRFGEPFIIGY"
FT   gene            278329..279273
FT                   /locus_tag="Desmu_0293"
FT   CDS_pept        278329..279273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0293"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR006130: IPR002292: IPR006132: IPR006131; KEGG:
FT                   dka:DKAM_0137 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; PRIAM: Ornithine
FT                   carbamoyltransferase; SPTR: Ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64612"
FT                   /db_xref="GOA:E8R7Y6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y6"
FT                   /protein_id="ADV64612.1"
FT                   /translation="MVTSLKGRHFLTLAEYSREELLFILETAMQLKQRYLAGERVIPLL
FT                   VGRHLAMIFEKPSTRTRISFETAMRELGGNAIYLSASELQLARGETIEDTARVLSRYVD
FT                   AVMARVYEHYKIERLAQYSRVPVINGLSDLHHPAQALSDVLTIMEKKGRDITRLKIVFV
FT                   GDGGDNVLHSLMLAVGILGGRIVIASPKGYEPHPSVVKLFNEHAAPNGGSYEIERDPFK
FT                   AVENADVVYTDVWVSMGQDKEREKRLRDLEPYRVTVELMERAKPDAVFMHCLPAHRGEE
FT                   VVDEVIDGRWSIVWDQAENRKHAQKAVLALLVP"
FT   gene            279362..281815
FT                   /locus_tag="Desmu_0294"
FT   CDS_pept        279362..281815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0294"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="COGs: COG1287 membrane protein required for N-linked
FT                   glycosylation; InterPro IPR018130: IPR003674; KEGG:
FT                   dka:DKAM_0136 oligosaccharyl transferase subunit, putative;
FT                   PFAM: Oligosaccharyl transferase STT3 subunit; SPTR:
FT                   Oligosaccharyl transferase subunit, putative; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64613"
FT                   /db_xref="GOA:E8R7Y7"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y7"
FT                   /protein_id="ADV64613.1"
FT                   /translation="MSRTVSNTIYTLYEYLASRPGLAKAATYIVLTLILAYGVYVRFSP
FT                   YWLNGFEFFEFDSYIEYWQAKYVYENGLLSWYTLTRDNPATHIFWYPWGRDIIYSSYPF
FT                   LPMWIGSTYHLVEGLGLSLKQWGILQPIIFAAIGIVLAYVTGRELSGGSRLAGLFTALL
FT                   TAVLPAATERTVLGYIEKEGVALVPILLYVYFYSKLVKSISSGQASRLRKTAYMVLSGL
FT                   FLAMVGWLWGGYVFILGTMVAFTVVYPVLVRGSVKGEFLAYQFGLIASSMILVLPSPAN
FT                   ASNLGIYPFNPRDLGVALASTLVLPLAYYVLNTEYRRLGLRKPLLTKGRYLLLLVVLVA
FT                   GGSVAVAQGLVPIGGRLAWALGLRFIPASPLVESIAEHQSPLSSYSTLIGMLHSWGVYP
FT                   WLFFASPLVLGVIGSLYFIYRGEADKLYVSIAFILAFYSYLNAAYMIASAAYFGTLVMG
FT                   VFMGRLVEYLLPTRRELEDRRKGRVRYRPAREYRVVVLALVALALVNTAYAGYVDYVSN
FT                   KSMVYTLKAGVSGLPYYSDSWYKAVEAIRGLPEGSLVIAWWDYGYGISVDGGKASVADG
FT                   STLNETQIGIIGLIMSATNTSEAAMLAKLFNPPAGRTFLMAIDSFIVSSDNSSVVIWPV
FT                   VTGSMPGTVDIPKSVWMIRIGNSTVSYLRSIGVNASYRDTSGYLYVYSFQDTSIISPVF
FT                   DSPGRLPLLYNMLIDGAMYWAETTNRSYTLKWFTGSQGLLDSATASRISESLKLPVTQY
FT                   IQAQSITSLSTRPLVNDTHVKPYKVIMEPFVNPYTGQPVEVSTPDGGRGILYSIIVFYQ
FT                   LLPDH"
FT   gene            281859..282401
FT                   /locus_tag="Desmu_0295"
FT   CDS_pept        281859..282401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0135 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64614"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y8"
FT                   /protein_id="ADV64614.1"
FT                   /translation="MPAMFKRSRDPLRKALEALYHVRLLRDRIDTLYNRISERREALFE
FT                   RLTDLESKGERYLAKRYAEEISKLDKLLSRLAAVQLVVEKVDLALQYAINMREFSGVAS
FT                   EVSSLVKDLSKLPELNIPDLNLAFAELQVSIRELSEASGPGALDLSYSPPGGSDVKRIL
FT                   EEAREVVKKRLENELTA"
FT   gene            complement(282422..283099)
FT                   /locus_tag="Desmu_0296"
FT   CDS_pept        complement(282422..283099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0134 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64615"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Y9"
FT                   /protein_id="ADV64615.1"
FT                   /translation="MSSADSTGVEKKPNWLLLKEAAEELYRSGKVYFTRKELVSKAREK
FT                   DPSRSEMSMDFEIDLVTVNGSSKDRYRDPEKLFLYRVDRGRYTLYNPEEHGELEKYIGV
FT                   QRVSPARKHLIEEVVKELEKAGYDASENRFAKPLQPDIIAEREDERLGVWIIDPGTPLS
FT                   DQYKMLAYAIGSCLLNKEFNDYVVVVPGELLKRVTKDLIDVLNQFRVRFATVKEERRYT
FT                   LQL"
FT   gene            complement(283128..283991)
FT                   /locus_tag="Desmu_0297"
FT   CDS_pept        complement(283128..283991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0297"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591; KEGG: dka:DKAM_0132 MRP
FT                   protein-like protein; PFAM: ATPase-like, ParA/MinD; SPTR:
FT                   MRP protein-like protein; PFAM: ParA/MinD ATPase like;
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64616"
FT                   /db_xref="GOA:E8R7Z0"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z0"
FT                   /protein_id="ADV64616.1"
FT                   /translation="MSSQEKRAAFTPVFKLINDAKRKLQGYRFKIIVLSGKGGVGKTFI
FT                   SSSIALGLALKGRRVAILDADIHGSSIPSMLGVQGMRHYASENGEILPVEGPLGVKVVA
FT                   VNLMLDSPDLPVVWRGPLVSKAITELLSKVAWGDGDYLVIDMPPGTGDAAITIAQVIPD
FT                   VTGAVIVTAPNMLTETIVAKAVNFTARNNIRLLGIVENMSYFKCPVCGSVFNLLGRSTG
FT                   EYLASKYGTRLLGKIPLDPLINEAVDRGEPYLLAYPEGEAAKAVMSMVDEIIKSVEADQ
FT                   SLGAQG"
FT   gene            284068..285021
FT                   /locus_tag="Desmu_0298"
FT   CDS_pept        284068..285021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0298"
FT                   /product="mevalonate kinase"
FT                   /note="COGs: COG1577 Mevalonate kinase; InterProIPR006203:
FT                   IPR006205: IPR006206: IPR006204: IPR 013750; KEGG:
FT                   dka:DKAM_0131 mevalonate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; SPTR: Mevalonate kinase; TIGRFAM:
FT                   mevalonate kinase; PFAM: GHMP kinases C terminal; GHMP
FT                   kinases N terminal domain; TIGRFAM: mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64617"
FT                   /db_xref="GOA:E8R7Z1"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z1"
FT                   /protein_id="ADV64617.1"
FT                   /translation="MPCSIAPGKVILFGEHFVVEGYPAIGLAVGLYASTCVEKGEFKIY
FT                   SRQLGPIDPSSPLAKPFLRVLEEAAREFNCGRDYTIYIDSGIPVGAGMGSSAAVNVSLT
FT                   HSLLHACGAGFTREDVSRIAYMGEVEVHGKPSGIDNTLATYGGLVYYKRGSFKRLDTLL
FT                   PEGVELVVADTGVKRDTGVVVRDVLEKRRRLGRLGGILYEAAGELVEEALAALRERDVV
FT                   RLGELMTVNHGLLFSMGASAWVNDYLVHRMLGLGAYGAKLSGAGRGGIVIGLAEPARAQ
FT                   AIVEELEREGVKAYRVKPDYEGVRLTTGSMVEPGYG"
FT   gene            285084..285533
FT                   /locus_tag="Desmu_0299"
FT   CDS_pept        285084..285533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0130 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64618"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z2"
FT                   /protein_id="ADV64618.1"
FT                   /translation="MNSHGLTGMALNGSRSGKIKLRVTRDVFNRLNSLLLESLPAIYGY
FT                   NGLIKGEKYYLKPVHIVSRRLPTGATVKYYYYGRYWYRVERSSDGRIKWIYLGRVKPSP
FT                   SLPDPPANPLEGLVVKKIEEEGVVELVFANEEVFKRLYSKLFQAT"
FT   gene            285637..286581
FT                   /locus_tag="Desmu_0300"
FT   CDS_pept        285637..286581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0129 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64619"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z3"
FT                   /protein_id="ADV64619.1"
FT                   /translation="MIVDIEASSRILNRVLLRYIILSRGSIVAKNKGIPGSRVLEYVGK
FT                   ACRSNVCMALLRAPGIWGDIYVSQGVPAAVNMEVDGEYLSGGLALEKLKELGEVDVEVY
FT                   AFNPEVVDGIYRQVDSLIKDVKGEVEADRKTMTIVNTLLKLTDTPCYMEELRLSGGEDL
FT                   LEARMVCVGKDLSFHAMLLALRILDLYSVAPSTLRFSTRLKTLEHGVLVEKKVEGDMEI
FT                   HDDTTRNIYVNLPSILASAGSHVLRAEVDRERGKTVVRVEATPPALDVEPDELAAMIHR
FT                   SLSKSLRRLEVIVEYVVETAVGPVKVSGKAPAP"
FT   sig_peptide     285637..285729
FT                   /locus_tag="Desmu_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            286764..287858
FT                   /locus_tag="Desmu_0301"
FT   CDS_pept        286764..287858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0301"
FT                   /product="egghead protein-like protein"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; KEGG: dka:DKAM_0128 egghead
FT                   protein-like protein; SPTR: Egghead protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64620"
FT                   /db_xref="GOA:E8R7Z4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027389"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z4"
FT                   /protein_id="ADV64620.1"
FT                   /translation="MSNLTGIMVGVALAYTLLLSIGLTGYIAYKPRRSSVKACNYEIVI
FT                   VSKADEKVQRSLIESVKYHVSRFSHITLVVDEGAPLISTLRYLRGVRLIVVPSGYRRDL
FT                   VGKGRALNYFVEHYVSPDKWYVFIDDDNLILDDSFLYEIPYYEAKGFVAGNGILLPRPG
FT                   KSMVSYVMDWIRYIDDLTLYRFFTGLLGKPLIGLHGELLIVKGSVLKEIGFNNRSITED
FT                   FRFAVELVRRKYKTWQSNTRVSIKSPNSVKDLMIQRGRWFKGLITDIKYSPAPMKLIVG
FT                   FRSFAWVLNLAVSVLFFPILVYLGLVWYILPGSIYYLASYTYGVIRSREPYLILLVPLF
FT                   GFIEASSRIYGLMRVNDFVVIDKN"
FT   sig_peptide     286764..286847
FT                   /locus_tag="Desmu_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            287892..289055
FT                   /locus_tag="Desmu_0302"
FT   CDS_pept        287892..289055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0302"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="COGs: COG1454 Alcohol dehydrogenase class IV;
FT                   InterPro IPR001670; KEGG: dka:DKAM_0127 iron-containing
FT                   alcohol dehydrogenase; PFAM: iron-containing alcohol
FT                   dehydrogenase; SPTR: Iron-containing alcohol dehydrogenase;
FT                   PFAM: Iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64621"
FT                   /db_xref="GOA:E8R7Z5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z5"
FT                   /protein_id="ADV64621.1"
FT                   /translation="MASKAFKLKYNDVTLFFGPGVLREKLAENVKGYGKALIITSKSAA
FT                   RVSGALDTVLEALKRESVEYVVYDGVKANPYASMADEAGRIAVENRVDLIVAVGGGSVI
FT                   DVGKLASVIATTGIKAADIAVNPASVSNARRLRLIAVNLTHGTGSEVDRYAVVTIDGTF
FT                   EKRGMAVRYPDVGFDDPLYTRTLSREQSLYTSLDAFYHAYEAATSTFSNHLTLTLSRDA
FT                   VEAVVGSLPRVLGDPGNLEHREKLLYASMIAGISIDQSMTHLNHALEHSFSGLHPELPH
FT                   GAGLAILGPMVVYYTHKAVPEASAHVLRPLDPGLKPLAGDAERAYRAVKEFQSSLGFDE
FT                   RLSDYGVDMGEVEKALEFTMRMIEARYTSIPFKPSLDVLRDIVARSL"
FT   gene            complement(289026..290255)
FT                   /locus_tag="Desmu_0303"
FT   CDS_pept        complement(289026..290255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0303"
FT                   /product="protein of unknown function DUF763"
FT                   /note="COGs: COG1415 conserved hypothetical protein;
FT                   InterPro IPR008482; KEGG: dka:DKAM_0126 protein of unknown
FT                   function (DUF763); PFAM: protein of unknown function
FT                   DUF763; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF763)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64622"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z6"
FT                   /protein_id="ADV64622.1"
FT                   /translation="MTRYSGVADLPLHNGHVPPYLFERMRVLGGLIARYIVEYYGPGEL
FT                   VRRLGDPFWFQAFNNVIGMDWDSSGSTTVVVYVLKNTFPPGSLRDNGIAVLGGKGRDSR
FT                   AVAEEAKAISDVADYERIVGASRMAAKIDGVALQDGYSIYIHSLIVDSDGDMLVVQQGL
FT                   NEDSGMARRYHLPVPKGSLPTTRVEPHSGVASMKIELSLNLANPGSREARRAILDIVSS
FT                   TPPGSLLNSLGEANRILRGEPSILSWVTGGAQGDTWSRVRQLTEVCPRYYRPVANLRLV
FT                   GKAASEIKKLGVREFDELIGLPGVGAETIRALALVADLIYGYRPSLRDPTTSIMDPFLY
FT                   AYAHGGKDGVPYPVRVEHIDRTIEFFASMLDEVKVGARDREHMLRRLASFADRVKRAIG
FT                   FLEGSSDYIP"
FT   gene            complement(290519..291952)
FT                   /locus_tag="Desmu_0304"
FT   CDS_pept        complement(290519..291952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0304"
FT                   /product="Acetylornithine transaminase"
FT                   /EC_number="2.6.1.11"
FT                   /note="COGs: COG0160 4-aminobutyrate aminotransferase and
FT                   related aminotransferase; InterPro IPR005814; KEGG:
FT                   dka:DKAM_0124 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase class-III; PRIAM: Acetylornithine
FT                   transaminase; SPTR: 4-aminobutyrate aminotransferase; PFAM:
FT                   Aminotransferase class-III; TIGRFAM: 4-aminobutyrate
FT                   aminotransferase, prokaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64623"
FT                   /db_xref="GOA:E8R7Z7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z7"
FT                   /protein_id="ADV64623.1"
FT                   /translation="MQGSLGWPRDVNIDIYTVQPYMYLLGALVMRPEVRIEPGSPGSKS
FT                   RQWIDEHFKYVATTTHDPEELPLVIERGEGVWLYDVDGNRYLDFSSAIGVNNLGYPTHP
FT                   EVKKAVVEQLERLAHAAGTDFFNPYQVMLAKKLAEIAPGGVPRKVFFSNSGTEANEAAV
FT                   KIARQATGRKLFIAFYGGFHGRTMGSLGLTASKSVHKRLVFPWMPGVFHAPYPNPYRNP
FT                   WHIDGYEEPVELVNRVIEFIEEYILEKLAPPEEVAAIFAEPIQGEGGYVVPPRVFFKEL
FT                   KKLADKYGILVSIDEVQMGLGRTGRMFAIEHFDIVPDIISMAKALSGGVVPIGATVFRS
FT                   DLDFKQPGIHSNTYGGHALASVAALKTIEVVEKLLPNVNRLEPLFREELEGLKQSVEQV
FT                   GDVRGIGLAWGVEIVKDKKSKTPDPSLRNRIVARALRNGLVLLPCGKSSIRLIPPLVIS
FT                   EEEAKTGLEIFRKAVKEAL"
FT   gene            complement(292305..292484)
FT                   /locus_tag="Desmu_0305"
FT   CDS_pept        complement(292305..292484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0118 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64624"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z8"
FT                   /protein_id="ADV64624.1"
FT                   /translation="MAVFKPGKNRREIIEELLRDLDPSLREEARRLLESMSPDELAGLR
FT                   KEDVYRRLGKQRPS"
FT   gene            292615..294045
FT                   /locus_tag="Desmu_0306"
FT   CDS_pept        292615..294045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0306"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterProIPR005841:
FT                   IPR016066: IPR005844: IPR005845: IPR 005843; KEGG:
FT                   dka:DKAM_0119 phospho-sugar mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase; SPTR: Phospho-sugar
FT                   mutase; PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   C-terminal domain; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64625"
FT                   /db_xref="GOA:E8R7Z9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8R7Z9"
FT                   /protein_id="ADV64625.1"
FT                   /translation="MGSCLGMVIAVRLFGTAGVRMRYPDELDAVAAYRLGLAMGVLGLS
FT                   SCSYIVYDTRVTSHVLTYAFAAGVAASGMDASIVGLAPTPVAGYAGLRRGGVGVSVTAS
FT                   HNPPEYNGFKFYDVEGFEFTRSLEERVEELVSGSLKAAEWSRAGRILHDSTLLDDYVED
FT                   LLEASQPSRRAWSPRVVVDCANGASYHVTPVVVRSLGGIPVTVNCSPDGYFPGRPPEPR
FT                   RDVLEKLLPVYRGVEPAMVLAHDGDADRLAALDPFQGFIRQDRLLALFAKILLEERKGV
FT                   VVVSVDTGRVVDEVVEASGGRLERYILGKTHERVKELGVGSVVMAGEPWKLIDTSWGPW
FT                   VDGVRQAALLVKLVVERGKPLARILEEEGVPDYPWDRRSYVIDPPGARMDVYKGLVEEL
FT                   KSRLGEPVAVIDIDGYRFEYSDDSWILVRVSGTEPKIRVYAEARSSERLKEMVDTVGAI
FT                   VKEMASRRDARIASVTIG"
FT   sig_peptide     292615..292668
FT                   /locus_tag="Desmu_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(294063..294833)
FT                   /locus_tag="Desmu_0307"
FT   CDS_pept        complement(294063..294833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0120 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64626"
FT                   /db_xref="GOA:E8R800"
FT                   /db_xref="UniProtKB/TrEMBL:E8R800"
FT                   /protein_id="ADV64626.1"
FT                   /translation="MKTWIPGTAKWLAYSVGAGLVAVVLLRGFSTYIAVDLAVLTAGIV
FT                   VFTLLFPYHLSTDVTGRRVLPRGSGEISLFVSAYLPVLALYVLLLLGYGGSMTATVGGL
FT                   LAPLIVVPGLLVVGLMLHYGLYRPVAGVPARIIVTAVVLLVDAVIWMCILLPAGLYVLG
FT                   ALEFSRLYLGAVLQQEPVAVALLLIPPASLVLAAVDLARYRGRGYMVAVGFGVPAYRRL
FT                   LVSRVFKRLASSHVINVPHEVYLDVSSFLQHSYS"
FT   sig_peptide     complement(294732..294833)
FT                   /locus_tag="Desmu_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            294942..296582
FT                   /locus_tag="Desmu_0308"
FT   CDS_pept        294942..296582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0121 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64627"
FT                   /db_xref="UniProtKB/TrEMBL:E8R801"
FT                   /protein_id="ADV64627.1"
FT                   /translation="MGRRSEGKPLIVGFIGFSQSGKSSRIENILRLTGSETMEPAVYTR
FT                   VYEKGTRHSRHFMPFASVARGRTIDTVLVTVDYTGHDHLAAYFFTRRILEALEKGLLGA
FT                   GREALVRELVENAGSVVDELAARRRGLSKRLLLQLLDSPIPGYKYLRDYFDPYRELCGV
FT                   IRGAPCRDEEVARVVEYVRQTLRETGRDMVSFNDLNRILCVLESSHQTRERCLDIGKAD
FT                   RVEIVVDEAGGYFARLVVTAPLLTHLLVGLLIESNILFILVPASIGDYLNQLKRLFMGD
FT                   DSKSPHYLLAALRALAWAGEDVHGLLVKALSSTVKDKASGEDTGRIVEECLETTVEEEV
FT                   ARLKLPRDAVQVVASAAPFTSINGYRGFIGCVSKALTGEAGGEGLDKGLTEALTRVVLE
FT                   KYQVGLLEALLKLLGYIAGSGVKPVLSTVVFDYTYMDKARRPFKEIVSRSLSSSLLEFD
FT                   RDTPALSEVYRLLRETPGLKGVDLEVYALPSSLHGSYSTPFEYMMLVCLLEDKLASFKV
FT                   TSKDTGESREVLCVDLLKEMRLHHGAGRV"
FT   gene            complement(296632..297705)
FT                   /locus_tag="Desmu_0309"
FT   CDS_pept        complement(296632..297705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0309"
FT                   /product="aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterPro IPR002082: IPR006130: IPR006132: IPR006131; KEGG:
FT                   dka:DKAM_0117 aspartate/ornithine carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain; SPTR:
FT                   Aspartate/ornithine carbamoyltransferase; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64628"
FT                   /db_xref="GOA:E8R802"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E8R802"
FT                   /protein_id="ADV64628.1"
FT                   /translation="MGRHKPWFVGYLKGKDWLSNYDYDIDTVFKVLQAARELKQMYHSG
FT                   VRKVNWLEGKMLYLIFYNKSLRTRNSFQTGVYQLGGQATYISPDQVYAPTLPEDMVPYQ
FT                   TEAISDVARVLSRYGDAIAIRIYGDAAKWIIGRGHRIIREFAKWADIPVLNMEDDVWHP
FT                   FQSLADAQAALEALGWPKDLRGKKVVVSYAYSGGLKPLAVPQDVASMFALLGADVYVAH
FT                   PPGFELMDEAMQIAKKYAEHWGSEFKIVHDMDEAFEGATIVYPKAWSPRGFFPPYNSTV
FT                   DKEGAKAYQDKFKNWIVTMERLEKAGKPFYMHCGPADRGQEVTDEVLDSYEKSLYFEEA
FT                   ENRLHVQKAVMSMVMGE"
FT   gene            297848..298471
FT                   /locus_tag="Desmu_0310"
FT   CDS_pept        297848..298471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0310"
FT                   /product="protein of unknown function DUF84"
FT                   /note="COGs: COG1986 conserved hypothetical protein;
FT                   InterPro IPR002786; KEGG: dka:DKAM_0116 protein of unknown
FT                   function DUF84; PFAM: protein of unknown function DUF84;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF84; TIGRFAM: inosine/xanthosine
FT                   triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64629"
FT                   /db_xref="GOA:E8R803"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E8R803"
FT                   /protein_id="ADV64629.1"
FT                   /translation="MNKCWEAFHIMDAGSPGSRITVCIGSRNPAKIKGVVNAFTRFFGS
FT                   VEARFTSPETGLPPQPIGLELIIEGARRRAIYAAEKLGECDYSVGVEAGWILVMGDYYD
FT                   LEAAWIHGRNGVDSLGFSPVFKIPRGFAELVVSGARRELEEVVDEHYGTRSIGDKGGFI
FT                   SLLTKGVVVRQDLSFMATVMALIPVVNRDLYRDPGLQPPASSQR"
FT   gene            complement(298444..299964)
FT                   /locus_tag="Desmu_0311"
FT   CDS_pept        complement(298444..299964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0311"
FT                   /product="Citrate transporter"
FT                   /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
FT                   arsenite permease; InterPro IPR004680; KEGG: dka:DKAM_0113
FT                   citrate transporter; PFAM: Citrate transporter; SPTR:
FT                   Citrate transporter; PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64630"
FT                   /db_xref="GOA:E8R804"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E8R804"
FT                   /protein_id="ADV64630.1"
FT                   /translation="MRPLVKLAVSIAVVFTLSFFLMSILHVSGPLGDRIAGMVAEYRGG
FT                   APLDLNSLQADVAQSIALTIFFTVIIATVMKMEWRVAAAITGVGVLAITGLTPPQNMIY
FT                   RAIDWRLLVFLIGSMTLAGILREAGVFNRLAVSLVEKSTSAFRLLLLLGLFSALLSMIL
FT                   GEVTSIIYAVLVVLELRRVLEIDVKPLIVYTVLATNTGSVALPVGNPIGVYIAFTANIS
FT                   VAEFLAKCLPLSLLEVLVLILVYRLVLSNYVERLNGELKQSRELIAKLTAARTIDVTPV
FT                   MARHTRIGLLILAVFTGLVVLNEKLAEAMSLATGVPVDPDSLLAFIPYLSIALALLLAD
FT                   PSSMDKLLSSAVEWPSIIFFMSLFILSYALSYTGAIAKIAYGIAMFSEPGSFTGNMLVV
FT                   GVLLAASAMLSSVLDNLSVIVALTQPVTILVQLGLSRVSYLALLYGGVFGGNYTPIGST
FT                   ANIVAVSMAEREKIAVSWGEWLRIALVSTTLQITVALLWSYLWLLAGG"
FT   sig_peptide     complement(299878..299964)
FT                   /locus_tag="Desmu_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(300033..300644)
FT                   /locus_tag="Desmu_0312"
FT   CDS_pept        complement(300033..300644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0312"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="COGs: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase; InterPro IPR001736; KEGG:
FT                   dka:DKAM_0112 phospholipase D-related protein; PFAM:
FT                   phospholipase D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase; SPTR: Phospholipase D-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64631"
FT                   /db_xref="GOA:E8R805"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E8R805"
FT                   /protein_id="ADV64631.1"
FT                   /translation="MQARVVDTGARSILVVFAVGVVAGLIAGIYVYSRLETGGGVAVNN
FT                   TCSMSLLLDREYYSAALKALGNAERSVYVIMYVVKYDPREAGDPVNSLLNALRDLREKG
FT                   VDVKVVVDDETYRSYRETIDYMVASGIPVRLDESASRTTHAKILIVDNSTLILGSHNWT
FT                   ESALTMNHEASVETNCHSLVSKALSYFDSIWGSGRSVAST"
FT   sig_peptide     complement(300576..300644)
FT                   /locus_tag="Desmu_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            300724..301851
FT                   /locus_tag="Desmu_0313"
FT   CDS_pept        300724..301851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0313"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon); InterPro IPR018357:
FT                   IPR005835: IPR001451; KEGG: dka:DKAM_0111 nucleotidyl
FT                   transferase; PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; SPTR: Nucleotidyl
FT                   transferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64632"
FT                   /db_xref="GOA:E8R806"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R806"
FT                   /protein_id="ADV64632.1"
FT                   /translation="MKAVVLAGGLGTRLYPLTKVAPKPMIPLAGKPILEYIVDGLVRHG
FT                   FTDIIIAARYLGTQVVEYFKGHPYAKPVILDSKDTADAVRLLDGVFDDHFIVSMGDTLC
FT                   NADYREIYDYHKSSNAVATIALKQVENPLPYGIVYLDEHGDILLFIEKPLSIEVYLLSL
FT                   AYYRQKGASAYENLINAGIYVFNPHILEILERNPGLMDFGRHVFPYLVENGYRVRGHVL
FT                   GHSVYWNDIGRLETYKSVAWDMLDGRIPGLEPAAPMASKGVYIHDSAIVRGRVNPPVYI
FT                   GRSVVVEEGASVGPYAVLEDNAVVGKGSVIQEGIVWRDTLIGEGSRIYDSILMNRVEVA
FT                   PGSTLVSTVVGTGSRVSGELSKMILDPVEVTPPYA"
FT   gene            301844..303091
FT                   /locus_tag="Desmu_0314"
FT   CDS_pept        301844..303091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0314"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="COGs: COG1109 Phosphomannomutase; InterPro
FT                   IPR005844; KEGG: dka:DKAM_0110
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I; SPTR:
FT                   Phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; PFAM: Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64633"
FT                   /db_xref="GOA:E8R807"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:E8R807"
FT                   /protein_id="ADV64633.1"
FT                   /translation="MLKQVDGRITGKPLVDISLEDVAMLGAVFGTVLGRRALVVSGRDT
FT                   APVSRMLKRALTAGLMSVGCDVMDFHEAVSGEISFSMKRFGAKGGFNIHLNPRRPGYIT
FT                   IRLYKAPGYELVGGGLAEVASREKPVPQEAGEVGWVNYAEYMHELYASALVSFVKSDEI
FT                   SAAKLNIVASHGHGASDEVLRRIFTLLELEYTLMSSGRISGETYPFVKEMGKVAASTRA
FT                   MRADLGVVFNIDASALAVYIGNLGFLLPEEILLAVLTRYPGNSSVVVDKYVSPSIVRYM
FT                   GEKGYRVRVAESEEKLIELVRRERPVLALNGRGDFITPLFSLGYDALIAFMQLLEALSL
FT                   QRSEVYGEINTARSMLTPRARSLSEVEAVCNSDTTCVRTLWGFRMLRERTLHTYIYSPD
FT                   AGGYIEIVEQQREPSS"
FT   gene            complement(303188..304474)
FT                   /locus_tag="Desmu_0315"
FT   CDS_pept        complement(303188..304474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0315"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /note="COGs: COG1350 alternative tryptophan synthase
FT                   beta-subunit (paralog of TrpB); InterPro IPR006653:
FT                   IPR006316: IPR001926; KEGG: dka:DKAM_0745 tryptophan
FT                   synthase subunit beta; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   PRIAM: Tryptophan synthase; SPTR: Tryptophan synthase beta
FT                   chain; TIGRFAM: pyridoxal-phosphate dependent TrpB-like
FT                   enzyme; PFAM: Pyridoxal-phosphate dependent enzyme;
FT                   TIGRFAM: pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64634"
FT                   /db_xref="GOA:E8R808"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8R808"
FT                   /protein_id="ADV64634.1"
FT                   /translation="MELRSPQTRDIVPSYWYNITPDLPEQLPPMLHPDGSPVDKRELEA
FT                   LFPRSLVEQEFTTQRHVEIPGEVVETLLMLGRPTPLIRARRLEEALKTNAVILFKYEGV
FT                   MPTGSHKVNTAVAQAYYNAAEGVERVSTETGAGQWGSALSLAGSLFGLKVRVFMVRASY
FT                   LQKPYRRILMESYGAEVYPSPSDRTNTGRRLLAENPDHPGSLGIAISEAIEDVVSSGGK
FT                   AKYSLGSVLNHVLLHQTVIGLEALKQLEMLGVDRVDYIVGCVGGGSNFAGLSYPFIGHR
FT                   YNDGDPPVFIAVEPETVPSMTRGEYRYDYGDTAGLTPLLKMHTLGHDYIPPPIYAGGLR
FT                   YHGVAPSLSILVKNGLVKPVAYGESEVLEAGLLFARTQGILPAPESSHAVKAVIDIALK
FT                   HRGSSRRPVILFNLSGHGLLDLSAYSRTS"
FT   gene            304576..305013
FT                   /locus_tag="Desmu_0316"
FT   CDS_pept        304576..305013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0316"
FT                   /product="DNA binding protein, Tfx family"
FT                   /note="COGs: COG1356 conserved hypothetical protein;
FT                   InterPro IPR000792: IPR004645: IPR007630; KEGG:
FT                   dka:DKAM_0744 putative transcriptional regulatory protein;
FT                   PFAM: sigma-70 region 4 domain protein; SMART: regulatory
FT                   protein LuxR; SPTR: Putative transcriptional regulatory
FT                   protein; TIGRFAM: DNA-binding protein, Tfx family; PFAM:
FT                   Sigma-70, region 4; TIGRFAM: DNA-binding protein, Tfx
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64635"
FT                   /db_xref="GOA:E8R809"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR004645"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR029291"
FT                   /db_xref="InterPro:IPR036657"
FT                   /db_xref="UniProtKB/TrEMBL:E8R809"
FT                   /protein_id="ADV64635.1"
FT                   /translation="MSREEAWSWMGRGLFTERQYLVLKYRAQGLTQEEVAGILGVARST
FT                   VAAIERAALRKLRLAQETVSIYKMMHAAGYIDIPAGTHMVDIPGIIIRKADELGVKLKG
FT                   DFNLVYGQLRLLIGSRATRLPRTVRAVIYRDGSYEFLEVHD"
FT   gene            305255..305515
FT                   /locus_tag="Desmu_0317"
FT   CDS_pept        305255..305515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0317"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /note="InterPro IPR017896: IPR017900; KEGG: dka:DKAM_0536
FT                   2-oxoglutarate ferredoxin oxidoreductase, delta subunit;
FT                   SPTR: 2-oxoglutarate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64636"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8R810"
FT                   /protein_id="ADV64636.1"
FT                   /translation="MSTVLPEAGLIARGNGRYRVNIIVDRCKECGICIAVCPMKVLAKS
FT                   SILNRNGYRPPEPAHVEKCIGCRLCEYNCPDFAIYVEVESK"
FT   gene            305512..306630
FT                   /locus_tag="Desmu_0318"
FT   CDS_pept        305512..306630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0318"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR002880: IPR005476; KEGG: dka:DKAM_0535
FT                   2-oxoglutarate ferredoxin oxidoreductase subunit alpha;
FT                   PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; Transketolase domain-containing protein; SPTR:
FT                   2-oxoglutarate ferredoxin oxidoreductase subunit alpha;
FT                   PFAM: domain; Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64637"
FT                   /db_xref="GOA:E8R811"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R811"
FT                   /protein_id="ADV64637.1"
FT                   /translation="MRKTFASGNMAVAEAAITAGLKFYAGYPITPSSEIMEYLAEHLPR
FT                   HGGIVIQMEDEIASINAVVGASWANVKAMTATSGPGFSLMAEGLGLAVMTETPLVVVDV
FT                   MRAGPSTGVPTKTTQADIFQARWLAHGDYIIPSYAPWSVQEAYDLTIKAFNTAEKLRTP
FT                   VILLSDAVIAHLWEPLVIRERGEVEIIERRKPAGREGYKPYMPGDDLVPPMACFGEGFK
FT                   VLVESLTHDERGFYAPSTTYHRSTVVRLALKILKNIDYVFEYEAYMMDDAEVALVSYGS
FT                   TARTVYALMRELRRKGVKAGLLRLKTLWPLDEEKIYRSVKAGRIIVVENNMGKLYLDVK
FT                   RIFRDREVYPAPVISLELPTVSEAMEVVEQWL"
FT   sig_peptide     305512..305556
FT                   /locus_tag="Desmu_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            306621..307451
FT                   /locus_tag="Desmu_0319"
FT   CDS_pept        306621..307451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0319"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: dka:DKAM_0534 2-oxoglutarate
FT                   ferredoxin oxidoreductase, beta subunit; PFAM: thiamine
FT                   pyrophosphate TPP-binding domain-containing protein; SPTR:
FT                   2-oxoglutarate ferredoxin oxidoreductase, beta subunit;
FT                   PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64638"
FT                   /db_xref="GOA:E8R812"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8R812"
FT                   /protein_id="ADV64638.1"
FT                   /translation="MAVAPRYMHPLDRHLRLERIPTLYCPGCGLGIGLGAMLRALDKRI
FT                   KEGVVKEDKVVWVGGIGCSARMAFYVNYDSAHVLHGRAIPFAIGAKLANPELTLIVVGG
FT                   DGDIAGIGGNHILHAAKRNIDLVTVMFTNFVYAMTGGQVAPTTPLRVKTTTTPHGNPEP
FT                   PLNIIKVVASLNANYVARASITTPHYIEQFFYRALGMKGFRFLEVVSTCPEVYGRHIGL
FT                   RDPVEMYNELRKRVKYKPNPTIDEAIIDWDKGIVIGEFIVRDNPSYMDLVRGLK"
FT   gene            307448..307984
FT                   /locus_tag="Desmu_0320"
FT   CDS_pept        307448..307984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0320"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain protein"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752; KEGG: dka:DKAM_0533 2-oxoglutarate
FT                   oxidoreductase gamma subunit; PFAM:
FT                   Pyruvate/ketoisovalerate oxidoreductase, catalytic domain;
FT                   SPTR: 2-oxoglutarate oxidoreductase gamma subunit; PFAM:
FT                   Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64639"
FT                   /db_xref="GOA:E8R813"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E8R813"
FT                   /protein_id="ADV64639.1"
FT                   /translation="MKVEILIIGRGGQGVLLLGRLLGLAASKYAGLYAVATETYAAETR
FT                   GGESRADVVIGGSMSDIDYVKVQSPDIAVFMYPFNIEKYRQLLKPESRVFIDEEYVKPD
FT                   FFKGFKLYSQRYSGLAESTVGSSRVANMVIAGHIARATGILSLEDLKKTVIDLTPERWH
FT                   QANIKALELGFSLPV"
FT   sig_peptide     307448..307522
FT                   /locus_tag="Desmu_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(307998..308070)
FT                   /locus_tag="Desmu_R0016"
FT   tRNA            complement(307998..308070)
FT                   /locus_tag="Desmu_R0016"
FT                   /product="tRNA-Ala"
FT   gene            complement(308209..308859)
FT                   /locus_tag="Desmu_0321"
FT   CDS_pept        complement(308209..308859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0321"
FT                   /product="alpha-glucosidase"
FT                   /note="KEGG: dka:DKAM_0582 alpha-glucosidase; SPTR:
FT                   Alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64640"
FT                   /db_xref="GOA:E8R814"
FT                   /db_xref="UniProtKB/TrEMBL:E8R814"
FT                   /protein_id="ADV64640.1"
FT                   /translation="MESTILLNDAADALRRMLASRRLSDPRLRRRLEEALASLESAGRE
FT                   ITVDNVELARLINKKARDLASRVLEASGEGLPGDLVKELDTLVKWCKMAPYDFTDRIRL
FT                   VRKGYRYYLTGMILFFILAGTFAQAYAVSALMLALPALMAMSMMKKRRSTGLMLAYASM
FT                   PLPLVIFTWILGYAVYAFTNPAEASVLAGEYGLPAGLVYFILALYLAGSVIVC"
FT   gene            complement(309084..309194)
FT                   /locus_tag="Desmu_0322"
FT   CDS_pept        complement(309084..309194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0417 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64641"
FT                   /db_xref="GOA:E8R815"
FT                   /db_xref="UniProtKB/TrEMBL:E8R815"
FT                   /protein_id="ADV64641.1"
FT                   /translation="MDPSAVAFMLASWIFILGLAAWCLWKQFGGGKKTKT"
FT   sig_peptide     complement(309126..309194)
FT                   /locus_tag="Desmu_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(309207..310757)
FT                   /locus_tag="Desmu_0323"
FT   CDS_pept        complement(309207..310757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0323"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="COGs: COG0733 Na+-dependent transporter of the SNF
FT                   family; InterPro IPR000175; KEGG: dka:DKAM_0583
FT                   sodium-dependent transporter; PFAM: sodium:neurotransmitter
FT                   symporter; SPTR: Transporter; PFAM: Sodium:neurotransmitter
FT                   symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64642"
FT                   /db_xref="GOA:E8R816"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E8R816"
FT                   /protein_id="ADV64642.1"
FT                   /translation="MSISGERETWATRIGLILSMAGNAVGLGNFWRFPRLLAGNGGGAF
FT                   MIPYFAALLLLGIPLMWVEWATGRYGGKYGHGTLGPTFYLMARESVKPRTAIVFGIIGG
FT                   MLAFAVTTLLNSYYIHVIGWTAAYAIYSATGAYYGVDTVQFFNNHIGNTGMVMATWAIP
FT                   MILLFIAAYRGVSKGIELFNKIMMPLLYLFAVILAVKSVTTGAPVRPDWSSWAGLEYSW
FT                   KPDFGVLMQNFWVISLAAAGQIFFTLSLGMGIIQNYASYVKKDDDIALAALTTASLNEV
FT                   AEVVLGGTIAIPIAYAYLGPSVVKQGSLGLSFMALPNVFTSLGEAGRVFGVLWFLLLFF
FT                   AGWTSAIAMYNYLVALLEEDLGVKRKVAAVVVFIVYLLLGLPVALDPSLTYFGELDNWV
FT                   GSYLLVLLGLFDVIVAVYLFKPGNLWRELHNGALIRVPEVFKYILMTLTPAYILILLVG
FT                   TTIDYYKSGVFAQSDPLIVGARVAILIALLIGAIETYYGIKRKYARELAENRKIIVVE"
FT   gene            complement(310869..312113)
FT                   /locus_tag="Desmu_0324"
FT   CDS_pept        complement(310869..312113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0324"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
FT                   InterPro IPR001991: IPR018107; KEGG: dka:DKAM_0584
FT                   proton/glutamate symporter; PFAM: sodium:dicarboxylate
FT                   symporter; SPTR: Proton/glutamate symporter; PFAM:
FT                   Sodium:dicarboxylate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64643"
FT                   /db_xref="GOA:E8R817"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E8R817"
FT                   /protein_id="ADV64643.1"
FT                   /translation="MTKPPRSGAYRFLAVILAAFLLGLLAGYLVSSFAPKETASATASW
FT                   LKALGDVFVRLIRIVIPLLILFTIAAATSSIASARKLGRILAWMLILYIGTSILAATWG
FT                   VLGGVFFKPGEGIGLQVPKDYKPPTPPSGVDLLLSFFQPDFSNLLTVSGSMTMIIFAIL
FT                   LGVAAVLMGEPGRRVASGLSLLSSLMVKFVSVVMYYAPVAVFSYSAWLMISYGPAMLGA
FT                   YARFLGVQYGFTLMHFFIVYSIIVYVGGLNPLKYFKAQLTPFLVAFTTRSSAVTLPFNM
FT                   EAARKMGIPDEVFEITLPVGATVNMDGTALYQALSALFIAQLFGISLTPGQLGMAIMAA
FT                   VIGSVATAAIPGGGTIMLAYVLSVLGLPLEGVGIMLVVDPLADAVRTAVNASGDNACTV
FT                   LISRLTGYRLNPPQV"
FT   sig_peptide     complement(311991..312113)
FT                   /locus_tag="Desmu_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(312224..312730)
FT                   /locus_tag="Desmu_0325"
FT   CDS_pept        complement(312224..312730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0585 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterised
FT                   protein family (UPF0113)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64644"
FT                   /db_xref="GOA:E8R818"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:E8R818"
FT                   /protein_id="ADV64644.1"
FT                   /translation="MKMVRLKKGVAGGSIRMRLHRVLRDVYGVDPVEYVEGRLGYTCID
FT                   NVCLIYVADAAAPLGNTPVIYMGSWVAVLVSGELAPSIPLVEKIYKDKGVRAAIIVREK
FT                   GVKAFLYGNDVLPESIVEKREPVEGLVTVVDSSDHGIVGFAKWDPVRKVYRNIYDLGVY
FT                   LRLLG"
FT   gene            complement(312727..313761)
FT                   /locus_tag="Desmu_0326"
FT   CDS_pept        complement(312727..313761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0326"
FT                   /product="ribosomal RNA methyltransferase NOP2"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0144 tRNA and rRNA cytosine-C5-methylase;
FT                   InterPro IPR001678; KEGG: dka:DKAM_0586 putative RNA
FT                   methylase, NOL1/NOP2/sun family; PFAM: Fmu (Sun) domain
FT                   protein; SPTR: Putative RNA methylase, NOL1/NOP2/sun
FT                   family; PFAM: NOL1/NOP2/sun family; TIGRFAM: NOL1/NOP2/sun
FT                   family putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64645"
FT                   /db_xref="GOA:E8R819"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:E8R819"
FT                   /protein_id="ADV64645.1"
FT                   /translation="MQRLRVYDIYREIYVEPSRQAVELALEYGYLPYMVQRYIDMLGPR
FT                   EAVELLEAFEKPVRQVVRANTLLVEPGELKTRLESLGFRLEEIPWAPGSFWVAEAPRSP
FT                   SIGSTHEYLKGFYYVHRDATSLIPVLLLLGDGYKGDVLDACAAPGGKATFTAQILKERG
FT                   GGTVYANDYVLYRLKSLIGHVLRMKLDNIVVTWGNAAELPGRVGRRFKRILLDAPCSGE
FT                   GRISVDPGRKTRTSILDLAIMVKREVELLGSLIDMLDEEGVIAYSTCSIAPEENEYVVA
FT                   KILESRRDVEVADPGPLPFNHSRWLTSYRSMEYPRELEKCIRIWPHRHGLFGFTTCLLK
FT                   RVGA"
FT   gene            complement(313767..314459)
FT                   /locus_tag="Desmu_0327"
FT   CDS_pept        complement(313767..314459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0327"
FT                   /product="protein of unknown function DUF72"
FT                   /note="COGs: COG1801 conserved hypothetical protein;
FT                   InterPro IPR002763; KEGG: dka:DKAM_0587 hypothetical
FT                   protein; PFAM: protein of unknown function DUF72; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64646"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:E8R820"
FT                   /protein_id="ADV64646.1"
FT                   /translation="MEVYVGTSGWLYEWNEGASLEWYAEESGLNAVELNASFYRFPFRN
FT                   QVASWSRKGRRLRWSIKVHRSITHLRRLDEKALETWGRFHGVFNPMEGLIDFYLFQMPP
FT                   GFTCHSSNLERVDRFHEASGLGPRMAVEFRHESCFNEEVAEWGRRKGIVVVSIDAPIAS
FT                   WIVESGGVVYLRMHGRTTWYGHEYTEEELRGIAEKILSLNPVKAYVFFNNNHWMLENAR
FT                   SLLRILGA"
FT   gene            complement(314559..315743)
FT                   /locus_tag="Desmu_0328"
FT   CDS_pept        complement(314559..315743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0328"
FT                   /product="phosphate transporter"
FT                   /note="COGs: COG0306 Phosphate/sulphate permease; InterPro
FT                   IPR001204; KEGG: dka:DKAM_0588 phosphate transporter; PFAM:
FT                   phosphate transporter; SPTR: Phosphate transporter; PFAM:
FT                   Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64647"
FT                   /db_xref="GOA:E8R821"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E8R821"
FT                   /protein_id="ADV64647.1"
FT                   /translation="MVLAGFIGAFMLAWIDGANNAANSIGTVIGARALPVRRALLIASF
FT                   FELAGGVVYGEYISSTLASRVVDTSNLPPRVAAVGFASALIVSFIIVFAATRRRIPFSI
FT                   SIVMVGAVAGVGLAAGVEHVNTVLISELFALWILIPLISILAGYTYYRLYSYLRSRRSL
FT                   YAKTFLPLLLLYASFTVSAVYMAIPGHLLSDPLILGTITLLLAAPLASLLLYLYRVLHR
FT                   EVLEESEVDAVVGRFNRRMLIASSAILAFTHGGHDVANAAAPLMVILESTGVNHTGSQL
FT                   LILAYSSLGISTGVLSWGASVARTIGEEITVLNPESALVANIAGAQTTLVVTRLGLPSS
FT                   MVGIVVGSIIGVGLARGVSGINTRLFARMLSYWYAGFTVAALATYTATRILAPV"
FT   sig_peptide     complement(315693..315743)
FT                   /locus_tag="Desmu_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            315938..316498
FT                   /locus_tag="Desmu_0329"
FT   CDS_pept        315938..316498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0329"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR011894: IPR019752; KEGG: dka:DKAM_0581 pyruvate
FT                   synthase subunit PorC; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase, catalytic domain; SPTR: Pyruvate synthase
FT                   subunit porC; TIGRFAM: pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; PFAM: Pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; TIGRFAM:
FT                   2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64648"
FT                   /db_xref="GOA:E8R822"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E8R822"
FT                   /protein_id="ADV64648.1"
FT                   /translation="MMIEIRWHGRGGQGAWTASNIVAMAAALEGKHVQSFPAFGPERSG
FT                   APMLSFTRISDEPIEVHSMIYEPDVAVVLDYTLLSPSIVSGLKKGGTIVTNYAGTVDQV
FT                   LGKLGVRRGGDYKVILVPASKLALEILRANITNTAMIGGLLRHGGIVKWESVEKAVKAR
FT                   FKGPVAEKNISLIKRAYEESLEV"
FT   gene            316503..316784
FT                   /locus_tag="Desmu_0330"
FT   CDS_pept        316503..316784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0330"
FT                   /product="pyruvate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR017896: IPR017900: IPR011898; KEGG:
FT                   dka:DKAM_0580 pyruvate synthase subunit PorD; SPTR:
FT                   Pyruvate synthase subunit porD; TIGRFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, delta subunit; PFAM:
FT                   4Fe-4S binding domain; TIGRFAM: 2-oxoacid:acceptor
FT                   oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64649"
FT                   /db_xref="GOA:E8R823"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E8R823"
FT                   /protein_id="ADV64649.1"
FT                   /translation="MSEPRGWRSLPMGGVAYRLSTDVKTGDWRALKPVVDHGKCTKCMI
FT                   CWLFCPDMAIVWDGEKIQVNLDYCKGCGICAHECPVKAISMVPEFEEV"
FT   gene            316788..318047
FT                   /locus_tag="Desmu_0331"
FT   CDS_pept        316788..318047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0331"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR002880; KEGG: dka:DKAM_0579 pyruvate synthase
FT                   subunit PorA; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; SPTR: Pyruvate synthase
FT                   subunit porA; PFAM: domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64650"
FT                   /db_xref="GOA:E8R824"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:E8R824"
FT                   /protein_id="ADV64650.1"
FT                   /translation="MEKTALKPKIPLEKQVLMTVNGDEAVAYAVKQSYVDVVAAYPITP
FT                   QTIIVEKYSEFVNDGLVHTEFVPVESEHSAMSACVGAAAAGARAFTATSSQGLALMVEI
FT                   VYIASAMRLPIVMAVVNRALSAPINIHNDHSDAYLMRDSGWIQLFVENVQEAYDTTIQA
FT                   FKIAEDPRVQLPVAVNLDGFFLSHTLEEVYMLPDDEVYGFLGGPRKTVNVKVDYFEEEV
FT                   PFTLNPARPISLGSLDLYDYYFEHKVQQVEAMKAVPQVVREVNEEWYRLTGRRYGDGVL
FT                   RAHWVDDADIVVVAMGSGAGTVRSVVRKLREKGERIGLLQLRMFRPFPYSEVAEKLSGA
FT                   KLVVVMDKAIGPGAFGALYEDVAVSLYDSGERPMLVDYIYGLGGRDLQPSLVYKMIEEA
FT                   KRDLEAKRVERKIRYLGVRE"
FT   gene            318050..319108
FT                   /locus_tag="Desmu_0332"
FT   CDS_pept        318050..319108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0332"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: dka:DKAM_0578 pyruvate synthase
FT                   subunit PorB; PFAM: thiamine pyrophosphate TPP-binding
FT                   domain-containing protein; SPTR: Pyruvate synthase subunit
FT                   porB; PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64651"
FT                   /db_xref="GOA:E8R825"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8R825"
FT                   /protein_id="ADV64651.1"
FT                   /translation="MTVKTLPEFPVKKGEPAYKLWIFDPGWKGEIPLTFNLRQLAEQKR
FT                   SVLLPGHRLCAGCAAPIVVKLASFAFRGPTIVVNATGCLEVASTIFPYTSWAVPWIHVA
FT                   FENAAAVAGGVESAIKALKKTGRLPYDHVDVVVFAGDGGTFDIGFQALSGMAERGHDVL
FT                   YILYDNEAYMNTGIQRSGGTPQFAATTTSPAGEVVPGKTQPKKPIADIMVAHRIPYVAT
FT                   GTPAHWMDFMKKVRRGIEVNGPAFIHALSDCNRGWRHETDISVEIMRRAVDTCYFPLWE
FT                   WTPEQGYVLTDRSLTIARNPSLKQPIEKYIEVQGRFRHLLKPENRELLKQFQEYVDKVW
FT                   EDLLRRASNAPR"
FT   gene            319095..319643
FT                   /locus_tag="Desmu_0333"
FT   CDS_pept        319095..319643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0333"
FT                   /product="hydrogenase maturation protease"
FT                   /note="COGs: COG0680 Ni Fe-hydrogenase maturation factor;
FT                   InterPro IPR000671; KEGG: dka:DKAM_0577 hydrogenase
FT                   maturation protease; PFAM: peptidase M52 hydrogen uptake
FT                   protein; SPTR: Hydrogenase maturation protease; TIGRFAM:
FT                   hydrogenase maturation protease; PFAM: Hydrogenase
FT                   maturation protease; TIGRFAM: hydrogenase maturation
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64652"
FT                   /db_xref="GOA:E8R826"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:E8R826"
FT                   /protein_id="ADV64652.1"
FT                   /translation="MPPGSDTRVFSKRELIEVLANLIGEDTVIAGVGSPLRMDDRAGLV
FT                   FCDKLLAKGFKCIKCEYGLENCINEIRESGAVRLVVVDAVLYEGAEPGEIVVASGDALA
FT                   EKYSLATTHTLPVKTVLRILGETGVREVYVVGIAPKQLGYGLEVSDKVAESVEKLVEAF
FT                   TSVLAGKQGRSSGERGDDA"
FT   gene            319640..320299
FT                   /locus_tag="Desmu_0334"
FT   CDS_pept        319640..320299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0590 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64653"
FT                   /db_xref="UniProtKB/TrEMBL:E8R827"
FT                   /protein_id="ADV64653.1"
FT                   /translation="MKGFIGVDEKLLAECRNRYQCIWVETALVKPVNSNIFYCVDCFFH
FT                   KYSATSAPEHRLLLSYSSRTSLHAVKPGVSGGLRVVEADGEVCSRSGIEAYFSSLSSTL
FT                   TQEMKQLSEEREKNPGKLSFRSMLLGLILPRQRDALQEEGWYWGRLTRYRIGHELMGML
FT                   GFENGVLNAEVDTAFILYRFDAKGRVAALIGGRAIDLPSYSKILDKGRLMADLALG"
FT   gene            320362..321462
FT                   /locus_tag="Desmu_0335"
FT   CDS_pept        320362..321462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0335"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="COGs: COG1363 Cellulase M and related protein;
FT                   InterPro IPR008007; KEGG: dka:DKAM_0589 aminopeptidase from
FT                   family M42; PFAM: peptidase M42 family protein; PRIAM:
FT                   Cellulase; SPTR: Aminopeptidase from family M42; PFAM: M42
FT                   glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64654"
FT                   /db_xref="GOA:E8R828"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E8R828"
FT                   /protein_id="ADV64654.1"
FT                   /translation="MSWRNEYLELVRKLTSLHGTSGREDSVRDLVVDLMKPHVDKLWVD
FT                   VWGNVVGYRKGSKGAGRIMLAAHMDEIGLFISHIEDDGFLRVIPVGGVLERTLLYQRVV
FT                   VKTRDGRLYRGVIGLKPPHVIKPEEAQKVPEIRELFIDVGASSREEVEKMGIRVGDIAV
FT                   FDRDVAELSGDRITGKAFDDRVGVAVMLKALESLGEHQVDVYFVATVQEEVGLKGARTS
FT                   SYGISPDVALAIDVTIASDVPGVAKSEWFTRLGYGPAIKVVDGRNASGLIAHPKVVDFL
FT                   VSVAEKRKIPYQLDVISGGTTDASIIALNKEGVAAGTISIPSRYIHSPVEVVDLKDLYN
FT                   ASLLAKAFLEEATPEWVQSVKGLIVK"
FT   gene            complement(321504..323600)
FT                   /locus_tag="Desmu_0336"
FT   CDS_pept        complement(321504..323600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0336"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro IPR006589:
FT                   IPR006047; KEGG: smr:Smar_0613 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; SPTR: Alpha amylase,
FT                   catalytic region; PFAM: Alpha amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64655"
FT                   /db_xref="GOA:E8R829"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8R829"
FT                   /protein_id="ADV64655.1"
FT                   /translation="MYRVLGRETIGRGRFGRYLVEYSVPWPSGARRVYLIGVFSGWFPG
FT                   HLRLRRVGDRGRIVLKLWPGEYHYGFSVNSGAPVPDPENPDIVESRPFYDWRVPFRLSR
FT                   SIVKASENPVDDVVHAEDEEAFLHRFLDTLVVRIRVPRGLDKPRLIVEGEGEYKPAVEY
FT                   VFRDAAVYEYHLQYIGSHVYKYRFLIRHQGVDLYYGDEGIAMDPSPIVVESERIPGISE
FT                   AEWYMGAVYYQVFPDSFDNGDPGNDPPVKVTRVAPREPGYYGGDIQGIIRRLNHIVGLG
FT                   VDALYLTPIFQAATYHRYDIYDFTSVDRYLGSMDDFKRLVDELHKRGVKLVLDVTLHHT
FT                   SPCFHAFVKALREGPGSPYWDWYLFKEEPPRGLLHEVLGYLEGECRSRELEKAMRSRGL
FT                   EPFYESFFNLWSMPKLNHENPEVLDYFMEVTRYWAEKGVDGFRIDVALGIPYTWLMLYY
FT                   KLVKDMRSDFLLLGELNDYPAYYTGYFDSVMDYYWRKIVFSKIIDEGLSMEDFIGELNR
FT                   EYSEIPHYKAISLYHSLGTHDTPRVMTYAGGDTGKVKLLFTLLFTLPGSPAIYYGDEVG
FT                   MEGGGDPDNRRPMTWDEAAWNMEVYMHVKKMISLYKAWASLRLGFYSATGIDDDVVLIK
FT                   RWIKGEEVYVLANLSRGEKTVEPGIPEGVYVDLVSGEEVYVGGGVKLTLGGYGFRLLGR
FT                   RCKG"
FT   gene            323753..324688
FT                   /locus_tag="Desmu_0337"
FT   CDS_pept        323753..324688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0337"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003593:
FT                   IPR016366: IPR011703; KEGG: dka:DKAM_0594 ATPase associated
FT                   with various cellular activities, AAA_3; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SMART:
FT                   AAA ATPase; SPTR: ATPase associated with various cellular
FT                   activities, AAA_3; PFAM: ATPase family associated with
FT                   various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64656"
FT                   /db_xref="GOA:E8R830"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E8R830"
FT                   /protein_id="ADV64656.1"
FT                   /translation="MGFYSAVRKILVDGELLIERERELRVIVAAMLAKGHVIMEGVPGV
FT                   AKTYTAKAVARLLDLEFKRVQMTPDLLPSDIVGYSIFDPKTGGFTVRRGPIFTNILLAD
FT                   EINRASPRTQSALLEAMQERQVTIEGETHRLPEPFMVIATMNPVEMEGVFPLPEAQLDR
FT                   FLVRVEAGYTSHEGLVKILKRAEEIERAIEGLKPVASRSELLEEISRAAEVRVDDSIYD
FT                   YAASIIEETRRHPAVRLGGSPRAGIALVRVAKSLAYMEGRGYVIPDDVKEACKPVLSHR
FT                   LILKPEYEVQGLSVSRVIEDVLSRVKVPAP"
FT   gene            324685..325758
FT                   /locus_tag="Desmu_0338"
FT   CDS_pept        324685..325758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0595 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64657"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E8R831"
FT                   /protein_id="ADV64657.1"
FT                   /translation="MRATMALLLAVLLAAALPVASAQDRHTAGFPSQLDAPLTMDELLR
FT                   ELYNMSLVELDPRSLNESTLLGLLDKLAGSGALNETYKGRLQQLLTAPSESLVANVSDP
FT                   ELRALLQGLLDKGSLSPDEVSSILKYIDALKAAGRLSPEDELIAYRVLSKLASTSTGAG
FT                   SELSSRVLSTLLNIAGLQRPLPEAPVNASIGVPLTGSSGLALPGPPSIQGIPGLPSSPV
FT                   IPQLPLLIGVVAAVFLTALTVTLKGSLVKDALSGAFSTMASTLRGHRFTGAEPGDCVSA
FT                   YWASVALVGWRYRAAKMLHETPREYLSRVKGALPPDVAGLLREVTVLYEECRFGHASVD
FT                   KESIGKYRELVRRLGEG"
FT   sig_peptide     324685..324750
FT                   /locus_tag="Desmu_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            325745..326884
FT                   /locus_tag="Desmu_0339"
FT   CDS_pept        325745..326884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0596 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64658"
FT                   /db_xref="GOA:E8R832"
FT                   /db_xref="UniProtKB/TrEMBL:E8R832"
FT                   /protein_id="ADV64658.1"
FT                   /translation="MEKGRVLLAVGVRLTALLLLYDAGVFTGSMVSAVYAGGLPVKGLG
FT                   AAASLLTLLLAGLVLATGSLKAYVAALSAITLLSIAVHSVPVASITGLPLILVLDTLSN
FT                   IYRGGEVSQLGLSRRDIARTLVAFTAVQAVMLTIALTLAFFSGAFVNGFEKALSSAAAS
FT                   KPLLTPILSSRILAVALTSILAVYFYGVFRAGAEATVVFLAPSRSYALSRLARDPGLDV
FT                   VFKVPLTWLLGLPMAFLVYPAFYTILHDVYLPYVAPWLSKATASSWYMGLLVDFLTGSL
FT                   AFAISAAAVGDFLNWSLLGGVDDPGKGSSLIIKPLLVLAFIYATSVVLSTGKGIPLQDS
FT                   LLNPAFPELAGLISSHYIDYSATVVSLMSDVSRLLGVVP"
FT   sig_peptide     325745..325843
FT                   /locus_tag="Desmu_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            326881..327150
FT                   /locus_tag="Desmu_0340"
FT   CDS_pept        326881..327150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0597 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64659"
FT                   /db_xref="GOA:E8R833"
FT                   /db_xref="UniProtKB/TrEMBL:E8R833"
FT                   /protein_id="ADV64659.1"
FT                   /translation="MSQRLHGFKARGIAFPLLLALGVAVLSASIVILILSLGYMGSAMV
FT                   GLSLLAALIGFSLLSASLYILRLAAYVYAAERKGEGEEKGLEKK"
FT   sig_peptide     326881..326964
FT                   /locus_tag="Desmu_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            327092..328630
FT                   /locus_tag="Desmu_0341"
FT   CDS_pept        327092..328630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0598 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64660"
FT                   /db_xref="GOA:E8R834"
FT                   /db_xref="UniProtKB/TrEMBL:E8R834"
FT                   /protein_id="ADV64660.1"
FT                   /translation="MSTQQKGKEKARRKGWRRSSLVAAFTAAALVFIGLVALVEKGPVA
FT                   PGLPQGASPLNPLSLGTMRLLKELEARYPVRVASSLQDLDGISGAKCIYIVVSPEKPFT
FT                   SSEAGYIIKALKERCGSASVLVADESTYSNPLLEALNTSIRITGGRIYVERHVNGSTAY
FT                   TPYPSARLSTGGDTYELILDKASNIVGRGVLRGYVAEPCLIALPGAGGFTCNGSTGLQL
FT                   GEMVEAGQVSPVVALEDSGSPIPVYVIGDGSIFLNQVVASGNGTEYKAYALNLVSHLCG
FT                   GSGCTVVFDNMHYGAVDPLSLLENPGRLASSGAGLADLAYMVTLILAVVLHPSFWMPMG
FT                   FKYVDEALAPLLLNPAAATAASLIAALAVYKHLSGREVFAPDEALREQVERDISVFEST
FT                   RGKIIRGKERLGKRDFLNVYWLADQVSSIVLGVKLSDPGFVERAAGFMGRDEAASYWDY
FT                   MNKLYRKAAGVSRRPLIVRWHRETSRAYGMTEKMITALSKSLQIEDYQRLLAGS"
FT   sig_peptide     327092..327244
FT                   /locus_tag="Desmu_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            328633..329949
FT                   /locus_tag="Desmu_0342"
FT   CDS_pept        328633..329949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0342"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: dka:DKAM_0599 protein of
FT                   unknown function DUF58; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64661"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E8R835"
FT                   /protein_id="ADV64661.1"
FT                   /translation="MPVSATPRLKLYVLFTSLLLAVAILVDPAALTLALILLALPILSH
FT                   TLIEVGYSVLEKLRVSESVRVEKDGRVVVEYMIENPSRIPLLPVEYSVAYSELLRLAEG
FT                   VKAGLLLVPPRGVVKLRLVFHGRLGEHTVGPVRAVLRDPFGFYRSSEETLGKAVTLNIP
FT                   PVPEEVVVRRLFRYARSTGLVKSKAPGDGVEFYDVRDYFPGDEMKRIVWRVYASRRTLA
FT                   VWEPEREVYQPVVFILDATREMWSGPFGQSMVEHSARITASLIHYLTRRGYPVSTVVFN
FT                   ESVTHASGRPIHGYRGYMESLRTISRARLSWEGTLQRRSAVSSVLSYTYERILPRDRSI
FT                   VFLFTHLDEDVLGDVASWNSIYSARGHVLYIVHPLITSYDTGNIPEWAANVYRVKLMEA
FT                   LRRDIDVLSRARSMGLRVVAVTPSLIPQRVVDIVERYSA"
FT   sig_peptide     328633..328728
FT                   /locus_tag="Desmu_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            330015..330332
FT                   /locus_tag="Desmu_0343"
FT   CDS_pept        330015..330332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0343"
FT                   /product="Rubrerythrin"
FT                   /note="InterPro IPR003251; KEGG: dka:DKAM_0600 Linocin_M18
FT                   bacteriocin protein; PFAM: Rubrerythrin; SPTR: Linocin_M18
FT                   bacteriocin protein; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64662"
FT                   /db_xref="GOA:E8R836"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E8R836"
FT                   /protein_id="ADV64662.1"
FT                   /translation="MMSKNPLILQPGRKLTREEIAEALRLSIIAELDAVNLYLQLARSI
FT                   DDENVRKVFEDVANEEKTHIGEFLALLEALDPEQSKRLGEGASEVKELTGQRHSYKGLK
FT                   E"
FT   gene            330329..330823
FT                   /locus_tag="Desmu_0344"
FT   CDS_pept        330329..330823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0601 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64663"
FT                   /db_xref="GOA:E8R837"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E8R837"
FT                   /protein_id="ADV64663.1"
FT                   /translation="MREASGLSREIDAGRLLEYSRIEEDYARRLSNLGESLKHPVLRAL
FT                   FKSIARDSEKHAMIYRALADLLTSPQPFITEDELERVKAEVSHHIETEKEMLRTVEEML
FT                   KTVEDPRVKLLLAAIRDDEAEHHALLVSIREKIASAETLTEQKLWDMIWKDSPWHGTPG
FT                   G"
FT   gene            complement(330836..332053)
FT                   /locus_tag="Desmu_0345"
FT   CDS_pept        complement(330836..332053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0345"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="COGs: COG0426 flavoprotein; InterPro IPR008254:
FT                   IPR016440; KEGG: dka:DKAM_0602 beta-lactamase domain
FT                   protein; PFAM: flavodoxin/nitric oxide synthase; SPTR:
FT                   Beta-lactamase domain protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64664"
FT                   /db_xref="GOA:E8R838"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E8R838"
FT                   /protein_id="ADV64664.1"
FT                   /translation="MSGDTAMPEVDVYRLTRSLHLLRLKDRETRFFEGLWEIPEGVTYN
FT                   SYVLTGSEGAVVFDTWKGKWSGVFLEALRGIVDPRDVKYLVVHHMEPDHSGALRQLVGE
FT                   ADPIVLGHPLTKGMIESFYGLTPRFKPVGDGERVTLGDVDLVFHHTPWLHWPETIMTYV
FT                   AGEGALLSCDAFGAFGVFNEVWADELGEAGWERYMWYMKKYFANVIGTYHEWVVKNIEK
FT                   LSSRGVAPSLILPSHGLLLRGSRLQHAIEKYLAWGRGLPEQGKTLLVYTSMYGFVERIV
FT                   EVVRDYFASKGRRLVVAGFTDGGRVDLSDVISEAYDAESIVFATATYEADVHPLMRHVA
FT                   SVIARKTPGGRKTAVIAIYGWGGRAGRVMEELLRNAGFNVVGVVEFKAGEEGRNRDKII
FT                   GLLESL"
FT   gene            complement(332104..332811)
FT                   /locus_tag="Desmu_0346"
FT   CDS_pept        complement(332104..332811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0346"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG0450 Peroxiredoxin; InterPro IPR017936:
FT                   IPR000866: IPR019479; KEGG: dka:DKAM_0603 peroxiredoxin;
FT                   PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Peroxiredoxin-like; SPTR:
FT                   Peroxiredoxin; PFAM: C-terminal domain of 1-Cys
FT                   peroxiredoxin; AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64665"
FT                   /db_xref="GOA:E8R839"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R839"
FT                   /protein_id="ADV64665.1"
FT                   /translation="MPGQIPLIGEPFPQMEVMTTHGKKKLPDDYKGKYLVLFSHPADFT
FT                   PVCTTEFVAFARRYEDFKKLNTELLGLSVDSTFSHIKWVEWIQEKLGVEIPFPIIADPN
FT                   GEVSRKLGFLHAQSATSTVRAVVIVDGNGIVRAILYYPQETGRNIDEILRLVKALQLND
FT                   KYKRAVPAGWPNNELVGDALIVPPASTIQEARERLKQFKCFDWWMCYEEGRVPPEEVRE
FT                   ARAWLERASKPSK"
FT   gene            333017..333229
FT                   /locus_tag="Desmu_0347"
FT   CDS_pept        333017..333229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0604 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64666"
FT                   /db_xref="UniProtKB/TrEMBL:E8R840"
FT                   /protein_id="ADV64666.1"
FT                   /translation="MKEALKCPRCGFTGRPEEFTFMQEATIYYTGRGLEHEERERPIMV
FT                   ICPRCGEGFYLESPVKRLLERLGAG"
FT   gene            333321..334940
FT                   /locus_tag="Desmu_0348"
FT   CDS_pept        333321..334940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0348"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1078 HD superfamily phosphohydrolase;
FT                   InterPro IPR003607: IPR006674; KEGG: dka:DKAM_0605 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Metal dependent
FT                   phosphohydrolase; PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64667"
FT                   /db_xref="GOA:E8R841"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E8R841"
FT                   /protein_id="ADV64667.1"
FT                   /translation="MASQSGEQGGEPALSLFMPFNAQVRDPIYGYIDYVKGFEDEVIDS
FT                   WVLQRLRYVYQLQAAHFIYPGATHTRFSHSLGVMYSSYRYMSFLMRSAVVSGIQGERRR
FT                   SVLEYQRELIYASRLLGLLHDIGHGPFSHAFDRYVYKNKDFLGYRVGNHEVVGYLLYRS
FT                   TVRDIIEKTLLRERERLQVDPEVLISLLDEGMKPPRGMRDFTDLQGKGVLGNSDFYDPS
FT                   VPHGLENIVRLVVRDYVYTSDIMDYLRRDSYYTGVPVGQINDDWIMRNSYIVDKGGILT
FT                   PAISSKALDEVARLFDARKIMYKHVYLHPVNQAFIETIGMLLPCIRGEIVEAVARVIEE
FT                   GDAVAYLALTDHYVYSAFKKLLVNGLDNADCVDKAVARSALESLFIKRKPVWKMVKRII
FT                   ADLRTAGHLYGRFGETLQKKIEEGVSSEVSTALPGRDIGHGDLKIMFDKIDIYPSAGAE
FT                   VLNTLEVVELKDGRVIESSSKSLEEFAKESGLIPEALITVYINRLKYQVLTSEELRKIS
FT                   EIATRIVEDAIKGTRRESPETS"
FT   sig_peptide     333321..333392
FT                   /locus_tag="Desmu_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            334980..335735
FT                   /locus_tag="Desmu_0349"
FT   CDS_pept        334980..335735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0349"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: dka:DKAM_0606
FT                   dolichol-phosphate mannosyltransferase; PFAM: glycosyl
FT                   transferase family 2; PRIAM: Dolichyl-phosphate
FT                   beta-D-mannosyltransferase; SPTR: Dolichol-phosphate
FT                   mannosyltransferase; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64668"
FT                   /db_xref="GOA:E8R842"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:E8R842"
FT                   /protein_id="ADV64668.1"
FT                   /translation="MPVKASIVVPTYNERENIRILIPMIHRALRDTGVDYEIIVVDDNS
FT                   PDGTAEEAVHLSSAYPVKVVKRSGKLGLSSAIYEGVRHATGDIVVVMDADLQHPPEYIP
FT                   ALLRRIDGCDLVVASRYAPGGRVEGFPLVRRIVSKGSILLAHLVVPGTRRARDAVSGFF
FT                   AAKREVVARWRMVEPRGYKVLVEILGELHDIRVCEEPIVFRSREKGSSKLTVRVMLSYI
FT                   RTLFKLNPVSFTLYVLLILLLIAALVLLA"
FT   gene            335808..338996
FT                   /locus_tag="Desmu_0350"
FT   CDS_pept        335808..338996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0350"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COGs: COG0060 Isoleucyl-tRNA synthetase;
FT                   InterProIPR015905: IPR001412: IPR002301: IPR002300: IPR
FT                   013155; KEGG: dka:DKAM_0607 isoleucyl-tRNA synthetase;
FT                   PFAM: aminoacyl-tRNA synthetase class Ia; tRNA synthetase
FT                   valyl/leucyl anticodon-binding; SPTR: Isoleucyl-tRNA
FT                   synthetase; TIGRFAM: isoleucyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (I, L, M and V); Anticodon-binding
FT                   domain; TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64669"
FT                   /db_xref="GOA:E8R843"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:E8R843"
FT                   /protein_id="ADV64669.1"
FT                   /translation="MSRVTEKEWALQGVYRPHDVEKKVLDYWDAVGVYSLVKKADESKQ
FT                   LRFNFIDGPPYPSGDIPHIGTAWNKALKDAVLRYKRMKGYRVYDRPGYDCHGLPIEVKV
FT                   EQKLGVSVKKEIEERIGVERFIEECRRLALTNANAITRWFKELGVFMDWDNPYLTLRDE
FT                   YIEAEWWLIKKAHEAGLLEEEYRVVHWCPRCSTTLAEYELEYRELEDPSIYVKLQVEGK
FT                   PGEYLVIWTTTPWTLPANTFVMVHPDEDYVKVEVGGEKWILAKQRLEAVMKELGVEDYK
FT                   VVEEFKGRSLIGVRYIHPLADVIPLQRELSKYHAVYPAPEFVTMYEGTGLVHSAPGHGF
FT                   EDFIVAKRNGIDAAASPVDDEGRFTSEAGKYTGLRVREANQLIIEDLRARNALLKASTI
FT                   MHKYPVCWRCKTPVVMRATRQWVIKVSRLRERLREEADRVKWIPEWARERIGFMIDNIQ
FT                   DWLISRQRYWGTPLPIWECPNGHRLVVGSIRELESYGGVRPRELHRPWIDSVVLKCPHC
FT                   GLEMRRVPDVADVWLDSGVAFYAAKGHPDELSPEDVILDFIVEGHDQTRGWFFSLLRAG
FT                   VLGFNRSPYRTVLVHGFMLDEKGREMHKSLGNYVGTDEAISRVGRDPLRLWLLGNTTWE
FT                   DARFSWKSLEEAVRDLSVLWSIAVFAYTYMRLDKYDPAGHTIRDVSGHLRVEDKWILSR
FT                   VNTLIKQVSELMESYQVYEAVRLLREFFVEDLSHWYIRLIRPRVWVEENTGDKLAAYTV
FT                   LYYVIDRVARLIAPFTPFIAEYMYQALMKPVYGEPSIHLLPYPEPDEGFINGKLEEEMR
FT                   LIRQVYEASASARMKQGIKLRQPVRRLIVYTNREDVAAAVSRNLELVKAITNSREVSVE
FT                   PLRLLGEIVRYRVEPVYRSIGPRYKSLAKRVISYIEENQEKVAADILGKGVHEAILDGS
FT                   KIVLERGDVSITPYYIEGFSVEDREWGSVAIDTRLSEEEVAEGLARDVVRRIQVMRKML
FT                   NLELDAKIRTIVMAPPDKARLLESKKSYIMNETRSVELRITPGYGDKGFLKGFTQTWEI
FT                   NDEEYIIGVEKVED"
FT   gene            338986..339405
FT                   /locus_tag="Desmu_0351"
FT   CDS_pept        338986..339405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0351"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="COGs: COG0295 Cytidine deaminase; InterPro
FT                   IPR016192: IPR006262: IPR002125; KEGG: dka:DKAM_0608
FT                   cytidine deaminase; PFAM: CMP/dCMP deaminase zinc-binding;
FT                   SPTR: Cytidine deaminase; TIGRFAM: cytidine deaminase;
FT                   PFAM: Cytidine and deoxycytidylate deaminase zinc-binding
FT                   region; TIGRFAM: cytidine deaminase, homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64670"
FT                   /db_xref="GOA:E8R844"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E8R844"
FT                   /protein_id="ADV64670.1"
FT                   /translation="MRIDVDALIKEASRVLGNSYAPYSNIHVAAAVLTSSGRVYLGVNV
FT                   ENASYGLTICAERSAISAMVAAGERDPVAVAIVTDLEDPIPPCGACRQVIAEFNPRALI
FT                   VMHSTRSGRTVVRNLEELFPQPFTISDEAGRRDPS"
FT   gene            complement(339402..341882)
FT                   /locus_tag="Desmu_0352"
FT   CDS_pept        complement(339402..341882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0352"
FT                   /product="SMC domain protein"
FT                   /note="COGs: COG0419 ATPase involved in DNA repair;
FT                   InterPro IPR013134: IPR003593: IPR003395; KEGG:
FT                   dka:DKAM_0610 DNA double-strand break repair rad50 ATPase;
FT                   PFAM: SMC domain protein; SMART: AAA ATPase; SPTR: DNA
FT                   double-strand break repair rad50 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64671"
FT                   /db_xref="GOA:E8R845"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:E8R845"
FT                   /protein_id="ADV64671.1"
FT                   /translation="MRIYGLMLENIRSFRKEYVVFPNKGVTVIHGATGSGKTSILMSVS
FT                   AALFGLQRESRDPFRAFAYPTGRDLVRADASSARIRLLFEHNGKLYLVEREFRRDGERV
FT                   VNAEYNRLEEYVVDSSGRVVNTNQWILSPTELNKRVKEILGIKEKAREQPLLFTSVLYA
FT                   PQFNIHEVLSLSDEDRTEIIERSLGLSKYKEYKKNSEEVENIIRSRVDELARNMERLKT
FT                   RLRERSKESLLEEKKRLTAEVEGYEKARTEKLRRLEEVEASIEREQRLLMEAEREVAEL
FT                   KSRIEQARRLEARLREIEGEIAGVAAGIGGVEADPASILGELTRRIDEASGRLRELHEK
FT                   EALIEEEIEGFEQRLEEARRAYSELKAKIGGLESDKRNILARRRELEDQLKRYKELLER
FT                   GICPLCLQPIPHEHGVKLIDEVSKGIRDLEEKARETEEKRTGIAAEISRVEEEIRRLEG
FT                   EVRGRKAERDRVRGEYKKLEEEVRRLQLTAEKIRSMLREAERVRAELSGAAGLEDKLKE
FT                   ALSKRSSIEAALRELREAEKGLQAEIRELDSRIARSKASIEYVEKMIHEIERDEEELRR
FT                   LEEEKMFHEWMLALLASLNEVVDEVEKRVSLEVVQEFRRRFYAILGTLMREQPVEVVVR
FT                   DDFTLESKVKIGGKAYAISSLSGGQSIAISLAYRLALNATVRAYSPFLRNTVLILDEPT
FT                   TGFSQELVRRLGEALRLMSSARGQGQEGGQIIVVTHDELLKDIGDCRIMLERDALNHVS
FT                   RVKGYECVDFKNFDDYKKLVEEILSGRFSRRTTGPVEGGGFKPVVSLEAGGSARKKSIL
FT                   EFSRGQGGKQSGVG"
FT   gene            complement(341887..343860)
FT                   /locus_tag="Desmu_0353"
FT   CDS_pept        complement(341887..343860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0353"
FT                   /product="DNA double-strand break repair protein mre11"
FT                   /note="KEGG: dka:DKAM_0611 DNA double-strand break repair
FT                   protein mre11; SPTR: DNA double-strand break repair protein
FT                   mre11; PFAM: Domain of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64672"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R846"
FT                   /protein_id="ADV64672.1"
FT                   /translation="MAKQVGVTHGWSGDGVRIAVSSPGYLPGLGDLLYVREQDRTLILQ
FT                   VVGFEGGIPAPPASIRVSKPDVLSDVSKEIVAIASLFLEVSSTGGEKRLEKPVRPPALM
FT                   QPVYLMDPGDPEARGILVEISGLTSGRGTGTVPLAYLRTGSYTGSGVKYVREAGLRVEP
FT                   GSILSKHVLIVGQTGSGKTSGLKGIMVRYARESSEKTGWLVIDRHGEYAEDCSQERFTW
FT                   RLYEAFSGNKYLSDTLIKAVRLTGGSGVNDICIQGNLRIYEASLSASSIGLRDFLALLE
FT                   NRVKPELVSEIEEFAEIILQALLNIREEDEKHRSIVGEFLTGDSGDEAEANGNVIALIP
FT                   LIYSNMIVYEGIGAERKDRTGFLKVLVDRGIYTTHVRTMRRYIRAIMGWRTPRRRLQNS
FT                   ASVYVSVIDDSKSVVKVSPLLKDPNTLSWLLNELAKQLNKMEKAGLGEYPWRKVETGSQ
FT                   QIEFRSIEAGSIDEIVGDVDAGNVVILDVSRLSNEQADLVVLTVVRRLFEQRMTMGVEE
FT                   AKGRPAVTIVSEEAPLYLSPDKVNSPFNPFARIAREGRKFRVGLIAVTQLASMIEKQIL
FT                   GNFNTVIALRTKSRSDIELLKDIGVPSETLPFLGDREGYIYSPDLPVKEPLPVYIPGWY
FT                   EEDTRGEGDRIPDARVLLDQGV"
FT   gene            complement(343866..345170)
FT                   /locus_tag="Desmu_0354"
FT   CDS_pept        complement(343866..345170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0354"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002355; KEGG: dka:DKAM_0612 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64673"
FT                   /db_xref="UniProtKB/TrEMBL:E8R847"
FT                   /protein_id="ADV64673.1"
FT                   /translation="MVDEVIRFIEKYARLMHEDYLKSHESIVVKKRSELYSRLFKVAPI
FT                   PSVKQEKPVVFVDGGRLDLETDVSALTVVNLGALVRRVDGELVTLNEYLGDPGVEAIET
FT                   LVVYSTIQWDGLSHVYRVLIEPVAAGSLLFENRDPVSVSRDISDAVNNEVKASHIQVRK
FT                   APRVLKRVHSYIVELAEVAYLARILSHMPEGIGVVDGSLLRWFTRGELARGGYRILSAV
FT                   SGLNDPGLRETLTSIIGVSKTSKFTNVARAYNLFTGYAGSVDSPRGLYGYVDSESAERA
FT                   RGILDEIARLGVDLAREAAGVFNRKVFREGNIWVFRIPVTGDMEWVLHADYYVEGPVAT
FT                   VEGDGKVYVNEDLAGRLSERIHRTIREVFAKRSSLQGHPPYGLMEVDVNVRIDKAKSEN
FT                   LRQLLLAGLKEATGRGNHPLIQALETTLRMRYGYG"
FT   gene            complement(345160..346440)
FT                   /locus_tag="Desmu_0355"
FT   CDS_pept        complement(345160..346440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0355"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG0420 DNA repair exonuclease; InterPro
FT                   IPR004843; KEGG: dka:DKAM_0613 DNA double-strand break
FT                   repair protein mre11; PFAM: metallophosphoesterase; SPTR:
FT                   DNA double-strand break repair protein mre11; PFAM:
FT                   Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64674"
FT                   /db_xref="GOA:E8R848"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:E8R848"
FT                   /protein_id="ADV64674.1"
FT                   /translation="MVFIHTGDLHLGCNLSEESALSKLYMDVLDEILENALEHRAPLLI
FT                   SGDFFDHYAVSYTLMIEVARRLRRLREAGVEVVAVQGNHDNARGGRGVLDLYSETGLIK
FT                   LTRYEEREGYLVLHPLKAGGYVFYGVPGFRNQAESRYIKERRVRFTGVGEAGGAPIIVL
FT                   AHVSVEFAGFKPSAYSEIYGDMDVLENELWSILPGGTRYVALGHVHIPIPFERKFKSNT
FT                   AYPGAPIGMGINDLRDTARLSGKGVGRRILLVDVEGDIPSVEALELESAPRVFYEKTGF
FT                   NSIEELKKYLEQAVKTHGDHHAFIIDVEELKTGEAGGLTPFIQELQQKHGKLVYIRLPG
FT                   ETGFEDFFTGVQPPPQATGLTLEDIEDMVLREQAGRLGLPVEKIREILRLLYEERGEKG
FT                   RRYYQDLYEELKRALRESYSRGRNSGG"
FT   gene            complement(346505..347773)
FT                   /locus_tag="Desmu_0356"
FT   CDS_pept        complement(346505..347773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0356"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="COGs: COG0498 Threonine synthase; InterPro
FT                   IPR000634: IPR004450: IPR001926; KEGG: dka:DKAM_0614
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; SPTR: Threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme; TIGRFAM: threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64675"
FT                   /db_xref="GOA:E8R849"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8R849"
FT                   /protein_id="ADV64675.1"
FT                   /translation="MHVKELRCSRCGRRFLLDEKPLTCPSGDLGRLDIVYDYDAISRSI
FT                   SRDALSSRPFNMWRYMEFLPVPSSDYVVSLGEGGTPLLKAKRLGERLGLRNLYLKDETR
FT                   NPTGSFKDRAMSVSVSMAVYFGFKRAVIASSGNAAASLAAYGARAGIEVYAFVPDFAGY
FT                   GKIAQLLYYGAKVFKVRWVESEDPTVKMMRILYEKHGFYPSPSFGVFNPYQVEGPKTIS
FT                   MEVSEQLGWTVPSQVFVPTGAASLLTGVFNGFRDLNMVGWVDGYPRLVAVQPEGNHPFV
FT                   RAWMERADPLRIKPWEKPPETIATGLEDTYPWDGDAGLRALYKTDGYGVVVSDRDIVEA
FT                   MRMLAGLEGVFAEPSGAAGLAGLVKAVENGEVDRDEVVVVLVTGHGLKDPDIVRKTAPE
FT                   PPLINPDVEEFKKAAREAYGVSL"
FT   gene            complement(347856..348779)
FT                   /locus_tag="Desmu_0357"
FT   CDS_pept        complement(347856..348779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0357"
FT                   /product="cytidine kinase; inosine-guanosine kinase;
FT                   6-phosphofructokinase"
FT                   /EC_number="2.7.1.73"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.1.11"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139: IPR002173: IPR011611; KEGG:
FT                   dka:DKAM_0615 ATP-dependent 6-phosphofructokinase; PFAM:
FT                   PfkB domain protein; SPTR: ATP-dependent
FT                   6-phosphofructokinase; PFAM: pfkB family carbohydrate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64676"
FT                   /db_xref="GOA:E8R850"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8R850"
FT                   /protein_id="ADV64676.1"
FT                   /translation="MGRDIDVVTVGHALVDIRIVVNEFPSVDLESKVLNQSWGAGGSAV
FT                   NVAIGVSRLGMKSSIIARVGFDSFGRIIVDDLLREGVDISGLRIGFTQTGFTIVAINNK
FT                   GEIMMYGYKGAAEELQPEDISEYAISRAKWMHIASLRLDTTMKAIEVARKHGLTISWDP
FT                   GRVLASQGLEKLRDVVSAVDYVMLNEKEAKLMTGVEDYREAAKTIAGDTSASILLKRGS
FT                   KGVYVLSKEYTGDIPAYSVENVIDTTGAGDAFASGFITGILRGYSLRKAVQYGNAVAAL
FT                   KIGKLGSHQVPSHDEVVEFIWDREQG"
FT   gene            complement(348793..349611)
FT                   /locus_tag="Desmu_0358"
FT   CDS_pept        complement(348793..349611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0358"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG1830 DhnA-type fructose-1 6-bisphosphate
FT                   aldolase; InterPro IPR002915; KEGG: dka:DKAM_0616
FT                   fructose-bisphosphate aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Fructose-bisphosphate aldolase; SPTR:
FT                   Fructose-bisphosphate aldolase; PFAM: DeoC/LacD family
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64677"
FT                   /db_xref="GOA:E8R851"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:E8R851"
FT                   /protein_id="ADV64677.1"
FT                   /translation="MSYSIAGKHLRLKRILPTGRGVVFAFDHGVEHGPGDFPREYLDPR
FT                   VIIGKVVEAGVDAVMMLPGAAFITRDLWAGRASLIVKVTSKTNLRPEDGRLLQSVFGHV
FT                   EDAVALGAEAVAATVYWGSQYEDAMLRQWFEVKRQAERYGYPCLQLSYPRGPAIKNMYD
FT                   VEVVKYGVRAAIESGADLIKTYYTGSLESFREVVEAAAGIPVLMSGGAVRERFIDFLRD
FT                   VENVVKAGGRGVVVGRNVFRHRNPAGAMKAVMKVVHEDASPEEAVKYAEQ"
FT   sig_peptide     complement(349537..349611)
FT                   /locus_tag="Desmu_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(349695..350189)
FT                   /locus_tag="Desmu_0359"
FT   CDS_pept        complement(349695..350189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0359"
FT                   /product="small multi-drug export protein"
FT                   /note="COGs: COG2426 membrane protein; InterPro IPR018130:
FT                   IPR009577; KEGG: dka:DKAM_0617 small multidrug export
FT                   protein; PFAM: small multi-drug export protein; SPTR: Small
FT                   multidrug export protein; PFAM: Putative small multi-drug
FT                   export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64678"
FT                   /db_xref="GOA:E8R852"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:E8R852"
FT                   /protein_id="ADV64678.1"
FT                   /translation="MDSWTLLWAMILAFAPISEVRGAIPYLLIATSGDAVGAVYGLLLS
FT                   VAANMAVPFAAFPILDVLDALAAKPWMPSVVKRLYGFLRGLGERKALGVRRGSYIALMV
FT                   FVAVPLPATGAWTGSLVAYVLGLDRRKSILAIDAGVAAASLIVFAAAYLGIGLLKTLFM
FT                   L"
FT   sig_peptide     complement(350124..350189)
FT                   /locus_tag="Desmu_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            350377..351762
FT                   /locus_tag="Desmu_0360"
FT   CDS_pept        350377..351762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0360"
FT                   /product="nucleoside-binding protein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR003760; KEGG: dka:DKAM_0618 ABC transporter periplasmic
FT                   binding protein; PFAM: basic membrane lipoprotein; SPTR:
FT                   ABC transporter periplasmic binding protein; PFAM: Basic
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64679"
FT                   /db_xref="GOA:E8R853"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:E8R853"
FT                   /protein_id="ADV64679.1"
FT                   /translation="MKTGILVAILVVLVIVSGAVGFLAGQSMAPAAVQKAYTPPETVKA
FT                   AWIYVGPIGDAGWTYMHDIGRKYVEKLYGEWLQTTYVESVSEDQLLGTIDRLVSQGYNV
FT                   IFTTSFEFMDKTIEAGKKYPNVMFFHCSGYKRAPNVGTYFADLYQVYYLNGLMAGALTK
FT                   TGQIGYVAAYLIPEVVRHINAFAIGAKEVGDALGKNITVHVIEIGAWYDPTKAGQAADT
FT                   LKTQYKVDVLAFTEDSTKIVEYGEANGVYVFSHYGPMLRYGPNYVVSGQIVRWEIIYAD
FT                   ILAKIKAGIYRPDNLDKVDYWYLLSSGAVDLGADIADDGSIVMINPKYIDTLKSIQVTD
FT                   KLTGEKLSVYDLVMRRYWQMKAAFTVVPLEETAATHKYENISSISMEWGGKIGTKPYPI
FT                   APVFDPFRGPFTAYCLNPPDKAVSTYCAGKPQGTQVSFPAGYMAGHDDLWNMDYFVTWV
FT                   VKH"
FT   sig_peptide     350377..350469
FT                   /locus_tag="Desmu_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            351863..352792
FT                   /locus_tag="Desmu_0361"
FT   CDS_pept        351863..352792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0361"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro IPR003439: IPR003593;
FT                   KEGG: dka:DKAM_0619 ribose ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: Ribose ABC transporter, ATP-binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64680"
FT                   /db_xref="GOA:E8R854"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R854"
FT                   /protein_id="ADV64680.1"
FT                   /translation="MGSEKPLVSVRNISKSFPGGIVALDKVSFDVYRGEIVALLGENGA
FT                   GKSTIVKILYGIYFPDEGEVYVDSRKAVFYNPLDAIRSGIVMVSQIPQLIDRLTVRENL
FT                   AIGLRLLGLSGLSSTSRIDEKARKVSEEIGMRIDLNAKTWRLTYTQKQMVEILRAFLLN
FT                   AKLVMLDEALTYLPLEERRRFYVILEAFKKNGGSSLVITHKITEALEIADRIIVLRRGR
FT                   LSGVLSREEASIEKVRELMFGEEAGKITYERLPSSPPLDQQCITVEDLVVVDEYGRRVV
FT                   DGARISVRKGEVVGIAGVAGRRSSSKPL"
FT   gene            352864..353367
FT                   /locus_tag="Desmu_0362"
FT   CDS_pept        352864..353367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0362"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /note="COGs: COG3845 ABC-type uncharacterized transport
FT                   systems ATPase components; InterPro IPR017871; KEGG:
FT                   dka:DKAM_0619 ribose ABC transporter, ATP-binding protein;
FT                   SPTR: Ribose ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64681"
FT                   /db_xref="GOA:E8R855"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R855"
FT                   /protein_id="ADV64681.1"
FT                   /translation="MRRLGVGYIPDIPLRHGVSSDNTILENMAALFQRDKMLIEWEKAR
FT                   ELTVEIMKRYQVLARNEETPVKVLSGGNIMKVIVGRELEYSRSALVAYNPTRALDEVTA
FT                   VTVRRVIKAKAINEKIGVLFASEDLDEVFQLSDTIYVMNSGRVYGPFNAETARREEIEH
FT                   LMVM"
FT   gene            353370..354491
FT                   /locus_tag="Desmu_0363"
FT   CDS_pept        353370..354491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0363"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="COGs: COG4603 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR001851; KEGG:
FT                   dka:DKAM_0620 ribose ABC transporter, permease protein;
FT                   PFAM: inner-membrane translocator; SPTR: Ribose ABC
FT                   transporter, permease protein; PFAM: Branched-chain amino
FT                   acid transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64682"
FT                   /db_xref="GOA:E8R856"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8R856"
FT                   /protein_id="ADV64682.1"
FT                   /translation="MRLLVMRRKEPLRYGTILIILLSLAVGVLLYTLILSLQGRSPVEV
FT                   LYTITASFASPSVVKDFIILTMLGYALLVSFKGSLWNIGAEGQLFISTIPVIVLTLYVA
FT                   PNPSTPLETIAVILASIVIATATGALWASAAGFIRAYLEVDEVPVTLILNYVAYYTVNI
FT                   LVIGPLKGTRVYGYNRTDEIPAAYRLYITGLQRTPAGNPVADTVMGFVYEALYYLPWLI
FT                   AMVLIMVFTWFLLNKTQIGLRVRILGSNPDYLKSIGVNTRLTLVTALALSGAIVGFTSA
FT                   FYTLSDLLRLSYPVEGQTAGYGYLAILVAWLSMLDYKLIPVSAYIIASLRTAGINLQVG
FT                   GLGGLEQMLLLIGLILAVYTILRFLKDYEVRVG"
FT   sig_peptide     353370..353531
FT                   /locus_tag="Desmu_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            354492..355427
FT                   /locus_tag="Desmu_0364"
FT   CDS_pept        354492..355427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0364"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1079 ABC-type transport system permease
FT                   component; InterPro IPR001851; KEGG: dka:DKAM_0621 ribose
FT                   ABC transporter, permease protein; PFAM: inner-membrane
FT                   translocator; SPTR: Ribose ABC transporter, permease
FT                   protein; PFAM: Branched-chain amino acid transport system /
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64683"
FT                   /db_xref="GOA:E8R857"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8R857"
FT                   /protein_id="ADV64683.1"
FT                   /translation="MLDALVDAAPLIAAFSTMYLAALGHSVMEKSGILNLAIDGAFFFS
FT                   TGVSIYLAVALYGLLTPLGLTYPATTVLAVLLTGLFTAVIGVFMAWVLTSLPISHGALG
FT                   LSLQFLGYGLGIMAGYPVRQSVGSIEPYSLPRDPVVYGALLASSIITGVAVHFLMEKTP
FT                   LGASIKACGENPHAASALGVNVLKTRLIAGALGFYILGVGASLYPLAWQRYWDIKSYTL
FT                   GYGWFAFTIALAGGRNPIYLIPLSLVFGGLLEFNIRIMTMLKISADVAKLIPFLATLGV
FT                   MAVYGATELRRIFAPPTSLGKPYYKEEKTV"
FT   gene            complement(355481..357118)
FT                   /locus_tag="Desmu_0365"
FT   CDS_pept        complement(355481..357118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0365"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COGs: COG1384 Lysyl-tRNA synthetase (class I);
FT                   InterPro IPR002904: IPR020754; KEGG: dka:DKAM_0622
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase, class
FT                   Ic; PRIAM: Lysine--tRNA ligase; SPTR: Lysyl-tRNA
FT                   synthetase; TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetases class I (K); TIGRFAM: lysyl-tRNA synthetase,
FT                   archaeal and spirochete"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64684"
FT                   /db_xref="GOA:E8R858"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:E8R858"
FT                   /protein_id="ADV64684.1"
FT                   /translation="MVKHWIDELADSLYDALTKRGKEVYVFNGGLSVSGLQHVGRLRGE
FT                   IIIAETLRRLLSERGLRVKQYLTLYTQDAWKGKDSQLKQFQNPAEASRYKGNPLIRVPD
FT                   PKGCHGNWVEHYWSDFGPFIGEFTDGAIEVVTTTDMYKGRMRDFVKLTLGKREEVRRVV
FT                   NKYRGRKPYPEDWIPVEPVCERCGRIDTTEALRLVDEDHVEYVCEHCGYRGVADISDGK
FT                   LMWRIEWVGVWWTLGVDFEPYGKDHAMPGGSRDSCVDLAVNVYGLKPPEGLPYEWVEWR
FT                   RPDGQVADMGSSDFIGFTPRDWLEVAHPHIYRFIVLKTPPMKKYSVGLHEVPQYYSQYY
FT                   RAERIYYGLEKPKDEEEEVLLKRSYELSYPKGKPPREPPEQVPYSHLAVLAQIIPRDKW
FT                   GTEGLKRLRSVGLLPEEPTEYGVQRVLETIPRAYTWAVKYGGEAGVFTLNTLEEAEKRA
FT                   REVPVEYRALLGKLYENLTAIGEWSEDSVKNAMTSVTGGMRRDMIGEFYRYFYMVYVGK
FT                   PSGPRAAPLLALMGREQALRYLEFFRNA"
FT   gene            357443..359068
FT                   /locus_tag="Desmu_0366"
FT   CDS_pept        357443..359068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0366"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro IPR000631:
FT                   IPR004443: IPR017953; KEGG: dka:DKAM_0484 carbohydrate
FT                   kinase, YjeF related protein; PFAM: YjeF-family
FT                   domain-containing protein; protein of unknown function
FT                   UPF0031; SPTR: Carbohydrate kinase, YjeF related protein;
FT                   TIGRFAM: carbohydrate kinase, YjeF related protein; PFAM:
FT                   YjeF-related protein N-terminus; Carbohydrate kinase;
FT                   TIGRFAM: yjeF N-terminal region; yjeF C-terminal region,
FT                   hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64685"
FT                   /db_xref="GOA:E8R859"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E8R859"
FT                   /protein_id="ADV64685.1"
FT                   /translation="MVEVFTHTSPSRRLIPVKVCSVSEIRRLDEAASKTGVGSIPLMEE
FT                   AASAVYTVILREYGVEGRRFTVVAGTGNNGGDALAVARRLHSAGGIVEAFVIGDPGRMS
FT                   DAAGFNHRVLSAMGVPVATVSSEEGLTALEKSLRWADIVVSGLIGVGLRGEVSGLHRRV
FT                   IELVNSSGKPVVSIDIPSGVDGDTGLVKGVAVKSSVTVALGLLKYGNLLYPGYDYAGKL
FT                   YVSTLSYPRSLIDSVTGEVNTPIPIPERPRWGHKGVFGKLLAVAGSRYYYGAPYYVASS
FT                   FLKTGGGYARLAAPKGVIPFIASRAPQVVYVPLEETAEGSIAYGNLEKILSLIEEHGID
FT                   IVVLGPGTSLNRETQELLRSLVEALDKPVIIDGDGLTAVSENPGLLRKRKAPTILTPHP
FT                   AEFARLTGKPLAEVQGNPVEHVRKACVELGSYIVYKTAHSLICYPNGYIYVNMTGNPGM
FT                   AKAGSGDVLAGVIAGLYGVGLRDPGAALRMGVLVHGLAGDLAAEEIGEDGVTPDTLMEH
FT                   LPKAVRILRENPGYVREKYLPKEV"
FT   gene            359217..359612
FT                   /locus_tag="Desmu_0367"
FT   CDS_pept        359217..359612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0367"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="COGs: COG0864 transcriptional regulator protein
FT                   containing the CopG/Arc/MetJ DNA-binding domain and a
FT                   metal-binding domain; InterPro IPR014864; KEGG:
FT                   dka:DKAM_0653 putative transcriptional regulator, CopG
FT                   family; PFAM: NikR nickel binding; SPTR: Putative
FT                   transcriptional regulator, CopG family; PFAM: NikR C
FT                   terminal nickel binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64686"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:E8R860"
FT                   /protein_id="ADV64686.1"
FT                   /translation="MKGRKIGVYIPGDIEDLLEDYLARHGGRSVSSVIQEALRSYLLGE
FT                   KIPECELVGYIMVLYQHGVGDVDRELTEVQHKYIGVALFENHIHVDEERCLLTIAVRGR
FT                   YSEIQKLIDEVRGLKGVLLVKHLCVCV"
FT   gene            complement(359797..360177)
FT                   /locus_tag="Desmu_0368"
FT   CDS_pept        complement(359797..360177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0368"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR001367: IPR000835; KEGG: dka:DKAM_0654
FT                   iron dependent repressor; PFAM: iron dependent repressor;
FT                   SMART: iron dependent repressor; regulatory protein MarR;
FT                   SPTR: Iron dependent repressor; PFAM: Iron dependent
FT                   repressor, metal binding and dimerisation domain; Iron
FT                   dependent repressor, N-terminal DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64687"
FT                   /db_xref="GOA:E8R861"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E8R861"
FT                   /protein_id="ADV64687.1"
FT                   /translation="MDSQRVEEYLEVIYVLSSQGRPRVREIARRLCVKPSSVVEFLRKL
FT                   SSEGYIIYEKGGRIELTEKGLAVARDVHQRHRLLAEFLESIGVPREIAEEDACRMEHVL
FT                   HPETVAKIREFLESIHAARHQG"
FT   gene            complement(360201..360941)
FT                   /locus_tag="Desmu_0369"
FT   CDS_pept        complement(360201..360941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0369"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109; KEGG: dka:DKAM_0655
FT                   glutaredoxin-like protein; PFAM: glutaredoxin; SPTR:
FT                   Glutaredoxin-like protein; PFAM: Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64688"
FT                   /db_xref="GOA:E8R862"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8R862"
FT                   /protein_id="ADV64688.1"
FT                   /translation="MTGLFDPETEEELRKIFQSITRELNDVLVVSRDEESHVHGEDEDE
FT                   HHHHHHHHGGCPTCGEAKMLAEEIVRISGGRVRFTVLDAKDAEALKPRYLPAFIYDTPK
FT                   RNVRYYGLPSGQEFAPFIFIHDYISNGVKLSKSVVEELESIDAPLHVKIFVTPECPYCP
FT                   LVVDFFNQAGLVNQGIVVETIEAFEHPVEADAYGVQYVPYVAITRLSDYDKYGAKPIEV
FT                   IPGYLPPEENVKILRKAAGKLKRM"
FT   gene            361060..361824
FT                   /locus_tag="Desmu_0370"
FT   CDS_pept        361060..361824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0656 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R863"
FT                   /protein_id="ADV64689.1"
FT                   /translation="MQARSYTLKALELLNSAPSLSVRDVAEALGVDVARAKEILERLRY
FT                   GGYVEKAGHGYAITEKGRALLADHAEQGSPTLTSFIQGKQGSTEAGGGKTGTDTPRQTP
FT                   PQPVGEAPDALAKRVEELSNRLRELESRLRDIESRLASLEGFVRDAARRSGAEARGGEG
FT                   LGMETPVMSIAEAQSRLGTLLEKYLVEGRLIRVGSLVVDSAFYGEFKKRFPIKAGDVGR
FT                   LSPAERMLLEEMRREMMVILYAGREYRLVDTG"
FT   sig_peptide     361060..361143
FT                   /locus_tag="Desmu_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(361887..362393)
FT                   /locus_tag="Desmu_0371"
FT   CDS_pept        complement(361887..362393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0674 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64690"
FT                   /db_xref="UniProtKB/TrEMBL:E8R864"
FT                   /protein_id="ADV64690.1"
FT                   /translation="MELEAGFEARYDALLYDPGEYVKTLVDDAVYMLKLYKETGEDHAL
FT                   AGFIKLFNKYLEAVSPLKYVPGLVERLGERVELRLWDVDFDYEALRRLMSLVYEVKDRG
FT                   NTGSLEAGVRELAGLVSYFMAKVGVPLRELGGFNGLLGCRGCWTSDPSLMATLATVLLI
FT                   LATNP"
FT   gene            complement(362466..363320)
FT                   /locus_tag="Desmu_0372"
FT   CDS_pept        complement(362466..363320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0372"
FT                   /product="protein of unknown function DUF182"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; InterPro IPR003777:
FT                   IPR003148; KEGG: dka:DKAM_0673 xanthine and CO
FT                   dehydrogenases maturation factor; PFAM: protein of unknown
FT                   function DUF182; TrkA-N domain protein; SPTR: Xanthine and
FT                   CO dehydrogenases maturation factor; PFAM: XdhC and CoxI
FT                   family; TrkA-N domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64691"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R865"
FT                   /protein_id="ADV64691.1"
FT                   /translation="MSSRDILSRVVEELDKGRPVALAVIVGKEGSGPRGLGSMLAVTAD
FT                   GSKYGTIGGGEFEAFVIKEALTALREGKPRLLKVALRRDNIPPDAIPTNMLCGGVVEVF
FT                   INVLKPKPRLVLIGAGHVGKPIADIGSILGYRIVVLDKDPSLASRERYPYAEAVRSGDI
FT                   TRELASLELSDTDIVVVAFGEVEADYQVLRHLVERGFKGHAWILCSRNRARWMLERLRS
FT                   EGFDTEGLTGRIHMPAGLDIEAETPGEIAVSIWSEIICVSRSCRKPVESMGILETGPRD
FT                   AKA"
FT   gene            complement(363317..363586)
FT                   /locus_tag="Desmu_0373"
FT   CDS_pept        complement(363317..363586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0672 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64692"
FT                   /db_xref="UniProtKB/TrEMBL:E8R866"
FT                   /protein_id="ADV64692.1"
FT                   /translation="MIGRITGSTITLQEAMNYWDLRSVLEVLNPLLVEHGYEPVFFFEG
FT                   TPVLGQGGFSVIIKLSKELAPSDRRLVKRILEANGFKVVEEDQR"
FT   gene            363657..364181
FT                   /locus_tag="Desmu_0374"
FT   CDS_pept        363657..364181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0671 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64693"
FT                   /db_xref="GOA:E8R867"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:E8R867"
FT                   /protein_id="ADV64693.1"
FT                   /translation="MGFNLMITHEPGLENYRFILAKLRSAGLNHVLVDKGPSVILLRVE
FT                   DPYGFTSRLREIAGEIQVVYRVIPVDSVVDPYVEVVAEKARELAEERIPRDRTYRVTLH
FT                   GRLYWLETRLPAHTMDAVRIIAEKIDRPVSLTNPDYLVYVRSVKLYHRRRYAAVTVTAP
FT                   SNILTLKSEKP"
FT   gene            364238..364903
FT                   /locus_tag="Desmu_0375"
FT   CDS_pept        364238..364903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0375"
FT                   /product="PhoU family protein"
FT                   /note="InterPro IPR008170; KEGG: dka:DKAM_0670 phosphate
FT                   transport system-like protein; PFAM: PhoU family protein;
FT                   SPTR: Phosphate transport system-like protein; PFAM:
FT                   Protein of unknown function DUF47; TIGRFAM: conserved
FT                   hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64694"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E8R868"
FT                   /protein_id="ADV64694.1"
FT                   /translation="MPVSLADILPGDVIEKLREYVSISSEVVRKFKKAVELLNKYQVGD
FT                   ARAVFAELVKLEDKGEKLRGELEYSISSLRLEASFMSELLSFVSSVDRISDHVKEVSKE
FT                   LRILPFLEIPQELRNGLLELCETVAEAVETYNEAFEAVVSGDYNKALELVGKTLELEEK
FT                   ADDLEVRNRGLILEAGDRFKPLTMAIIVHNLNRALEDTADICAVSANNLRILIMTRLL"
FT   gene            364971..366206
FT                   /locus_tag="Desmu_0376"
FT   CDS_pept        364971..366206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0376"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="COGs: COG1167 Transcriptional regulators containing
FT                   a DNA-binding HTH domain and an aminotransferase domain
FT                   (MocR family) and their eukaryotic orthologs; InterPro
FT                   IPR004839; KEGG: dka:DKAM_0669 alanine glyoxylate
FT                   transaminase; PFAM: aminotransferase class I and II; SPTR:
FT                   Alanine glyoxylate transaminase; PFAM: Aminotransferase
FT                   class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64695"
FT                   /db_xref="GOA:E8R869"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8R869"
FT                   /protein_id="ADV64695.1"
FT                   /translation="MSPVYEKFLSSRVNYIETSPIREAVSKIAARSRVAKVISFAAGEP
FT                   DPDVIPRELYGELAREVFAREKKSVAYSPADGLPDLKAEIAGFMKEYEGVATTPENIVV
FT                   TLGGSQAIDIVGRLMLDPGDIVFVENPSYVNTILVWRHYGVRTIGIPVDDEGMVTERLE
FT                   EAVKAMRGEGRKLKLVYTIPTGQNPSGVTMSMERRKHLLEIASRHDLLIVEDAAYNHLV
FT                   YEPAGIKPLRAMDGEGRVLYIGSFSKIFGTGLRIGWLEAPGEIVEKARAAKGPMDMCAP
FT                   VPSQYIVLNILRNKLYRTIREKAVSEYRVKRDLMISAIEKHLPGLRHTRPVAGMFILLW
FT                   LPGMLDGRVFADQLLEKHNVAVIPAAAFYTDDSGRNVVRLNFSMSEKDLIEEGVKRMSM
FT                   LLKEMTGSSQAT"
FT   sig_peptide     364971..365057
FT                   /locus_tag="Desmu_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(366199..367464)
FT                   /locus_tag="Desmu_0377"
FT   CDS_pept        complement(366199..367464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0377"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG2425 Uncharacterized protein containing a
FT                   von Willebrand factor type A (vWA) domain; InterPro
FT                   IPR002035; KEGG: dka:DKAM_0668 hypothetical protein; SMART:
FT                   von Willebrand factor type A; SPTR: Uncharacterized protein
FT                   containing a von Willebrand factor type A (VWA) domain;
FT                   PFAM: VWA domain containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64696"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8R870"
FT                   /protein_id="ADV64696.1"
FT                   /translation="MSGEGGTGFLKGIDYGDPVVKYRGWRVRRLAEKLAGRRLNLQGAL
FT                   AVDVFYILYLPAPVPREGAGEPGREIIEALLDSPNLPVIRGKTLMDSFTSSIAAAVFLS
FT                   EVKMLEAALGHTQGAGRGVDYSEARRIVERALTTVSMDVENVKMLKSIAEGLEPGSLSQ
FT                   LSFEEDAVEVLRLARDVDARRILEVLRGLKPWELGIEKRRRRFKHGEITGYEYGRDIER
FT                   VAPSNLALPEDVFYIKYLQRRLLLYEKAVEESMGPVYVLLDKSGSMDGTKITWGKAVAV
FT                   SLYLKAVRTGREFYIRFFDSQPYPLLRVRRRPRPGEALRLIDHVVRVKGAGGTDISRAI
FT                   ITACTDIRTGSAGRESDIVLITDGVDRIAESMVRLNLKKADARLITVMVMGDNDGLKRV
FT                   SQKYMSVEKLDRESMLRVIELK"
FT   gene            complement(367461..368612)
FT                   /locus_tag="Desmu_0378"
FT   CDS_pept        complement(367461..368612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0378"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003593:
FT                   IPR011704; KEGG: dka:DKAM_0667 ATPase associated with
FT                   various cellular activities, AAA_5; PFAM: ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase;
FT                   SPTR: ATPase associated with various cellular activities,
FT                   AAA_5; PFAM: AAA domain (dynein-related subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64697"
FT                   /db_xref="GOA:E8R871"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R871"
FT                   /protein_id="ADV64697.1"
FT                   /translation="MSAPLEAGQLISKLGVLVSELEKPFVGRSEEARLLVLSLISGEHA
FT                   ILIGEPGTAKSALARRLADLVKARFFKYLLTRFTEPDELFGPLDIGALREGRYVRVTRG
FT                   KLPEADIAFIDEIFNANSAVLNMLLTLMNERVVYDGYSEIKIPLLTLISASNNVPDEPE
FT                   LQAVYDRFLLRHFLKPVSENLWGRLLEASWLIESGAYMEAKPVVSIDEVKAAGSLVFKV
FT                   DVSGVKEKLLKLYAVFEDQGIHLTDRRKGKTLKAVAANALLNGRLKAVEDDLFVLKYTA
FT                   PRDRDEAEKAFSILLDEVEAREKHLRELSEIEANIREAKAYIARSPELDPRLLDYLRSF
FT                   ETLRDKLEKLAREASDEVVRRRAVDVLGELNDAIDTVKRKLVL"
FT   gene            368733..369134
FT                   /locus_tag="Desmu_0379"
FT   CDS_pept        368733..369134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0379"
FT                   /product="protein of unknown function DUF296"
FT                   /note="COGs: COG1661 DNA-binding protein with PD1-like
FT                   DNA-binding motif; InterPro IPR005175; KEGG: dka:DKAM_0665
FT                   DUF296 domain containing protein; PFAM: protein of unknown
FT                   function DUF296; SPTR: DUF296 domain containing protein;
FT                   PFAM: Domain of unknown function (DUF296)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64698"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:E8R872"
FT                   /protein_id="ADV64698.1"
FT                   /translation="MKAVPLRIGEGGVVHAEIERAVASNGLKGGFITGIGGLSEADIGF
FT                   YNPATREYAREHLEAGGEVIEVASLQGNYLITADGSVSVHLHIVAGLKGRVVAGHLLHG
FT                   VVKPFLEVFLVETGGEVSEVFTHRAGRIR"
FT   gene            369076..369591
FT                   /locus_tag="Desmu_0380"
FT   CDS_pept        369076..369591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0380"
FT                   /product="protein of unknown function DUF123"
FT                   /note="COGs: COG1833 conserved hypothetical protein;
FT                   InterPro IPR002837; KEGG: dka:DKAM_0664 endonuclease III
FT                   (nth1); PFAM: protein of unknown function DUF123; SPTR:
FT                   Endonuclease III (Nth1); PFAM: Domain of unknown function
FT                   DUF123"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64699"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:E8R873"
FT                   /protein_id="ADV64699.1"
FT                   /translation="MRPVERSQRCSLIGLGEYVKSCYVLALEIPEGMVVEAVAGGRRLR
FT                   LGPAVYFYIGSARGPCGVPCRVARHLAAVKAVRWHVDALTTNPVVVKHGFFMVRDTGGD
FT                   CEAAVSRLLRGVLEPVKGFGCSDKPGDVSHLYACSGGVSECLPLVYSLLEDGGFNPIWV
FT                   QAWMPWDA"
FT   gene            369656..370123
FT                   /locus_tag="Desmu_0381"
FT   CDS_pept        369656..370123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0381"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="COGs: COG1599 Single-stranded DNA-binding
FT                   replication protein A (RPA) large (70 kD) subunit and
FT                   related ssDNA-binding protein; InterPro IPR004365; KEGG:
FT                   dka:DKAM_0663 single-stranded DNA-binding protein; PFAM:
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SPTR:
FT                   Single-strand DNA-binding protein; manually curated; PFAM:
FT                   OB-fold nucleic acid binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64700"
FT                   /db_xref="GOA:E8R874"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8R874"
FT                   /protein_id="ADV64700.1"
FT                   /translation="MSSNPSQEASPPTNIMDLKPGMEKVSVKARVIKAEAPRVIRTRNG
FT                   PRTISNAVLGDETGRVEATLWGEKAGTLKEGDAVEVHGAWTTEFRGKVQLNIGRSSEVV
FT                   RIDSGSVPEASEIPENSPTAPPGSGGPSRPPRRPFGGRRGFRRSDTGESDE"
FT   gene            370116..370475
FT                   /locus_tag="Desmu_0382"
FT   CDS_pept        370116..370475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0662 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Coenzyme PQQ
FT                   synthesis protein D (PqqD)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64701"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:E8R875"
FT                   /protein_id="ADV64701.1"
FT                   /translation="MSEEEGHAQGEEHGHEHEHEHPGHGELLARFNELKGVKPVRQGEF
FT                   LGEEKEKFYVALSEEEVYELSALAYYVWVMCDGEHTVGELAEAISKEAQVDFNDVVEPL
FT                   VVALDQLHEAGLVNY"
FT   gene            370702..371877
FT                   /locus_tag="Desmu_0383"
FT   CDS_pept        370702..371877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0383"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155: IPR020617; KEGG: dka:DKAM_0661 thiolase; PFAM:
FT                   Thiolase-like; PRIAM: Propanoyl-CoA C-acyltransferase;
FT                   SPTR: Thiolase; PFAM: Thiolase, C-terminal domain;
FT                   Thiolase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64702"
FT                   /db_xref="GOA:E8R876"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E8R876"
FT                   /protein_id="ADV64702.1"
FT                   /translation="MEKVFIVGVGMTKIGRFYEQSGRELFSQALWKAIEDAGGVKPRAL
FT                   VVGNMMSSTLMNQDSLGALLADYAGLRGIPAFKVEAACGSGGAALYAGYALVKSGVADV
FT                   VAVGGLEKQTEATTPYVTRALAQAADADFEVFYGVTFTGLNAMIARLYMQLFGYSDEDL
FT                   SYWPLKMHEYASYNPYAQLPRKTSMKEILDSPVIADPIRLFHAAPIGDGAAAVILVRGE
FT                   EKAREIAKAAGRDTLIEVAGVGMATDSVDIASRNNLVVMEATAKAAQEALRMAGIGVKD
FT                   VDYAEVHDAFHVTGYAALEDIGFAPKGEAPRLFKEGRFQKGDKPEVNFSGGLKARGHPV
FT                   GATGVYQVAEAVMQLRGDFPGFKASSPETALTHNMGGVSTITVVSVLRRWK"
FT   gene            371877..373433
FT                   /locus_tag="Desmu_0384"
FT   CDS_pept        371877..373433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0384"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit beta;propionyl-CoA carboxylase carboxyltransferase
FT                   subunit;acetyl-CoA carboxylase carboxyltransferase subunit
FT                   alpha"
FT                   /EC_number="6.4.1.3"
FT                   /note="COGs: COG4799 Acetyl-CoA carboxylase
FT                   carboxyltransferase component (subunits alpha and beta);
FT                   InterPro IPR011762: IPR011763: IPR000438: IPR000022; KEGG:
FT                   dka:DKAM_0660 carboxyl transferase; PFAM: carboxyl
FT                   transferase; SPTR: Carboxyl transferase; PFAM: Carboxyl
FT                   transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64703"
FT                   /db_xref="GOA:E8R877"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E8R877"
FT                   /protein_id="ADV64703.1"
FT                   /translation="MGHEDLLRKVNEYREKSIEGGGRDKIEQQRQKGKLWVRDRINRLL
FT                   DPDSFVELQWVRTHRSTYFGLDKVKYYGDGVVAGYGTIDRRLVYIYAQDFTVLGGSIGE
FT                   AHGEKIARLIELAVETGAPVIGLYDSGGARIQEGVASLHGCGRIFYSNVKASGVVPQIA
FT                   VVMGPCAGAAAYSPALMDFVIMVKSSYMFITGPEVVKAALGVDVTFEQLGGANIHASTS
FT                   GVAHFITEDEESALSLVRKLLSYLPSNNMEEPPRVPSEDPVDRRMDEIYEVVPTDPVKP
FT                   FDVKKVISMIVDEGDFLEVHEHYGRSAVVGFGRIGGYTVGIVANQPAVNAGVIDIDASN
FT                   KIARFVRFCDSFNIPIVTLVDTPGFMPGVDQEHGGIIRHGAKVLYAYAEATVPKITLVM
FT                   RKAYGGAYIAMGSLSLGSDVNLAWPTAEIAVMGPEGAIRILYRKELAQAPDPEELARRK
FT                   LAEYREVFANPFRAAELGYIDDVIDPALTRLRIYQVLEALKSKREEFLGTVPKKHGNTP
FT                   L"
FT   gene            complement(374134..375114)
FT                   /locus_tag="Desmu_0385"
FT   CDS_pept        complement(374134..375114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0242 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64704"
FT                   /db_xref="UniProtKB/TrEMBL:E8R878"
FT                   /protein_id="ADV64704.1"
FT                   /translation="MKNRFRYIRFTGIELSPEKLGREPSLSDIVNYSATSSLSVKPQNY
FT                   ISISFPEETLWLSEETYKKAKNVFGVCSYEAHEGVGFGVAKGAWLIIGEPQPVSPPLGV
FT                   NEECVRVETKLSRALGLPSFIIEKRFVFKGFKGEDIDIGRIKRYRYFIAAYDRSTGQPL
FT                   TESQLGNTLLWKNYLSNERVLKRLGASSKHLKKDLWELERMSLDAMSRYKVVWRDVAKR
FT                   FIPAVVTDGAVPEHTAHYIVVNSLEEAYYLSSILLAPQINAVINEISPWVGHVEPRFIK
FT                   FFRIPKYDPKNSDHKRLAEIGREICGKGEDYKKFENEIEGLVSKL"
FT   gene            complement(375116..377365)
FT                   /locus_tag="Desmu_0386"
FT   CDS_pept        complement(375116..377365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0386"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002296; KEGG: pai:PAE0242 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64705"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8R879"
FT                   /protein_id="ADV64705.1"
FT                   /translation="MSHQAPEQYTKDFVEGVLGSIDPGCKMEEVVIKGDGKIYKADYKY
FT                   GKLMIECEPPGGRDRGRSQLLNYMKLTGYRFGLLIDIPTEKYYTEYPSPFTNPVGFELY
FT                   MDDKPVYVRIFERGELDAARKELEVLLKVVTGLKIAAYDPTPDNVLARVRDLHSNHLDS
FT                   LTQLVGGSPQRVALYKRIWERNLELIYGKEVVEFFADLDKLYATLTLYATFLKVLGATI
FT                   LEASLGRGRYTTPLRLANEGYKAAVELFWEGKALAKHNIYYLFERDEYDWVFDPEVAEK
FT                   LDDFFRDLGKHIIEIDWSKPIELDLLKRVYQNIVSRDIRRQLGEFYTPDWIAKLALWRS
FT                   LHILVNGSLPQDILKHEKDVDNEIVELIHMFWEKNKSIPRFIDPTCGSFTFGVQYLSAL
FT                   QRWYITKKPDVHPNKFVEMILENVVGIDINPVAVLTAKVNYLLQISGLLTVRGEYLVAE
FT                   PMIPIYRVDLLALHDAHAQAKKAAPSLMTFLKVSVYKDYIYVNVPLDMFTQDKEKLEEL
FT                   AEELEDAGADVRIPRDNKGEDVPMATLKIPKSLVARLPGLTQLHRAFVALALFGKQGFN
FT                   NELEKANVTLSPDETKDIEALEKTIKAFEKLGGDHVWLSLLTNYALAYLSTQKRFHLVL
FT                   GNLPWVNVSKYEESYAEKVRSVAKRLGVNPPRAAALKLDISIVLFAVATKYLLEKGGVV
FT                   SLMVPASIFRGVHGARWRNFEAMGLKLFEVFDLEDVKPFEGANNQPGIVFAAKVR"
FT   gene            complement(377973..378500)
FT                   /locus_tag="Desmu_0387"
FT   CDS_pept        complement(377973..378500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0387"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="COGs: COG1038 Pyruvate carboxylase; InterPro
FT                   IPR000089; KEGG: dka:DKAM_0658 biotin/lipoyl attachment
FT                   domain-containing protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; SPTR: Biotin/lipoyl attachment
FT                   domain-containing protein; PFAM: Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64706"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E8R880"
FT                   /protein_id="ADV64706.1"
FT                   /translation="MPKKYSVVFFNDEAVEIEVLARERDVVVLKDPGGRIYRVRVLKEG
FT                   DGRYVLYIDDRMVSAGVIGDKVYVNLEPLLVKKVKETVAAAKAVERKEEKQTPAAMEEG
FT                   VVSTPISGRVVEVKVAEGQSIGENDVVAVVESMKMLIEVKTPFKGVVEAVYVKPGSTVN
FT                   KGDKLVKVKTRS"
FT   gene            378686..379774
FT                   /locus_tag="Desmu_0388"
FT   CDS_pept        378686..379774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0388"
FT                   /product="Wyosine base formation domain-containing protein"
FT                   /note="COGs: COG0731 Fe-S oxidoreductase; InterPro
FT                   IPR007197: IPR013917; KEGG: dka:DKAM_0657 tRNA-modifying
FT                   enzyme; PFAM: Wyosine base formation domain-containing
FT                   protein; Radical SAM domain protein; SPTR: Wyosine base
FT                   formation; PFAM: Wyosine base formation; Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64707"
FT                   /db_xref="GOA:E8R881"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:E8R881"
FT                   /protein_id="ADV64707.1"
FT                   /translation="MSIEWSEVKRRREEFWNSSPVYRAIYDRLVKQGYHLIGTIGAVKR
FT                   CHWSKEAVLRNRYCYKCLWYGIESHRCIQMTPVAAWCWNRCLHCWRLQPEDIGMHWDDT
FT                   RPPVVDDPEVLVEESIRVHREIMAGFKGNPRADQRLVEEALNPKHAAISLTGEPLLYPR
FT                   LGELIEEYHRRGITTFLVTHGTRPDVLGSLEVEPSQLYISIEAWDKDSYEHFNRPLVPR
FT                   AWELFNETLGLIPSFKSPTVFRFTIVKGFNDHDVALRSFAGFVEKAQPSYIEVKAYMHI
FT                   GGSRGRLFKNNMPSHGEVRNVAARLAELTGYQVLSESIPSRIVLLSRVGKPLRHGKGCP
FT                   DGVEHPEKYAPPLTEEYEELQD"
FT   gene            379841..380719
FT                   /locus_tag="Desmu_0389"
FT   CDS_pept        379841..380719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0389"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="COGs: COG2084 3-hydroxyisobutyrate dehydrogenase and
FT                   related beta-hydroxyacid dehydrogenase; InterPro IPR006115;
FT                   KEGG: dka:DKAM_0675 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; SPTR: 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; PFAM: NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64708"
FT                   /db_xref="GOA:E8R882"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R882"
FT                   /protein_id="ADV64708.1"
FT                   /translation="MAPRILVAGAGLMGSSLAKCLSTRGVVVYVYNRTVEKARALCSEA
FT                   GCRVLENLDSMPGFDATVVFLFDDQAVSGFIEALVDKGLTAEAGVLMVSSTISPETSIR
FT                   LHGLVTRAGGVYVEAPVYGSTGEASSCSLVSMLAGDQVARSRAEEAASLYSRRMYWVGG
FT                   VPQAMALKLALNNIGLALPGLLAESLALLEAYGVGSDVFRMVAGDLWFGSMVERYMERA
FT                   MAAAGRPRFTVSGAAKDYRVIACTLAGKGYPPLVSQGLAGFYTLAASVMPGEDYPRAVN
FT                   AYRVLKNPRPH"
FT   sig_peptide     379841..379894
FT                   /locus_tag="Desmu_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            380733..381458
FT                   /locus_tag="Desmu_0390"
FT   CDS_pept        380733..381458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0390"
FT                   /product="ERCC4 domain protein"
FT                   /note="COGs: COG1948 ERCC4-type nuclease; InterPro
FT                   IPR006166: IPR000445; KEGG: dka:DKAM_0676 ERCC4 domain
FT                   protein; PFAM: ERCC4 domain protein; helix-hairpin-helix
FT                   motif; SPTR: ERCC4 domain protein; PFAM:
FT                   Helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64709"
FT                   /db_xref="GOA:E8R883"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:E8R883"
FT                   /protein_id="ADV64709.1"
FT                   /translation="MGVRLLLPVDVVIDSREDSKHPEFREAFTREGLKTAVRELPAGDF
FT                   LLMAPEGRRSILVERKSVDDLANSIRDNRIWEQSSMLLEEARRDGHQPLILVEGCLSIL
FT                   EKQRGWRIQSVLRVLDTLILDMGIPVLNTPGKDATIAWIIAKARSLGRTEEKRVFRMRT
FT                   ERKPMDINERILYVAEGVIGPVLARKLLERFKTLRNLANASKHDLLSVEGIGEKRAEEI
FT                   YLLFNTPWRGSGDESGSDG"
FT   gene            381436..382452
FT                   /locus_tag="Desmu_0391"
FT   CDS_pept        381436..382452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0391"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="COGs: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; InterPro IPR018481; KEGG: dka:DKAM_0677
FT                   glycosyl transferase, family 4; PFAM: Glycosyl transferase,
FT                   family 4, conserved region; SPTR: Glycosyl transferase,
FT                   family 4; PFAM: Glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64710"
FT                   /db_xref="GOA:E8R884"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="UniProtKB/TrEMBL:E8R884"
FT                   /protein_id="ADV64710.1"
FT                   /translation="MSQGAMADALGYLVPVAVSAATAWLLLDWWVDAGWRLGLKGRDMN
FT                   KPGEHYAVEAGGVWVLLGAAFGILSYVALDTYLSSDKGSVEYFAVSQVLVLAGLLGLMD
FT                   DILGWKKGLSQVKRVLLTLPISFPLVVVKAGYTSVELPLIGVLDLGPLYPLLVVPVGVM
FT                   GASNAFNMIAGYNGLEALQALVITGFTLLFALKKGIVDVIPLLLVMAAAILVFLRYNWC
FT                   PARVFPGNTFTYGFGAFYASIVIYGNFEKFGLALFTPYFIELALFIRGLLNGVYKENFS
FT                   KPTPEGCLKPPYSKHYSLTHLAITVVEKLKGCAGERSVVVFITLIEAAAATVALILL"
FT   sig_peptide     381436..381495
FT                   /locus_tag="Desmu_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(382456..382770)
FT                   /locus_tag="Desmu_0392"
FT   CDS_pept        complement(382456..382770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pop:POPTR_655804 hypothetical protein; SPTR:
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64711"
FT                   /db_xref="UniProtKB/TrEMBL:E8R885"
FT                   /protein_id="ADV64711.1"
FT                   /translation="MEKQRSDTSISVSREDAEWLRALKKEFQASSSSELFQVLRRILDE
FT                   YVDGAARRLCTEYSSAKAALPAWLSIFKRERIPLRLLYMLRPEGGVMVVDSEECERILG
FT                   "
FT   gene            complement(383000..383329)
FT                   /locus_tag="Desmu_0393"
FT   CDS_pept        complement(383000..383329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0678 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64712"
FT                   /db_xref="UniProtKB/TrEMBL:E8R886"
FT                   /protein_id="ADV64712.1"
FT                   /translation="MQAESHTSLRVIEKLAYSIARLITGKKPSQGSIHLAEMSCGNIMG
FT                   EIKELARLIDEQRKCPFCGYTPGPRCWKHALYLHLVKKHLGELEEIASACGSGRSSVNT
FT                   TVHRG"
FT   gene            383550..383714
FT                   /locus_tag="Desmu_0394"
FT   CDS_pept        383550..383714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0679 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64713"
FT                   /db_xref="UniProtKB/TrEMBL:E8R887"
FT                   /protein_id="ADV64713.1"
FT                   /translation="MNPEVKLYIIAVLKKLRETIEGCRSIECATSVIDTYIEAIDEKTT
FT                   SEILKMLGL"
FT   gene            384000..385079
FT                   /locus_tag="Desmu_0395"
FT   CDS_pept        384000..385079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0395"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="InterPro IPR022272: IPR008217; KEGG: shc:Shell_0761
FT                   protein of unknown function DUF125 transmembrane; PFAM:
FT                   protein of unknown function DUF125 transmembrane; SPTR:
FT                   Putative uncharacterized protein; PFAM: VIT family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64714"
FT                   /db_xref="GOA:E8R888"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:E8R888"
FT                   /protein_id="ADV64714.1"
FT                   /translation="MSAPSRELGEWYVDEVVSARLYRFLAAATGRRVFEELALMEEKHA
FT                   GIIAGLMIGRGLKPPRRLPLRARLRERLLRLASRLLGYRVLMLVMEHGELEAVVGYWRL
FT                   LNDPSMVDARERVLELLRDEVVHEAGLYGEIHGFRVEAEGLKDAVYGMIDALVEIEAGL
FT                   IGVAAATQPIIAGVAGLISSIAGSISMSVGAYLSTKSENEAASSEELADSVLSTVDKTR
FT                   FLEKAWRRLREAGLTSEEASAIVELASGSQALLKLLSLHGEKASSPVKAARNAGLFYVL
FT                   GAIGPVAPFLANLPLYHSVMLSLLLTLLVLLALSVFISLVSGARVLRVFAEYALLTLAA
FT                   TAATFTVGLAARRLLGLEV"
FT   gene            complement(385172..386452)
FT                   /locus_tag="Desmu_0396"
FT   CDS_pept        complement(385172..386452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0396"
FT                   /product="Citrate transporter"
FT                   /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
FT                   arsenite permease; InterPro IPR004680; KEGG: shc:Shell_0133
FT                   citrate transporter; PFAM: Citrate transporter; SPTR:
FT                   Citrate transporter; PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64715"
FT                   /db_xref="GOA:E8R889"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E8R889"
FT                   /protein_id="ADV64715.1"
FT                   /translation="MDVFVLLVFAAVVALVSMDLVEKHVLGAAVLALLLFTGALSPVEL
FT                   YEAVEWDVLGVVAGMSLLTGFLRDSGFGEAVSKRIVSRVRSPRLLFFTLILLSGFISLF
FT                   LDNVSTVSLMGLVVFYVAKEAGLNPVDLFIGVALAAGMSGSATMVGDPPAMIVAGYFNL
FT                   SFLDFFFYRGRPSMFFITVAAMLASTLVYTLFHSGRSRVQGSPSAGGEGFDKVYLAEAS
FT                   ASLTVTVALLSVRNVLGLPLTLCVSAGLALILAARLLVHRDYKGVLEVARGSLEWRLPV
FT                   FIASVFALSAGLLKYGWIDRFVAAVLSATGGGFTAVSSVLIGVSVLASAFIDNTPYIVA
FT                   SLPLTSKLATAIGADPVALAWALLLGTTLGGCITPIGASSNMVAVGILEMAGHRVSFTG
FT                   FVKKALAFNMVNVLTGWLIYLLAYSPP"
FT   sig_peptide     complement(386402..386452)
FT                   /locus_tag="Desmu_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(386565..387485)
FT                   /locus_tag="Desmu_0397"
FT   CDS_pept        complement(386565..387485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0397"
FT                   /product="Transcription factor TFIIB cyclin-related
FT                   protein"
FT                   /note="COGs: COG1405 Transcription initiation factor TFIIIB
FT                   Brf1 subunit/Transcription initiation factor TFIIB;
FT                   InterPro IPR013150; KEGG: hla:Hlac_1513 zinc finger
FT                   TFIIB-type domain protein; PFAM: Transcription factor TFIIB
FT                   cyclin-related; SPTR: Zinc finger TFIIB-type domain
FT                   protein; PFAM: Transcription factor TFIIB repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64716"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:E8R890"
FT                   /protein_id="ADV64716.1"
FT                   /translation="MVEGFNEVLLELATAVSVKTGVPVERLASTASRLLSDPVFTELTK
FT                   YFDKRFKAAAAVYAALRSMGVCVSPRCVEEYAGVSRTRFTEVLRSMGVEPCSLAGYVSY
FT                   ASRVLGLDDSTAADALWAARRVRVAMGGLSNSTVAAASLYLAARGRLTQKTVSSILCVS
FT                   EVSVRNIARRMEGLLGDALSFSLREADAPGRPRGSLMLELLGGGGVAAGLTLLEPGVEP
FT                   WRSVTASAGLPLEGSIVLAEATGRLEHMGIAVGRALSYLCLKGYRVVWTHLSNLAPVLV
FT                   GEGFKPVSYSPRLGSTIYAVSLSML"
FT   gene            complement(387621..388055)
FT                   /locus_tag="Desmu_0398"
FT   CDS_pept        complement(387621..388055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0398"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013373; KEGG: dka:DKAM_0264 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF1628); TIGRFAM: archaeal
FT                   flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64717"
FT                   /db_xref="GOA:E8R891"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:E8R891"
FT                   /protein_id="ADV64717.1"
FT                   /translation="MKKAISPVIATVIIVAVTIAIAIAVALWMTGLVGSFTATENLQII
FT                   TAYAEQFTNTTTNTTYWTITLQVKNVGTTDVTIDNIFINGKPYGSVGVTLNITLPYSIK
FT                   TGETKGLTITISSGFSSGQMVEVKLHTASGKEYPKQVTLP"
FT   sig_peptide     complement(387951..388055)
FT                   /locus_tag="Desmu_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            388187..389464
FT                   /locus_tag="Desmu_0399"
FT   CDS_pept        388187..389464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0399"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095: IPR001959; KEGG:
FT                   pcl:Pcal_0427 IS605 family transposase OrfB; PFAM:
FT                   transposase IS605 OrfB; transposase IS891/IS1136/IS1341
FT                   family; SPTR: Transposase, IS605 OrfB family; TIGRFAM:
FT                   transposase, IS605 OrfB family; PFAM: Putative transposase
FT                   DNA-binding domain; Probable transposase; TIGRFAM:
FT                   transposase, IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64718"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E8R892"
FT                   /protein_id="ADV64718.1"
FT                   /translation="MGGEGFLTLHTVFRVSPEPVGEPLLLSLLRRYRDALNYSIKRIHG
FT                   YMEENGLKKVPGDGAVHKLLYGELKTVFSLPSRIAIDCYREAKAILKSWLGNGGNGRLP
FT                   RARRPRMWLTEKYGYRVRDGYVEIIGGLKLRVIGWDRRYDQYPSRQAVLTYRNGKFLLR
FT                   VAKRVPKPQPISPVDVLAVDVNEGFIVAGNHRVEYRFGTAVEKAVRYRELAERLQRKYS
FT                   NGSYRAWLRRRGIRDRVRRFHEKARSIIEDWARKTSHEIVVVARQNNYAIAREDLTYLV
FT                   ESLRKLPRQHRTRLILLGYRRFEYWLDWQCEKHGVPCIAVNPKDTSSTCPRCGSRLIEN
FT                   GYRRLKCPSCGFEADRDTVAVLNIRRKALARMGGSLTTPTAPQMTDVAPNKCGEPVNRP
FT                   KGNPLLGRGGGQGLVKPVEACVVCCD"
FT   gene            complement(389399..390001)
FT                   /locus_tag="Desmu_0400"
FT   CDS_pept        complement(389399..390001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0400"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain protein"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752; KEGG: dka:DKAM_0727 iindolepyruvate
FT                   ferredoxin oxidoreductase, beta subunit; PFAM:
FT                   Pyruvate/ketoisovalerate oxidoreductase, catalytic domain;
FT                   SPTR: Iindolepyruvate ferredoxin oxidoreductase, beta
FT                   subunit; PFAM: Pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; TIGRFAM: indolepyruvate ferredoxin
FT                   oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64719"
FT                   /db_xref="GOA:E8R893"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E8R893"
FT                   /protein_id="ADV64719.1"
FT                   /translation="MKTVNILIASVGGQGGLTLSRILAGAAVKTGLSVRTGETLGMAQR
FT                   YGSVVSYVRIGVSVHSPVFSRGEADALVGLELVEAVRNTAYLKPRGVLLVADEYKPPSL
FT                   ASITRRTQDRSIYMEQVVKAGGVIVPARRIASEAGNPRAANIVMLGALNASLKLLPHST
FT                   VEEAILEAIPGEAGSTSITAYHAGFNWLNKTLTSSPP"
FT   sig_peptide     complement(389924..390001)
FT                   /locus_tag="Desmu_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(389998..391875)
FT                   /locus_tag="Desmu_0401"
FT   CDS_pept        complement(389998..391875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0401"
FT                   /product="thiamine pyrophosphate TPP-binding
FT                   domain-containing protein"
FT                   /note="COGs: COG4231 Indolepyruvate ferredoxin
FT                   oxidoreductase alpha and beta subunits; InterPro IPR017896:
FT                   IPR017900: IPR002880: IPR011766; KEGG: dka:DKAM_0726
FT                   iindolepyruvate ferredoxin oxidoreductase, alpha subunit;
FT                   PFAM: thiamine pyrophosphate TPP-binding domain-containing
FT                   protein; pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; SPTR: Iindolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit; PFAM: domain; Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain;
FT                   TIGRFAM: indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64720"
FT                   /db_xref="GOA:E8R894"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8R894"
FT                   /protein_id="ADV64720.1"
FT                   /translation="MAGFNPLKAPPGSRLALMGNEAIARGAVEAGVYVATGYPGTPSSE
FT                   VVETLQRYGGGLGFYAEWAVNERVAFEIALGAAIAGARALATMKAPGLNVALDPVVSAA
FT                   YSGVEGGLVVLVADDPGPHTTQTEQDSRWLAKLAKLPAISPSSPQEAKDYTVAAFDISE
FT                   ELKLPVILRTTTRVNHAVGEVVLGGVREPKGFKEFKRDPARYVRAGMRWNLERHRWVNQ
FT                   QLSRAEEAAGRHGLNRVEGGGDTCVVTEGAAYNYVVEAVESLGLTGDVRIVKLGLIHPL
FT                   PSGFIAGSIEGCRRILVVEELDPFIEEELTVLLHQAGSGTVVYGKKTGGLPLEGELNPL
FT                   LVENFIARALGLPTPAPIQQPAGGVEAPERPPPLCPGCPHRFTFIALRSALMRLGYKPS
FT                   DVPVFGDIGCYALSVNPPLGSIWTEHSMGASISMAMGLRLSGFKGPIVAVIGDSTFFHA
FT                   GIPSLIEAVHKKVSLLVLILDNDVVAMTGHQSTPAWSRTETGRAARSISIVDVVKAIGV
FT                   DKVAVVDPYRLDEAVEAIAGLLEGEGVRVLVAKHPCALQERRRARRTAPYTVDPGKCTG
FT                   CGACIAATGCPAIFLSEGKAVIAVEDCTGCGLCARYCGFNAIKPGGDAA"
FT   sig_peptide     complement(391804..391875)
FT                   /locus_tag="Desmu_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            391994..392698
FT                   /locus_tag="Desmu_0402"
FT   CDS_pept        391994..392698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0402"
FT                   /product="acetyl-CoA synthetase (ADP-forming) beta subunit"
FT                   /EC_number="6.2.1.-"
FT                   /EC_number="6.2.1.13"
FT                   /note="COGs: COG1042 Acyl-CoA synthetase (NDP forming);
FT                   InterPro IPR011761: IPR013650; KEGG: dka:DKAM_0725
FT                   branched-chain acyl-CoA synthetase (ADP-forming) beta
FT                   subunit / acetyl-CoA synthetase (ADP-forming) beta subunit;
FT                   PFAM: ATP-grasp domain protein; SPTR: Branched-chain
FT                   acyl-CoA synthetase (ADP-forming) beta subunit / acetyl-CoA
FT                   synthetase (ADP-forming) beta subunit; PFAM: ATP-grasp
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64721"
FT                   /db_xref="GOA:E8R895"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E8R895"
FT                   /protein_id="ADV64721.1"
FT                   /translation="MRSAVLSYVSGMEPGGRGKLPDHLVFQLLESYGIPLAPYGFASTP
FT                   MEAAAVAEKLGFPVVVKIVSPDIVHKSDVGGVALGLSSGREVAEAASRMLEAVSEKARG
FT                   ARIQGFLVQKMMPKGVEVIVGGLNDRVFGGVVMLGLGGVFTEVFRDVSFRVAPVSLEDA
FT                   LEMMGELKASRVFEGYRGMPPVDKAALADIVVKASRLIAENPWVDSMDLNPVIAYTDKA
FT                   VVVDARIIAVKR"
FT   gene            392707..393669
FT                   /locus_tag="Desmu_0403"
FT   CDS_pept        392707..393669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0403"
FT                   /product="PP-loop domain protein"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR012089: IPR011063; KEGG: dka:DKAM_0722 ATPase, PP-loop
FT                   superfamily; PFAM: PP-loop domain protein; SPTR: ATPase,
FT                   PP-loop superfamily; PFAM: PP-loop family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64722"
FT                   /db_xref="GOA:E8R896"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E8R896"
FT                   /protein_id="ADV64722.1"
FT                   /translation="MAKCRRCGREAGYRVSYAKLWLCGEHFKEYVEERVVETVVRHGMT
FT                   GGGGRVVVAVSGGVDSMSLLAITAKRRVEMGVEKIVGVHVNLGIEGYSDLAEAAVREYC
FT                   GSLGVECTVLRLRDILGVGLPELASRAGRPPCSVCGLVKRYLITAYAVATGASAVFTGH
FT                   HLDDAARYMLKDLYVGDFKSLAGLKPAVREPGLPVKAKPLITLGKKDIEAYAELAGVPH
FT                   LEAPCPFKHSTGVEEAAEGFLKALEREHPGARLILLSSMLKLIEGYIEPVEKETYRRCS
FT                   VCGMPSRSSVCSFCRLTERTLGEPMGGRVLRSLSQPVFS"
FT   gene            complement(393683..394219)
FT                   /locus_tag="Desmu_0404"
FT   CDS_pept        complement(393683..394219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0404"
FT                   /product="protein of unknown function DUF1616"
FT                   /note="COGs: COG4743 membrane protein; InterPro IPR011674;
FT                   KEGG: shc:Shell_0865 protein of unknown function DUF1616;
FT                   PFAM: protein of unknown function DUF1616; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1616)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64723"
FT                   /db_xref="GOA:E8R897"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:E8R897"
FT                   /protein_id="ADV64723.1"
FT                   /translation="MVEKQLTLEEYVARQGGGWRAVKKAFEEASRGVIRLEDPDPPATP
FT                   VEYALRPEYSLWYWATCTAAALTIITVVLTSWINAAWLMPLRYILGALYTLFIPGYTLV
FT                   EALYPGERDLAPLERLALSIGLSLAVIPLIGLFLNYTPWGIRLEPVLASITVFTVATAT
FT                   IALYRKHRVLQESRR"
FT   gene            complement(394224..394712)
FT                   /locus_tag="Desmu_0405"
FT   CDS_pept        complement(394224..394712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0866 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated; PFAM:
FT                   Protein of unknown function (DUF1616)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64724"
FT                   /db_xref="GOA:E8R898"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="UniProtKB/TrEMBL:E8R898"
FT                   /protein_id="ADV64724.1"
FT                   /translation="MLLDEEVFAVVLAVSVVASAVGIALVLGPGGSEAFTAIGLLNSEC
FT                   RIGEYPVKAYNGSTLHLCLFIYNHMGEAIYYRVAYKIAASQGDMPTNTTPSPRPVIAEW
FT                   KGVLGDGWNETTRVEVPVAAPSGSSRVALVFELWVYRQGEGWVYTGRWVHLYVNVTSW"
FT   sig_peptide     complement(394611..394712)
FT                   /locus_tag="Desmu_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(394715..395137)
FT                   /locus_tag="Desmu_0406"
FT   CDS_pept        complement(394715..395137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0866 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64725"
FT                   /db_xref="GOA:E8R899"
FT                   /db_xref="UniProtKB/TrEMBL:E8R899"
FT                   /protein_id="ADV64725.1"
FT                   /translation="MSRLPKWIHIAAAALIIAAASCIAHAGDAGFDERVASTLAALNTL
FT                   RGKGVNVDDALVLLDKAVKAAQAGDTAGANGYLSRVEEEVRLLEAGAWSTYIWGSTVKY
FT                   LTVAVLAVIPVAVYTLLPRLYVYAWYRLRRKWVVRR"
FT   sig_peptide     complement(395060..395137)
FT                   /locus_tag="Desmu_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(395142..396749)
FT                   /locus_tag="Desmu_0407"
FT   CDS_pept        complement(395142..396749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0407"
FT                   /product="protein of unknown function DUF58"
FT                   /note="InterPro IPR002881; KEGG: tag:Tagg_0747 hypothetical
FT                   protein; PFAM: protein of unknown function DUF58; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64726"
FT                   /db_xref="GOA:E8R8A0"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A0"
FT                   /protein_id="ADV64726.1"
FT                   /translation="MYTGGIKPYKPLILLLEASSVILASHIRGDYGVAAAAAIALLPLA
FT                   ARGGYTVFLSAYASSIAVSSATLHPAPLALSTLALLLGYAYYYERYRGTGFAGRVTASV
FT                   AAFTPLYIAYPAAFSTALTALGVLAASSLREQLRLSGSRVEVSATRGGLHPGDEVVVKA
FT                   RLMVKGEAVYRLIVDGVEEASGVVNGAGEAVYRRVASGLGRSRLRLVVELRDPRGLASI
FT                   THGPYVLEYTVTPRLAEAMEKARAVLARYAEYLEAPLVLRVLVEPAGTGGAAGSPGGGS
FT                   NPAAPGAGVPGYGATVALRARLATPLELVESIGEAVKAYRGEYTGVREYQPGDPLRLIH
FT                   WKKTLSREGGEGIYVKQYAVEGEGAGMGGGGDLVVVADLTSVNPVELDLLLHAVYSILL
FT                   SNTGVGGRVFLYVKTPGKGAYVFKGRVLDVVLGLNTLILREGVEALYRYEAWGRTRRLR
FT                   LGESTGFPRLLEDYYAAYGGALASVIRELGAGEGCSVRLVYSKALGLKYSVVAGILAER
FT                   GFRVAGREEIIAGGGLRL"
FT   sig_peptide     complement(396678..396749)
FT                   /locus_tag="Desmu_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(396730..397572)
FT                   /locus_tag="Desmu_0408"
FT   CDS_pept        complement(396730..397572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0746 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64727"
FT                   /db_xref="GOA:E8R8A1"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A1"
FT                   /protein_id="ADV64727.1"
FT                   /translation="MPLKTRVVAVFFILLAAAAGLVAASLTSSTRPYSVYNTGGDGASN
FT                   LAGLPGVMVVADLSGLQGFNPASHVLITGRENPLTPAEAGYLKGFAEKGGVVIAYGSRG
FT                   FTESLLEALGVGAGVKGAVYDPVYNAGDQGLVNASTVFCGTRVVLEEPYSVSPIGAAAA
FT                   AAWSSPFSYIDVDGDGSYSPGEPIGSSVVAVRVDAGGGVIIVFPARGVFANSVLHYNKG
FT                   LLDCIAAGRRVLVDQSEVFRDPAELLRHLIRGQVYSPLHVALLIGLVTLVLYYVYGRH"
FT   sig_peptide     complement(397489..397572)
FT                   /locus_tag="Desmu_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(397556..399289)
FT                   /locus_tag="Desmu_0409"
FT   CDS_pept        complement(397556..399289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0745 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64728"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A2"
FT                   /protein_id="ADV64728.1"
FT                   /translation="MKTWLLLLLIGIPVITATPVYTRGEGAGCLYYLVLLDKAVSSAAT
FT                   LDPAGRTLAEAVAGAPAPTGLTGLHRDAWLAILGYYRVVEEASETAPGDPAAQYRIAEA
FT                   ADALGSVLEYAERLSKCSRDPGAAGLTLKRVEAGVSSMRSILEDLAENLTAWSGILEAG
FT                   LQPALDAYTPGMEVHAWVKTLGEGVSVSSIKLYTWPSLVLMDAPGYTCRGSYCYSVIEI
FT                   PDAGRLASKGVAGLVGAGGILEFAFTVDAEVNGSRVKAVKLFKAVYRHPAITVEASLLG
FT                   AGLLNVSIYSDAAYNASLSVNGEHALNLSLKPGVNILLVNASSKQAVGQAVRVEVCVEP
FT                   GVDTLPACRAVYASTQGAPSGIGVSVEAPSPVFTWTGTLGIHVVNHEGRPVNITVYAGG
FT                   SMVYSGPLEASMVIEAWAGPLPATWLSIEVAVQGGSGAVTVYKGSLLVVNTASLTAVAA
FT                   ALTAAVAVARRSLATVLQPQFRIRRPGARGRPRGPGFASRIALLYYDALSRLGVREPRP
FT                   HETLREHYSASVEPAGFRERVKELLRRLMHLAERDLYSARKVEPGEAGEVYRGVLDAVE
FT                   D"
FT   sig_peptide     complement(399224..399289)
FT                   /locus_tag="Desmu_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(399286..399540)
FT                   /locus_tag="Desmu_0410"
FT   CDS_pept        complement(399286..399540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0744 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64729"
FT                   /db_xref="GOA:E8R8A3"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A3"
FT                   /protein_id="ADV64729.1"
FT                   /translation="MPGRLYSFIVLYTGLVAASNTWLLLLGEKRADAYLAVNTLIYFTL
FT                   YSTMRPMPPGSRRARALTLLLLAVFTTIVAYRVYRVLNP"
FT   sig_peptide     complement(399442..399540)
FT                   /locus_tag="Desmu_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(399546..400244)
FT                   /locus_tag="Desmu_0411"
FT   CDS_pept        complement(399546..400244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0743 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64730"
FT                   /db_xref="GOA:E8R8A4"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A4"
FT                   /protein_id="ADV64730.1"
FT                   /translation="MKALNNLTLLGLGVAAAASLLAAYALLTGDTGLLGAAASAVMAGG
FT                   VVAVASTAPAEPSQQALHYYTGMLAAGSTAVLEDLDLLDAKPCAVNKGGRILIAFTKAA
FT                   CTQGVDPGVGFHGGSPYYAIPVEPLGEAVPAGSPGGLADALRVILVEELGVCRSVRVEE
FT                   AGGVVKVRMQGVAGGLREYAGYPVNPAVLILLAAVAGVTGTGAVVLVDGKEVPGGVEVS
FT                   LRVEKPVEAG"
FT   sig_peptide     complement(400137..400244)
FT                   /locus_tag="Desmu_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(400251..401198)
FT                   /locus_tag="Desmu_0412"
FT   CDS_pept        complement(400251..401198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0412"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003593:
FT                   IPR016366: IPR011703; KEGG: tag:Tagg_0741 ATPase; PFAM:
FT                   ATPase associated with various cellular activities AAA_3;
FT                   SMART: AAA ATPase; SPTR: ATPase associated with various
FT                   cellular activities AAA_3; PFAM: ATPase family associated
FT                   with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64731"
FT                   /db_xref="GOA:E8R8A5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A5"
FT                   /protein_id="ADV64731.1"
FT                   /translation="MEAGLDYAAGRIKGVLEAVSRVYVGKRDVVKLAVAALFTGGHVLI
FT                   EGYPGTGKTLLAKALAKAIGGAYKRVQGHPDILPSDILGFHMYRLGGERILVQGPVFTN
FT                   VLLFDEVNRAPTRSQAALLEAMQELQVTIDGVTYQLPRPLIVIATQVPYRHAVGAYQVM
FT                   ETLADRFAVSIPSHYNPPEEELEIVLKSDTVLTLPVEQVATPREVEEVSGMLQGLVHVE
FT                   NHVADYIVKLVNYVRSHPAVAYGPSHRATIHLMRVSRALAVMDGRDYVIPDDVKQLFPH
FT                   VVAHRVKLREEYEAEGVTAESIVKEALSNVPVPK"
FT   gene            401385..401831
FT                   /locus_tag="Desmu_0413"
FT   CDS_pept        401385..401831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0875 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64732"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A6"
FT                   /protein_id="ADV64732.1"
FT                   /translation="MSTPMTQQPRSLPEAVAEALAAGPVDSVVEYARRVVAEKLVGEVS
FT                   PGKVSRYIRKALRLGVWGRLRRVSRALLYAVTRLKAIRSPVLAGIVSEILVEIELASTR
FT                   GLAVFYGVIVSLKRGFTCFLGDLRRLVTIGVAYISLPPAFRYYG"
FT   gene            401824..402735
FT                   /locus_tag="Desmu_0414"
FT   CDS_pept        401824..402735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0414"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: shc:Shell_0873
FT                   glycosyl transferase family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: Glycosyl transferase family 2; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64733"
FT                   /db_xref="GOA:E8R8A7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A7"
FT                   /protein_id="ADV64733.1"
FT                   /translation="MGSVDYSDLTVVIPVFNEAEAIGLVLDEVLAAGVPRERILVVDGG
FT                   STDGTVEAASSRGVRVVQQEGRGKADAVKTAARLVETGFTLIMDGDYTYPAGFIQALYV
FT                   KAREGYDLVVGWRRWGEGSQPLVYRLGNKLLTFVFNTLFATRLHDVLSGMYIVKTSVLR
FT                   EVPFEMKGFSVESEIAAYAAGTGARVAEVPVEYRRRLGRKKLGVRHGLRILLDVVRLTW
FT                   RYSPAFFIFTLGSLLLIPGLALGSWVAYHYFFTGTVYHVKGLTAVILTAAGLQSLLLAV
FT                   IALYMKRMELRILSTLKHIDQH"
FT   gene            402775..403884
FT                   /locus_tag="Desmu_0415"
FT   CDS_pept        402775..403884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0415"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   pcl:Pcal_0472 glycosyl transferase family protein; PFAM:
FT                   glycosyl transferase family 2; SPTR: Glycosyl transferase,
FT                   family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64734"
FT                   /db_xref="GOA:E8R8A8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A8"
FT                   /protein_id="ADV64734.1"
FT                   /translation="MLEEAALTLALLHFGFPLYYYSWAKGMLGKSVRAGRDPGFTPRVA
FT                   VVIPTYNEAGNIERKLEDIYSQDYPRDRITVYIVDSASSDGTVGKALDWASRHKDIEVR
FT                   IVEEGERRGKGRALNTALNTIDGGFDFIVVTDADAFWANRDALRNALSYFSDESVGAVS
FT                   CVKTPGGGGFTGVESGYRDFYNVVRLGESSAYSTPVFHGELSAYRRRLLEDLGGFPTDI
FT                   GSDDSHTATLIAVKGYRAIVAPDVYCYEPVPRRKYFHWRVRRAQHLIQHFAKSIRLLPR
FT                   SPKAFRKILAAEIFLHLANPILLLISIALLAYSAYKGSPLSLSLLALGTALLAYKPYRT
FT                   WIVMQLILLVAMVKNAFRKELVWSKEEKE"
FT   sig_peptide     402775..402846
FT                   /locus_tag="Desmu_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            404168..405070
FT                   /locus_tag="Desmu_0416"
FT   CDS_pept        404168..405070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0416"
FT                   /product="glycosyl transferase family 2"
FT                   /note="InterPro IPR001173; KEGG: sii:LD85_1079 glycosyl
FT                   transferase, family 2; PFAM: glycosyl transferase family 2;
FT                   SPTR: Glycosyl transferase, family 2; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64735"
FT                   /db_xref="GOA:E8R8A9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8A9"
FT                   /protein_id="ADV64735.1"
FT                   /translation="MHGVAVLIPSFDRARMLKIILPRWLASAHVCSVIVLAEASSAEVL
FT                   DEYRRVLQGLDASGKLIYRIMPGRMGSVEARNMLLEMALKHTTCEYFLLTDDDYLPIDE
FT                   DTLGVMLKHMRDDKVGAVGGRVVVLRKRRVDPDFFLNTPFLIADALTRLIGYVFLDVEH
FT                   GPRYAEFLPSFFMVRREVIENGVRYSKAFSTPTGFREESDLQQQIKNLGYRLVLEPRAR
FT                   VVNLVPEEGGNRPRMSMRKRIYWKARNHIIFVFKWNTSRARRLWYTMLSAMLLLSYRPW
FT                   HLPSVMKGLQDGIREASCA"
FT   sig_peptide     404168..404284
FT                   /locus_tag="Desmu_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            405061..406212
FT                   /locus_tag="Desmu_0417"
FT   CDS_pept        405061..406212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0417"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: tag:Tagg_0579 group 1 glycosyltransferase;
FT                   PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase group 1; manually curated; PFAM: Starch
FT                   synthase catalytic domain; Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64736"
FT                   /db_xref="GOA:E8R8B0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B0"
FT                   /protein_id="ADV64736.1"
FT                   /translation="MRIVHIFHNYCPVVGGLEKAVQKVAEEQTKMGHEVHVITSNYGAN
FT                   GRPKEEVLNGVYVHRVRSWRLGFADLTIPLEYPVDLFEKVDVVHSWSQNSLFTYLMSKK
FT                   AKRLRKPVVVYFLGVSYLRHHYNLLIRIFGYFYQRMVERGVVELADMALATNEYEAELL
FT                   REKYGVKATVVPHGIDEIYLNTLDMSARFREKYRINNRIIAYVGRIHYTKGLDLLLKAF
FT                   AQIAKQVDDTVLVIAGKGDKKYFDKCMHLAEKLGVSSRVIYVGFLTEEDKIGLIDASDV
FT                   VVLPSRHAGESFPLLVYEVISRLRPIVVTNAGMLGYHVRNGEDGFVVAVDDLQGLSNAI
FT                   LAILKDRDLREYIKLNLIERRRVLWLWRDVASKFIDLYKPLVN"
FT   gene            406216..408057
FT                   /locus_tag="Desmu_0418"
FT   CDS_pept        406216..408057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0578 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64737"
FT                   /db_xref="GOA:E8R8B1"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B1"
FT                   /protein_id="ADV64737.1"
FT                   /translation="MLSFSSALIFFTVVLVPLYTIFLWLSNNEKNKDISPNNVHIHASN
FT                   KLLDMTTYLSFALSATGLLLTLSTHFRETLPYFLITVLIPFLNVVTAFYKPRGMIIASY
FT                   VLWHLMLLLGNVPATGIAIGEGTGMLREMALNDHWRFEWAHNPSYNPLPTMAFIQATLS
FT                   RVAGTDWYSWALGTTVFLGWAVAYDISVYLLTLYVTGETRAALLSIPLIAVTPETAIHQ
FT                   HPYQWSGNMLVLLASMVLVKAVQGMEKPTRYILLMTLLFTGAILAHATALAYIFVLLGL
FT                   LATRYMYPLLGKLHLRMEKTPIERIVLPATLVLVVIFFIRSLYVSGFAQYVMPSFLSVY
FT                   NGLVGIIKSFLIPTEEHEIGAAIHIPLYERAEVSPIQAYVWSYTASLATAYFIYALFLK
FT                   RRVSSLQFSLYVTSVLILSVSFMGYSILKEKNFYLLNRTTYVFIPFIAPMASLTLSRIF
FT                   GLLRRRKISLRALGLASMLMFIATAPIAAQDPNISPIQYARIRNSESVPLSMGDILIAK
FT                   SFLGQLDVSSVSQLYLTSSRLYMTGMYRLTPQGSAVGIWLPTYTSRFKEALGLTSFIDK
FT                   LQLPAIHLSTDSSSYTGMYCKLIYSIGIDSTSIYICN"
FT   sig_peptide     406216..406281
FT                   /locus_tag="Desmu_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            408409..409230
FT                   /locus_tag="Desmu_0419"
FT   CDS_pept        408409..409230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0419"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: ape:APE_2066.1 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase, group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64738"
FT                   /db_xref="GOA:E8R8B2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B2"
FT                   /protein_id="ADV64738.1"
FT                   /translation="MLGYLRSLYSSLRDRARFRLFEFSHKVPSAVLSFFHKPRVGRLVF
FT                   VSRSCIADALVHTPPREREELRRRSVVIYNGLSIERVRRSVDRVDSNSASVVFVSRLME
FT                   YKGGFRLVKAFVHVVEEVKDTVLHVIGEGPEGPLLRELVRKLGLEKHVIFHGWLGRRET
FT                   LRVIASSRILTHPSLYESFGYVIAEAYALGKPVVAHRASYSLELVENFGAGLVVNTFDE
FT                   KRYAEALMTLLTDDNLYRRLSQRALATAEEYFDIRRTAEEYLRVYREVVGE"
FT   gene            409227..409841
FT                   /locus_tag="Desmu_0420"
FT   CDS_pept        409227..409841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0420"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COGs: COG0726 xylanase/chitin deacetylase; InterPro
FT                   IPR002509; KEGG: cma:Cmaq_1454 polysaccharide deacetylase;
FT                   PFAM: polysaccharide deacetylase; SPTR: Polysaccharide
FT                   deacetylase; PFAM: Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64739"
FT                   /db_xref="GOA:E8R8B3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B3"
FT                   /protein_id="ADV64739.1"
FT                   /translation="MRCAVLTFDDGYLSHYEIAKMLYRMDVPATFFIITGLMEYNGRRL
FT                   LATRPELIREMRDMGHEIASHTVSHRDLTRIPVWEVEREAAESKKMLEETVRDEVKGLA
FT                   YPYGSFNDRVVEVVRRYYSYGRTMGTVNRWNEKADSYVIGSIGIRHLPEVPMRLLVNRT
FT                   GLVVLTMHDERQLIVRAVVELLRALGFRLTTLSEALRGHNV"
FT   gene            409834..411051
FT                   /locus_tag="Desmu_0421"
FT   CDS_pept        409834..411051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0421"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: hbu:Hbut_1505 glycosyltransferase; PFAM:
FT                   glycosyl transferase group 1; SPTR: Predicted
FT                   glycosyltransferase; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64740"
FT                   /db_xref="GOA:E8R8B4"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B4"
FT                   /protein_id="ADV64740.1"
FT                   /translation="MYKVISILHHSLPMIDGKLAEEDGQGWHFRSALALRRLGGFAVEA
FT                   VRPSGESQGLVKVVDEIPLVLTPTLRLSPSHMLWKWDEVSPELARYVEHRVSRDGYIPY
FT                   IHEYRALNSELVVRRLTDHPVILQHHGSSPPSLSRLMNPSPFSVAKELSKIKREGLLRK
FT                   IHGVFFVVNIREKKYLEEVLGVEARVLFRTMAVDFEKLRPPAWEEVQRFREALGIPLDA
FT                   VVLVSYVGIFREEASFLKGLHYIPVIWKMLRKEYGGRIVIVLTGVSGRWRDMLREMGIR
FT                   VYGFLPHQEFLRFLSTSDIYFFPATGGYYGGPGVAVMEAMALGKPVVSPTFLEMPREAI
FT                   PRTGAVVTPFVGNAKDLNVFIKRLKYVVDNVEVFRARTSMIREEAHRVFSWESFVRDFT
FT                   DAARGL"
FT   gene            411055..412050
FT                   /locus_tag="Desmu_0422"
FT   CDS_pept        411055..412050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0422"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683: IPR004104; KEGG: hoh:Hoch_4014
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: Oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, NAD-binding Rossmann
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64741"
FT                   /db_xref="GOA:E8R8B5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B5"
FT                   /protein_id="ADV64741.1"
FT                   /translation="MVRLRVGIVGGGFAAGHHVKGWRANKAKVVAVSDIAVERARVFAE
FT                   SHGIPRYFSSLEEMLKDVELDVVSICTPPQTHREVAVKVAQANANMFVEKPLATSYSDA
FT                   AEILNVARSKGVKVGVVSNYLYTPVSIKARRLVREGVIGPVCRVDIAVYAPREVVLARS
FT                   GGWLESLPGHVFGEVLPHAIYILQDIIGKLDVVSVDFSRLSEGGWTLYDELYAVLRGER
FT                   GVGRLTISYNARRFDIYVYVEGEKGSLIYNPVGKIISRLSTSWRWASNLLSLKPYLELG
FT                   FDHIFNRAPRDPFAENIGDFIRLLERRDDDHLDMLLNQVRVYEEILREYR"
FT   gene            412077..413009
FT                   /locus_tag="Desmu_0423"
FT   CDS_pept        412077..413009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0423"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR001173; KEGG: mfs:MFS40622_0603 glycosyl transferase
FT                   family 2; PFAM: glycosyl transferase family 2; SPTR:
FT                   Glycosyl transferase family 2; PFAM: Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64742"
FT                   /db_xref="GOA:E8R8B6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B6"
FT                   /protein_id="ADV64742.1"
FT                   /translation="MLTTGTHERLGYLRLLLRSLSRQTMRPSEIIVASEVSDRELLETV
FT                   KRECGDTCMVLATGLWNKCRTANRAILESRGDIVFLLEDDLVLREDFIEEVVKTFDRDG
FT                   SIGCVYSRCVWVFREGARSRGGPLGLATRLLSKLSVHESLLPRQVRTIDRHLAEIPVFT
FT                   MSVACRREALLRAGLYDESVEEPIQGEDFDLAMRVRAAGYRIVANGKAVSYHFTRQVSK
FT                   RVERLRRDPRHIEGVYRSEVYFLAKNRGLVGLYVVPHAIYRAIEAVAWAARSGRPSTAL
FT                   YGVRGIMVGLVKGCVSRGAGPWRSRSYTS"
FT   gene            412982..413895
FT                   /pseudo
FT                   /locus_tag="Desmu_0424"
FT   gene            413892..414878
FT                   /locus_tag="Desmu_0425"
FT   CDS_pept        413892..414878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0425"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: plu:plu3015
FT                   hypothetical protein; PFAM: glycosyl transferase family 2;
FT                   SPTR: Similar to putative glycosyltransferase; PFAM:
FT                   Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64743"
FT                   /db_xref="GOA:E8R8B7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B7"
FT                   /protein_id="ADV64743.1"
FT                   /translation="MKSILVSIVIPVKNERGNVEQLIMSIYGQTYRPIEVVVVDGGSTD
FT                   GTLEALQELKAKLKGAGFAIKVLKEEDFGSLRSPANARNIGVLNSSGEVIVFFDADFDL
FT                   SGDPEAIEKIVAGLGEGEHVAITYAPNGHTWVERHLALDDIVYYFRGGRPLHVVCCFRR
FT                   SVFSRALFDASLGFGEDLEFLARAKTMWRVVGTGVRRCYPHTLGQLMKQQLWYGRTALR
FT                   YFRKVGAMRWPIDVARSNAVLGIVALDVIVSAASMNVLLTLAVTALLLAFVAHRWLRRD
FT                   VVVLGGKPRLILERLAWTLLRETYGRLWFDIGLLLGLARSSHRDLGR"
FT   gene            414921..415211
FT                   /locus_tag="Desmu_0426"
FT   CDS_pept        414921..415211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_5573 GerA spore germination
FT                   protein; SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64744"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B8"
FT                   /protein_id="ADV64744.1"
FT                   /translation="MHLLILRGTERWALEVSKHLSRMLKSSISIVSFCTGLEDYGASRV
FT                   KVPSLVRYLAEAKSVEALFVPSIYYKHVSKKLALLSGSRALSQAGRRYKCS"
FT   gene            415302..416426
FT                   /locus_tag="Desmu_0427"
FT   CDS_pept        415302..416426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0427"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1216 glycosyltransferase; InterPro
FT                   IPR020785: IPR001173; KEGG: tag:Tagg_0574 family 2
FT                   glycosyltransferase; PFAM: glycosyl transferase family 2;
FT                   SPTR: Glycosyl transferase family 2; PFAM: Glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64745"
FT                   /db_xref="GOA:E8R8B9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8B9"
FT                   /protein_id="ADV64745.1"
FT                   /translation="MQQAGSHDAGRPVTPSKVAIVILGYNARKSLGPLLDRAIDSALGQ
FT                   SYGNVKVIFADNGSADDSAEYVSSKYGDKVRVVRLGRNYGFCLGNNLAVRHLSPDIKYI
FT                   LFMNPDAVLEERYVEKLVGIMERDESVGIAQGLQRSLGGSFSSLGGYVDSYGRAVEVDV
FT                   SGLEGRLSGLDAVFEVAWASGSAMMVRRELFERLGGFSPELFMYHDEIDLCARALSLGY
FT                   RTVVYPRAVYYHRRGTEGAPKRINWLSWYLANRNKWLTTVRYFPLKHVLRALLLYLPVE
FT                   VLINVLKSVRKGERARARLQLRIVWHVARNLRREASFRRRWRPGLRGLEGFIMDVPSPL
FT                   IGVDPRRALRKLLSHAHGAPRPKSGRAKASPGRA"
FT   gene            416466..418052
FT                   /locus_tag="Desmu_0428"
FT   CDS_pept        416466..418052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0428"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; InterPro IPR002797;
FT                   KEGG: tpe:Tpen_1738 polysaccharide biosynthesis protein;
FT                   PFAM: polysaccharide biosynthesis protein; SPTR:
FT                   Polysaccharide biosynthesis protein; PFAM: Polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64746"
FT                   /db_xref="GOA:E8R8C0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C0"
FT                   /protein_id="ADV64746.1"
FT                   /translation="MSRRSLVDLAAEASRGGAYLFAGNALSLALSALASILIARLLGPE
FT                   GYGIYSLVLTVPAIVGPLIGLGIGQAVTRYVAMLGSEGKGCDASMYIRVALIFEASLGL
FT                   VAMVLVFLCSDLVAMYMLGRPGIGSLVGLVSPLVLTGSIIGICDGVFLAFLKTKYSALV
FT                   KSLQALVKLALSPLLALSLGVMGALGGNVASYIVATIASLALLASACRTLGSNNKATSV
FT                   GYVEALRSMISYAYPLYLPTLLGFLIGRVIFVLTAHFVSDYELGNYSVAQNLYSPISMA
FT                   TSAIGSSLFAVFSGLDPGRESREVAEVFRASVKYSTVLMVPAIAMAILFSRDLVVLVYG
FT                   LDYEAAPLYLALTATGALGVGLGAYVLGGLFAGIGKTQEVFRSWIVNTLVSLPLTLILL
FT                   PRLGMVGAIVAGLIGGYASTVYLLMRAKIEAGVSIGAKEIARVYVSAAISALATLPVLY
FT                   VEIHEVLRVILASIIYVASYAIILPLLGALKEDEVSILVNVARRSGPVLLPLTLLLRIE
FT                   ERIIRKLKQIL"
FT   sig_peptide     416466..416567
FT                   /locus_tag="Desmu_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            418168..419364
FT                   /locus_tag="Desmu_0429"
FT   CDS_pept        418168..419364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0429"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: pai:PAE0431 glycosyltransferase (type 1);
FT                   PFAM: glycosyl transferase group 1; SPTR:
FT                   Glycosyltransferase (Type 1); PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64747"
FT                   /db_xref="GOA:E8R8C1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C1"
FT                   /protein_id="ADV64747.1"
FT                   /translation="MTTGRILVFSKLWWPEGGGGELATHLITKHILSRHFEVIVVSGTR
FT                   HPTGEVMGYCRYLYWPVLREPYKPLEWLKLFSNTETLRKLVEKADTIYIPSHTLLPLAI
FT                   AAKNINPRARVIVHLHNYQPLTYTSVILHDVNTRSLGDVIVELYEHGDVARAIATGLLD
FT                   TLGVNRVSALALGYADRVVCVSRRQCGIIASGLPGVSRKLVHVYNLLPEVPPVEKRLGR
FT                   PLLLFTGGDSYLKGFHLVLGAALELTRRGLDAEVLVTRRLGEIGLSAARRLGRVLKPIG
FT                   HVDYERLLELYSTSYALLHPSIWEEPLPYAVIESMLSGTIPIASRVGGVPEIVDGTPAE
FT                   RFMFIPGDPLILAEKIEEVIAMGREELLSIGGQLREATLRKFEATKIEGKLLKAFGVE"
FT   gene            419515..420180
FT                   /locus_tag="Desmu_0430"
FT   CDS_pept        419515..420180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1461 thymidylate kinase-like protein;
FT                   SPTR: Thymidylate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C2"
FT                   /protein_id="ADV64748.1"
FT                   /translation="MGRVIVFAGLEGAGKTTHIRLLAIRLKKRGLRVRTTYLKTVFIFA
FT                   RLLPRLFSRLGLGKREIYAAHRCGVLLDLALNSVLLPLLKLLRISAITRRNDFILVEEH
FT                   LPGSLVDYYHAALVLGLDLKLVKKLVRILSRLMWGRSPEVLVLWAPPSSLPERWRKRGT
FT                   PPELKTYVFTQILVLKTWVKREGCLINTEGRKIINTSKELECLLGITRSNCDFSEHRS"
FT   gene            420401..421546
FT                   /locus_tag="Desmu_0431"
FT   CDS_pept        420401..421546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_1376 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64749"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C3"
FT                   /protein_id="ADV64749.1"
FT                   /translation="MVLRTHRNSGKLRIIIVGPSAKDMSGSLLRPMNFYYSLKDLKTLS
FT                   VRYLPISRLAQLFMPKTLSSLLKSDIVIVSGTNPWISAFMVLARKIFRRTTVVDVHGVA
FT                   WLESISTGQPGIIGRFILFLSEYLTYKHAHYIIAASTYTSEAIYRYFTPRKARVIENAL
FT                   TPIFEDIVAKLKEKTVLGLREKISILLGLQNHLDKTIVVAPLPGVFSSNILAYSELMNI
FT                   AWLLPSNVLIIVTGHRIKRPSLRAKNEENSRYKVIQVGFLTYPAYAALLLSSEAIILPY
FT                   PKNAICGGARNKVLEAGYIGKPIVSTPAGMLFIPAIPRKHYIPLEEFLHISKNSSAFRE
FT                   WNSIGLEFQKLILSRYTFKVFKRSLLKELRGILTSASEYFW"
FT   gene            421654..422666
FT                   /pseudo
FT                   /locus_tag="Desmu_0432"
FT   gene            422688..423803
FT                   /locus_tag="Desmu_0433"
FT   CDS_pept        422688..423803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0433"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: tpe:Tpen_1723 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: Glycosyl
FT                   transferase, group 1; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64750"
FT                   /db_xref="GOA:E8R8C4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C4"
FT                   /protein_id="ADV64750.1"
FT                   /translation="MVRFIKVAFVNWRPSDEYFSELSKELSEKGIKTDAIPLISEFHLS
FT                   NLDPRALIEYDVVYFVNLFYPNDELYYLLRLSRTLETKPIVYGVHAPVVMPRFRGYRPR
FT                   NYLYSMLSLLRLIVERTFINNQICSIHVLNSFDLQVFRALRFRRVAYIPWGIPNTILEN
FT                   CQPSPDEKQSDRFTIVFVGARYGKGADIAYSVISSLLPRFPDIHAKIFLGHGTLPALVQ
FT                   HLQNLADKFPNRVDIFHLLSRRDFLKELLQAHLLLFPSKYETFGLVVLEALACGTPVVA
FT                   FDIPGAPRDLLKPAVSRGELCGHIAKNFDLKSLTRGVLKYYLLWKKDSSYVVPSISSRR
FT                   LAERYPLTNMAMDLAKLFNEAALSCRSGCSC"
FT   gene            423907..424545
FT                   /locus_tag="Desmu_0434"
FT   CDS_pept        423907..424545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0841 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64751"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C5"
FT                   /protein_id="ADV64751.1"
FT                   /translation="MRCVVVCFFGCDGSGKSTLAGLLSRYLSDCTGKQSVVVWVRGTHT
FT                   FSSFLARFMEGFQLFKGNCNPYYNICVPEKMSYLWVWLEFFSALPVFFARFVLPRITGR
FT                   VVVAERCPVDFLVWLAVTLRRNVFKSFIGRATLSIAFSLCECMVYVRADEGVLLSRRSA
FT                   LWDRRVIPVELRIYDSLARFLGVRVVDTSGKSVEESLREVVEIAGNECV"
FT   sig_peptide     423907..423951
FT                   /locus_tag="Desmu_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            424523..425407
FT                   /locus_tag="Desmu_0435"
FT   CDS_pept        424523..425407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0842 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64752"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C6"
FT                   /protein_id="ADV64752.1"
FT                   /translation="MRGMNAYRECFKLIYNSIGGGKGIHVNRDLYGYCLELASLNKVKL
FT                   QFLRSIDSRDEERRREEARYAVFLRELESVSRALKGVEHAFIKLRKPVAYVPSDIDLLL
FT                   SPSSLRSAVSRLRDLGYSIIVKEPYCVTLVRKTSIVDLYVHPTIAGVIYAEGSRLLSYT
FT                   ETAGFNGVEVKVLERDAEAVLAVAHALYKERVYTLNDYFTVEKWLSNRSLKIAKELKAL
FT                   EAVSLAATLNQQVREGSIVLPYRLPMPRWITLLARKTWRDPLFTSTITKAAGYIPSKRF
FT                   GRQVVSKLTRLGY"
FT   gene            425516..426226
FT                   /locus_tag="Desmu_0436"
FT   CDS_pept        425516..426226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0436"
FT                   /product="O-methyltransferase-like protein"
FT                   /note="KEGG: fpl:Ferp_2404 O-methyltransferase-like
FT                   protein; SPTR: O-methyltransferase-like protein; PFAM:
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64753"
FT                   /db_xref="GOA:E8R8C7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C7"
FT                   /protein_id="ADV64753.1"
FT                   /translation="MLGKAMRIYRERGLKALVKSAASLARRKLGGTGLDSLILTPYACL
FT                   EFKSTSSWRDALDYVLSEKTVAKMIRPMQVREEITALLSLLESVKPRTILEIGTARGGT
FT                   LFLFSRIASDDALIISVDLPGGLFGGGYPYLKTFLYRCFARTKQKIVLLREDSHSEETL
FT                   SKVRKHLNGRGVDSLFIDGDHSYEGVKRDFEMYSPLVKKGGIIAFHDIVPGPPENVGGC
FT                   SSILAGSKAEIQAC"
FT   gene            426302..427459
FT                   /pseudo
FT                   /locus_tag="Desmu_0437"
FT   gene            427479..428735
FT                   /locus_tag="Desmu_0438"
FT   CDS_pept        427479..428735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAL2512 hypothetical protein; SPTR:
FT                   Sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64754"
FT                   /db_xref="GOA:E8R8C8"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C8"
FT                   /protein_id="ADV64754.1"
FT                   /translation="MNITPYIFNQLLEGEKPPIRVLQALFWIGVGMVIHGAMHPPLLAE
FT                   LSAAIVLLALAVLLAARLEALLNSEVLPELALELTGEGRGESAGIASAVEFTRSVLSGR
FT                   KSLYSDLAVSRLRVALLALLPFSTSMFISLTTAMLIDMSPIPRPSLTDGLALVFTSCTL
FT                   ILLFGEGPAVREPAHGEAGYEGSFTAMVEKYVYGGLPTLPPVLRYAIPRLAALFLSPKL
FT                   KVKPPRLLLNIYLCSPAMVELVEKWKKEYGATVAGDIDNLFKCKNTGGLSKWVELHSDN
FT                   SLKEILDKLLGKNEDALKKGRALVVKIPVREKGSNGESAKEREKKGSGERLAAYIAMTA
FT                   WEGCIVYKRIRQGKRGRNRSLQWSNLEEMAEPWRMISVFMVGLQEYVDALSLEIELASR
FT                   RAGLENIICYSEDNKGSDG"
FT   gene            428980..430068
FT                   /locus_tag="Desmu_0439"
FT   CDS_pept        428980..430068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA0620 sensory transduction histidine
FT                   kinase; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64755"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8C9"
FT                   /protein_id="ADV64755.1"
FT                   /translation="MEEIRERVNGRKWAWIISHLDYDHFSIIEALWRDGRINPPDVVIL
FT                   PASYNVKLCRDAVSYLYAYMMLLSHIEKIQPPGWIEIFDRLSNTRKLFVEKGHRIKAGP
FT                   LEYLVLWPSRDYAEQNCEKVLKEPVLKELKDKIESFCGAHENKEYKNIADKAREEACKE
FT                   AEKAREKILEGLSKNTVQVYGNIIDLEELLTEDRNRDSYPQREGSRKPENDVASKDKAS
FT                   IILYSKVRNLNSIAYVLKAGFPCELRVFERVKRRKYSVFFDYYYGYDVLLYLGDLSDEE
FT                   LDKALENYFGLTENKRLLVEVAPHHGNSYSRYLKQLNPAPVYLSRCNKHYRYPNRYEKY
FT                   YHGSVVIVSGHTRGVDISYYKV"
FT   gene            430727..431584
FT                   /locus_tag="Desmu_0440"
FT   CDS_pept        430727..431584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0440"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG1192 ATPase involved in chromosome
FT                   partitioning; KEGG: sii:LD85_3138 hypothetical protein;
FT                   SPTR: Cobyrinic acid ac-diamide synthase; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64756"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D0"
FT                   /protein_id="ADV64756.1"
FT                   /translation="MPNVITVTNQKGGTGKTTLSALLGIGLASKGYNVLLIDLDPQAHL
FT                   SSLFVKITNLENVSDGAIEMAQDLRFNIRPINIGTRGRLGLIASGLNYIIKVYRGMIPS
FT                   TDPYAIYKRIEREPAITRNYDYVICDTPPELFPPTIWGLFAADYIIIPSNLEELSILGT
FT                   KLLIKEVLPEVIMYSKKNVRVLGMALINISKKYGQDTFNKLNDALTRFIRNLPVPVRER
FT                   FYARPLFQARIHRHEELKDLPYRPRRWELPLKRVVDRSAELRIEVQSFVDELISRMSNF
FT                   AGLQ"
FT   gene            431568..432044
FT                   /locus_tag="Desmu_0441"
FT   CDS_pept        431568..432044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_F4484 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Phage integrase,
FT                   N-terminal SAM-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64757"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D1"
FT                   /protein_id="ADV64757.1"
FT                   /translation="MPAYSRANDETEKFRIIQLELPKHLADWLESFSREIAMRPSQFIA
FT                   TILTYFYEAWKVGRESAFAATREPYKKKEQSLDEIVERFSREVKLGRNIFILRKFVSWI
FT                   QQRGLGVGSIDEEAVNAFLNAYLEGRAVKKNTVDRYRGILRRFVEYLATKRDTD"
FT   gene            complement(432325..432522)
FT                   /locus_tag="Desmu_0442"
FT   CDS_pept        complement(432325..432522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hbu:Hbut_0698 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64758"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D2"
FT                   /protein_id="ADV64758.1"
FT                   /translation="MSIVVCVRVPRWVKEVLERHGVRVSELVRRLLIEEAERLSEEELR
FT                   RILDDVAGMLEGKIDPCEWA"
FT   gene            complement(432872..434563)
FT                   /locus_tag="Desmu_0443"
FT   CDS_pept        complement(432872..434563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hbu:Hbut_1168 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM:
FT                   6-pyruvoyl-tetrahydropterin synthase related domain;
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64759"
FT                   /db_xref="GOA:E8R8D3"
FT                   /db_xref="InterPro:IPR018776"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D3"
FT                   /protein_id="ADV64759.1"
FT                   /translation="MNTREVIYELLSQLLVALMTVLVAHPLLSTTGLPSYSAGRFRDAT
FT                   IAYYIEWARELDAYGPYTPAWCGGFDLLRFYPPLGLTLIYLIGRAAGDFPYAAQTSFFL
FT                   AIYVFALGAWALGRSLTGSRLAGLATALTALSITGYVSTISVYWEYTRILGEGLAMLAL
FT                   SELNEFMRHGEKKSALLFGVFTGLTVLTHLIASLLLATLSAVTAAYWVMRHMKKGAGVS
FT                   ALTYIARLLAVAVALALAISGWWLIPALIPFGISHYMRVQPQPGLVAGVFTNSVSLFPP
FT                   LYEPGIQAPLLLLGFTGIALQVFKGRERLPLLYVSSTALLVLLYGQGSRLIPTLGLFMV
FT                   ASLASTYNGRLRELSSSLALTAVVAASLIYFSHYIPVYWSNLSLDHTYVESDEYLIAEY
FT                   LAGKVPSGHRVYAMYGPLLHGNQWINVFEPGLWQVLSGFMEGCVKPEPLELDYLVKDTL
FT                   HTSAIREMIVELNVDYIAVDKEWYETRDPNSIKLLEAEGFLVKDPVSKALSYTLLFKVN
FT                   TTGGLEKPVAEEQPSIIEYLLLPSRLAGYSTSLLMLYVFTRMKKET"
FT   sig_peptide     complement(434492..434563)
FT                   /locus_tag="Desmu_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(434550..435116)
FT                   /locus_tag="Desmu_0444"
FT   CDS_pept        complement(434550..435116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hbu:Hbut_1169 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64760"
FT                   /db_xref="GOA:E8R8D4"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D4"
FT                   /protein_id="ADV64760.1"
FT                   /translation="MTYTGTEETAGGRVFYTFLTGVVVATVLAYILTLDPISLLLIGGE
FT                   LSILEFIAGYIGIHTVRVSPDTLILHRMSHAVTVIMTPDCTGVFAPVVLGLLVLSTPGV
FT                   RLRVKARVLPVHLLVMLVVNMVRIEASAVAGVFFGPIAFRIIHDTIGGAIMLALALVLW
FT                   LDWLYREIIPWLRRTGPGWIINEYS"
FT   sig_peptide     complement(435030..435116)
FT                   /locus_tag="Desmu_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(435097..436413)
FT                   /locus_tag="Desmu_0445"
FT   CDS_pept        complement(435097..436413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0445"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   hbu:Hbut_1170 hypothetical protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: Universally conserved protein;
FT                   PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64761"
FT                   /db_xref="GOA:E8R8D5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D5"
FT                   /protein_id="ADV64761.1"
FT                   /translation="MLNSYWYAELEAWRRFLLDFTVNASIVLYIVSSAVLGVYAAWYIS
FT                   SFIAFIRLGPPKPARLLEKMPQSMWPKVGILIPVYNDYEVLASIKSLQGIDYPNTVVVV
FT                   VDDSDDEDLLHELSNASLRSRVKLVHYRRKGRKGLKAGALNDAIEYLLSVEHVDYVLIL
FT                   DADFEIEPGMVWKLVSLAFDHDAHVVQGYQRHRKGSDTVIGTLYRASTAGSIVNLVGRY
FT                   RDGLYPIFTGSCGLISRRVFERVRFRPGSLAEDWRLTIDSSMEIPGFKILATHEAAASG
FT                   AVPKTHRALWRQQVRWAAGTLSEFASTFLEILACKGLSRTAKLGYVLQGLYFTNGVWVY
FT                   VNTLAPLAHYLVTGSHLRMPWPIGVYLWLLGIETLLIAGAMLEGYRYKDTVITALYAIP
FT                   MIYYLALMHVAGTVKGILPGGVKWVVTSKRGEYRDLYRY"
FT   sig_peptide     complement(436342..436413)
FT                   /locus_tag="Desmu_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(436420..437574)
FT                   /locus_tag="Desmu_0446"
FT   CDS_pept        complement(436420..437574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0446"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: hbu:Hbut_1171 hypothetical
FT                   protein; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64762"
FT                   /db_xref="GOA:E8R8D6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D6"
FT                   /protein_id="ADV64762.1"
FT                   /translation="MKHWLLVLFLSILLLPCFKASATQSSILILATDTCDYEYITAVSN
FT                   AYGFKPSTAGLENFTEALRSLEWSHVILVDPNYGSSKAELAGAVAKATVDYAVSGGRVV
FT                   TTFNGFMMLYPVLQQETPLRIIVYDSPLKPGVPSSYNVSKYKALLLFGEGVEEHGGIYY
FT                   LHVGKGLIIVVPLNIAWAYCDTHDPYYLELLLKSLTAPPWEPGGSQVKYSIALPVIAVL
FT                   ASAVAVSQLSLPRTRRPQGLVVLPPARLKLEADEALAHPARREIMRALEARGAVTMSEL
FT                   LRLLNMPKATLSWHLYVLESRGIISSFKWRKSLFYFASGPTGVESLASRLSREDPYFCI
FT                   AAKSLLEDPDPVRVSEALNLPTESITRLAKLLEKEREAVLEHCG"
FT   sig_peptide     complement(437500..437574)
FT                   /locus_tag="Desmu_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(437571..438263)
FT                   /locus_tag="Desmu_0447"
FT   CDS_pept        complement(437571..438263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hbu:Hbut_1172 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64763"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D7"
FT                   /protein_id="ADV64763.1"
FT                   /translation="MLSPRITVLTLLLTALTLLPAMVVAQASSSVLLNTSWRNWTVSGQ
FT                   LQVKVIQGGSIDLSSSGVIYVKEGDTVVFNINDANGPGKMWIGSDGYLDIKRLWVDSIY
FT                   VNGMLVTTRDMVLKAGFRVDVNAISSSLSIHVQPSPSGWTYLVFNGATIINGVVDGSDI
FT                   VVAGVSASSSKALNLDLNTEYLDAVASAVYVNGSEVPEVTPLSVLALSALPVIAAGTSM
FT                   LAGRRSRA"
FT   sig_peptide     complement(438183..438263)
FT                   /locus_tag="Desmu_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            439230..439601
FT                   /pseudo
FT                   /locus_tag="Desmu_0448"
FT   gene            439721..441871
FT                   /locus_tag="Desmu_0449"
FT   CDS_pept        439721..441871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0449"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="COGs: COG3379 conserved hypothetical protein;
FT                   InterPro IPR002591; KEGG: smr:Smar_1366 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; PFAM: type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; SPTR: Type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; PFAM: Type I
FT                   phosphodiesterase / nucleotide pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64764"
FT                   /db_xref="GOA:E8R8D8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D8"
FT                   /protein_id="ADV64764.1"
FT                   /translation="MSKAWIPVLAVLIVLAFLAAPSAAQSTPPAKKVVLLSIDALRADM
FT                   VWQLLSNQTPGAPQLPGFRYIAEHGYIAKGMIVSFPSSTAVSHAVISTGAPPAVTGITG
FT                   NAMHLPGTPLTSLVSGFNGSLLLAEPLWMTADRQGLTAVVAAFPQSNPSAWEGKMRRSM
FT                   VFNPYDSSMGPPTYSTLYTSNRSVPAATYVDVSPALNWTGSLPGVSVVKAWEASFSYGD
FT                   EAWFLYIADTNGDERPDVVAVVPRVKDLGAALTVLREGEWSKPLNTTLTYKGVSYVVAP
FT                   LFKAVNLSLDNLRVYRSLTRPFESAARWFSDRQVAWRVWNEVVARVGFITDGDYYGLAN
FT                   GWFDEDTYMETVYYANTFFMEFTRWLIRNTNWDLLMTYTPIVDNVYHEFLGMTDPRMPY
FT                   YDPVKAPKYWGYILRTIQWADQFVQMILSEVDLTNTAVVVVSDHGQWPVAKLVYVNNIL
FT                   EQAGLLKRSGSTILLNETLAYYTGYNQVFINLKGREAGGIVDPADYDRVVNNVMSVLAS
FT                   TRDPDTGEPVFSVVMKKSEAASLGLWGDRVGDIVISCKPGYAPWGGILRAGSPFVNVTP
FT                   LKTITANHQDLPLYPELHAVFAAVGAGVGHGVLGLVYSTSVAPTVAALLGIEPPLNSTG
FT                   TPLPVLKPWTTTVTETQSFTATTTFTQTQTVTATVTATTTFTKPEVVTATERYVDAAST
FT                   TIIAAVALVEAAAIVLLARRGK"
FT   sig_peptide     439721..439792
FT                   /locus_tag="Desmu_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            442038..442328
FT                   /locus_tag="Desmu_0450"
FT   CDS_pept        442038..442328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0450"
FT                   /product="acylphosphatase"
FT                   /note="COGs: COG1254 Acylphosphatase; InterPro IPR001792:
FT                   IPR020456: IPR017968; KEGG: kcr:Kcr_0367 acylphosphatase;
FT                   PFAM: acylphosphatase; SPTR: Acylphosphatase; PFAM:
FT                   Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64765"
FT                   /db_xref="GOA:E8R8D9"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8D9"
FT                   /protein_id="ADV64765.1"
FT                   /translation="MPPGELVRARIRVRGLVQGVFFRATMKEVADQLGVSGWVRNLPDG
FT                   SVEAVVEGERQRVEELIKWAHRGPPAARVEAVEVEWEPYKGEFKGFKIKYY"
FT   gene            complement(442325..442873)
FT                   /pseudo
FT                   /locus_tag="Desmu_0451"
FT   gene            442959..444257
FT                   /locus_tag="Desmu_0452"
FT   CDS_pept        442959..444257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0452"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: pcl:Pcal_0427 IS605
FT                   family transposase OrfB; PFAM: transposase IS605 OrfB;
FT                   SPTR: Transposase, IS605 OrfB family; TIGRFAM: transposase,
FT                   IS605 OrfB family; PFAM: Putative transposase DNA-binding
FT                   domain; Probable transposase; TIGRFAM: transposase, IS605
FT                   OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64766"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E0"
FT                   /protein_id="ADV64766.1"
FT                   /translation="MGGEGFLTLCAVFRVSPEPVGEPLLLSLLRRYRDALNYSIKRIHG
FT                   YMEENGLKKTPGDGAVHGLLYEELKSRFGLPSRIAVDCYREAKAILKSWLGNGGDGRLP
FT                   RARRPRMWLAEKQGYRVRDGYVEVIGGLRLKIIGWDRRYDQYPNRQAVLTYRSGKFLLR
FT                   VAKKVPKPQPISPVDVLAVDVNEKYIVAGNHRVEYRFETAVERAVRYRELAERLQRKYS
FT                   NGSYRAWLRRRGIRDRVRRFHEKARSIIEDWARKVSREIALTARRDGYAVAREDLTYLV
FT                   ESLRRLPRQHRTRLVLLGYRRFEYWLDWQCEKHGVPHIAVNPKDTSSTCPRCGSRLVES
FT                   GYRRMKCPDCGFEADRDTVAVLNIRRKALARMGGSLATPTAPQMTDVPPEQMRGTSEPP
FT                   KGNPRPLGRGGGQWATVSLNEGDHVAVFPFPLY"
FT   sig_peptide     442959..443009
FT                   /locus_tag="Desmu_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(444377..445192)
FT                   /locus_tag="Desmu_0453"
FT   CDS_pept        complement(444377..445192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0453"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR003010:
FT                   IPR001110; KEGG: dka:DKAM_0721 nitrilase/cyanide hydratase
FT                   and apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; SPTR: Nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; PFAM: Carbon-nitrogen
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64767"
FT                   /db_xref="GOA:E8R8E1"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E1"
FT                   /protein_id="ADV64767.1"
FT                   /translation="MSSITIGLLQAGFDGLPLENAGKAVDMVRKGFREADLIVLPEYSM
FT                   LNPFKIGDPVKVYGYAETPVTSKYLSELSRLAEELGAFILAHFIEKTDTPPLTYSTSVL
FT                   ITDKGEAIPVYSKTHLFDAYGFRESSFFKPGKGPGRVVSVKGVKIGFTICYDLRFPELY
FT                   RLYALSGSDLILVQAGWVKGPYKEEALDKLASVRAHENTVYIALADHVGEAFVGRSGVF
FT                   NPWGLRELDLGWRETYMEHEVDASLVAEARKTLPVLEQAKAKWEIKQAG"
FT   gene            445271..445720
FT                   /locus_tag="Desmu_0454"
FT   CDS_pept        445271..445720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0607 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64768"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E2"
FT                   /protein_id="ADV64768.1"
FT                   /translation="MYILPRLIDVNAKASILREAKRILVAGRCVESEHREILEEVAGKG
FT                   GYVVLTACPEAEHVNMLGFKLAGILARGSYEEVAVLTVDGSLHCTQLHWMLEEVCKISG
FT                   KCPARRHIVIYKGKPREISVEAVKASRFLYRVDKLLGSSGGAPVD"
FT   gene            complement(445717..447681)
FT                   /locus_tag="Desmu_0455"
FT   CDS_pept        complement(445717..447681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0455"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR020817: IPR005110: IPR001453: IPR005111; KEGG:
FT                   dka:DKAM_0715 putative molybdopterin biosynthesis protein
FT                   MoeA/LysR substrate binding-domain-containing protein;
FT                   PFAM: MoeA domain protein domain I and II; molybdopterin
FT                   binding domain; MoeA domain protein domain IV; SPTR:
FT                   Molybdenum cofactor synthesis domain protein; TIGRFAM:
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   Probable molybdopterin binding domain; MoeA N-terminal
FT                   region (domain I and II); MoeA C-terminal region (domain
FT                   IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64769"
FT                   /db_xref="GOA:E8R8E3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E3"
FT                   /protein_id="ADV64769.1"
FT                   /translation="MSRKLFHTLLSISEALEAVKARIPVSPKGVEEVGLSEALGRVLAE
FT                   DVYAPIDHPPFDRSEVDGYAVRSMDVEWADELSPVELKITGVVGVGEAPATPCRPGEAV
FT                   EVATGAVVPGGCDSVVMEEYAEASGGTVRIYRSVSPGENVSTAGSDVSAGDLVLLKGTR
FT                   LSHEHIAVLSGLGVSRVRVYVKPKAAVYSTGNEVVEPGAPLPLGRVYDVNGRLTASYLR
FT                   ELGVDAVFKGLLPDDYGELKKALEDALSQYDLVVTSGGTSAGVGDLVYRVFEDLGEIVV
FT                   HGLRAKPGKPTVIAVSRGRLLIGLPGFPLSCYMILRGLVKPIVSLMTGARDMELEVEAV
FT                   LPVKLRKQVGKAWLLPVSLVEGRQGVSAYPVSLSSGSIAALIYSDGYVELPEDTDTVEA
FT                   GSRVRVRLFRPVEPSSRLNIIGSNDPLLMDILVEAGLAYSSRVLNTGSLAGWHAAARGE
FT                   ADVAPTHLLDEESMTYNRPFLKRFNLVDKAVLVRGFDRLIGIVVAKGNPKNIRSVGDFL
FT                   RGDVRIVNRVKGSGVRVYMDHLLKKILEAEGKPFKQVGRLVNGYTYEVKTHTAVALAVK
FT                   QGRADAGIASGYVAEMFDLDFIPLTWEEYDFLVPREKLAKPLVASFLEALKRRELVEKA
FT                   MRYKGYYRIPGDIGEPLPP"
FT   sig_peptide     complement(447619..447681)
FT                   /locus_tag="Desmu_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            447756..449900
FT                   /locus_tag="Desmu_0456"
FT   CDS_pept        447756..449900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0456"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG1204 Superfamily II helicase;
FT                   InterProIPR014021: IPR001650: IPR014014: IPR014001: IPR
FT                   011545; KEGG: dka:DKAM_0716 DEAD/DEAH box helicase domain
FT                   protein; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; SPTR: DEAD/DEAH box helicase
FT                   domain protein; PFAM: Helicase conserved C-terminal domain;
FT                   DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64770"
FT                   /db_xref="GOA:E8R8E4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E4"
FT                   /protein_id="ADV64770.1"
FT                   /translation="METAALRGLGLPEAYVRLLEERGIRELNPVQSEAVEKGLLGEGNM
FT                   VVSAPTASGKTLIAELALVDAWLKGGMGVYLTPLRALASEKYWEFKTLESIGVKVGVST
FT                   GDYDQPADHLGGYDILVATYERFDSILRLKPWWLPRVSVVVVDEVHMVGDPERGPIIEV
FT                   IAARLLKRGVRVIGLSATVGNPGELADWLHATLVATGWRPVKLVEGYLEKHEWRIVFPS
FT                   EGRAEAVEEDTGDPFLDIPLHNAVELGVQTLVFTHNRRRVEEYAEKAAQRLPMAPVGDA
FT                   LAKLLRELEEAPTSVERDGLSELMKRGVAFHHAGLSGVARSIVEKAFRERLIRILYATP
FT                   TLAAGVNLPARRVLVSVKRYDPARGRKVSISVSEYKQMAGRAGRPRFDEKGESIIVDAS
FT                   SSREALKYIEGSPEPVAGKLLSERSLRIHVLSLVASGEASSTREAVEALSATLSMKQSG
FT                   DPGFYAGKVEAAVKLLTELGMIEEAGGSLRASALGRITSYTYLDPLTISVYRGLKPPNP
FT                   GLDLYLLHVVSMTPDFKRGSPYIQGRVVAGLEDVALDMSGEGLIPGPGRAGVDYDDWLE
FT                   AFVHAMILYDWINEASEDEIVGKYSVGPGDLYSMRDTAAWITHALARVEGVLGDIAFYR
FT                   ALDKLSKRLEKGVREDALELASLRLIGRVRARILIEHGFKTLRDLAEAPVSSIASLPRF
FT                   GQRVAEEVERQLRELGLKQG"
FT   gene            449917..450636
FT                   /locus_tag="Desmu_0457"
FT   CDS_pept        449917..450636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0457"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COGs: COG0035 Uracil phosphoribosyltransferase;
FT                   InterPro IPR000836; KEGG: dka:DKAM_0717 probable uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: Probable uracil phosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM: uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64771"
FT                   /db_xref="GOA:E8R8E5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E5"
FT                   /protein_id="ADV64771.1"
FT                   /translation="MTPPIHSVRVMGRLILVDNPLAKYYLSILRKPATTPGLFREYMRK
FT                   LGFIIGYEVSRHLEWRRVFIESGMGRAEGVYPSRPLYIVGVLGASIPLVHGIWDAMPWA
FT                   GLGLVAARRIVGEGRVEAELYYERMPSDLSAYTTLVVDPTLASGRTMTRVVEEVEARGC
FT                   RSIIAATVVASRYGVEVFHSRFSSIPLIAVEVDPVVDKGFFIVPGIGDAGDRSLSADMV
FT                   FEPALGLGFEKPGDNGV"
FT   gene            complement(450601..451326)
FT                   /locus_tag="Desmu_0458"
FT   CDS_pept        complement(450601..451326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0458"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591; KEGG: dka:DKAM_0718
FT                   nucleotide-binding protein, mrp/nbp35 family; PFAM:
FT                   ATPase-like, ParA/MinD; SPTR: Nucleotide-binding protein,
FT                   mrp/nbp35 family; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64772"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E6"
FT                   /protein_id="ADV64772.1"
FT                   /translation="MTGDPRLHNALRNLSQAGRVYVVLSTKGGVGKTTVAVLLALHASR
FT                   RLKAGLMDADLTNPSTHILLGIDPSAVKYREEKGIEPYRINGLRYVTMAAYTGEKPLPL
FT                   RGREAGEALRELLAIVKWGPLDILLIDTPPGVGDEHLDLLYSLKNIVRPLVVATPSVLS
FT                   VRSVARLIQLLREAGYGWIGLVENMGSGVLQGEPLLQGADYLGYIPFTPGLEDCLRSRK
FT                   EACVDPALLDTVVSRLLEA"
FT   gene            complement(451323..451712)
FT                   /locus_tag="Desmu_0459"
FT   CDS_pept        complement(451323..451712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0459"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /note="COGs: COG0375 Zn finger protein HypA/HybF (possibly
FT                   regulating hydrogenase expression); InterPro IPR000688;
FT                   KEGG: dka:DKAM_0719 hydrogenase nickel incorporation
FT                   protein; PFAM: hydrogenase expression/synthesis HypA; SPTR:
FT                   Probable hydrogenase nickel incorporation protein; PFAM:
FT                   Hydrogenase expression/synthesis hypA family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64773"
FT                   /db_xref="GOA:E8R8E7"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E7"
FT                   /protein_id="ADV64773.1"
FT                   /translation="MVHEWALAESIVNYLVDQGLRRIRVLRLRLGLLQGVDKEVLLFSL
FT                   REVASMQGVEIGEVAVEDEEPVLKCNTCGYTWSMPASALSDEEREAVHFVPEAIHAFTR
FT                   CPRCGSRDFTVVKGRGVSLVEAVPG"
FT   gene            451774..453054
FT                   /locus_tag="Desmu_0460"
FT   CDS_pept        451774..453054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0460"
FT                   /product="hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /EC_number="1.1.1.34"
FT                   /note="COGs: COG1257 Hydroxymethylglutaryl-CoA reductase;
FT                   InterPro IPR002202: IPR004553; KEGG: dka:DKAM_0720
FT                   hydroxymethylglutaryl-CoA reductase, degradative; PRIAM:
FT                   Hydroxymethylglutaryl-CoA reductase (NADPH); SPTR:
FT                   Hydroxymethylglutaryl-CoA reductase, degradative; TIGRFAM:
FT                   hydroxymethylglutaryl-CoA reductase, degradative; PFAM:
FT                   Hydroxymethylglutaryl-coenzyme A reductase; TIGRFAM:
FT                   hydroxymethylglutaryl-CoA reductase, degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64774"
FT                   /db_xref="GOA:E8R8E8"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E8"
FT                   /protein_id="ADV64774.1"
FT                   /translation="MSSSRIPGFYKLPIHERRRIVGEWAGLTGEELETLGNLGNLPEKI
FT                   ADSMIENVVGGMTYPFAVATNFLINGRERLIPMVIEETSVVAAASNAARMLRHGEGIGA
FT                   NAERQEMISQIHLVKVDSPWFKAMRVIERKKEILEHAAQQDPTLLKYGGGPRDLEVRVL
FT                   EHPALGGVIVVHLVVDVRDAMGANTVNTMAEAVAPILEKITGGEARLRIVSNHAVYRVA
FT                   RAWAATPVDEVGGMDVARKIMEASILAEIDPYRAVTHNKGIMNGVIAVALATGQDHRAI
FT                   EAGAHAYAARTGVYRPLSRWEVTQDGLLAGSLEIPLQVGVVGGAVKVHPVARIALKILG
FT                   VSTARELAEVMAAVGLAQNLAALRALVTEGIQKGHMRLHARNLAIMAGATGDLIDRVAE
FT                   KMVKDGRIRYDYAKELVEKAARGEPLD"
FT   gene            453162..453527
FT                   /locus_tag="Desmu_0461"
FT   CDS_pept        453162..453527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0345 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64775"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8E9"
FT                   /protein_id="ADV64775.1"
FT                   /translation="MGGEGFLTLCAVFRVSPEPVETPRPLAQMGVSDHPDCPADDGCSP
FT                   EQMRGTSEPPKGKPPLGRGGGQMLSVRGSTPYICEPARSALQSYRWIIGDARYLAFLEC
FT                   IAHCFAPPWVSSCPGGS"
FT   sig_peptide     453162..453212
FT                   /locus_tag="Desmu_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(453524..454243)
FT                   /locus_tag="Desmu_0462"
FT   CDS_pept        complement(453524..454243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sto:ST1731 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64776"
FT                   /db_xref="GOA:E8R8F0"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F0"
FT                   /protein_id="ADV64776.1"
FT                   /translation="MYMLGGNVKKVKYIVKWYLKSGLFHPLSLALIAVIALSLHSILST
FT                   YEGDMERSMVPLLEYLLLPVYVLAAGLHMIGSPLVVVFEVNMFKDWRSLFAAKLASFTL
FT                   SLAPLAAVLLLVAYASGGDYLVGYLLLRLLTYISLFAPALLLRDQRAALLYFVAVFMLV
FT                   PIAAPIVLTNEVSARGTIDAPLALFFYFTSPLTMVRYEGHVDVSLPTACTAALFASALI
FT                   VIASAKVFEHLEYGLEH"
FT   gene            complement(454209..455066)
FT                   /locus_tag="Desmu_0463"
FT   CDS_pept        complement(454209..455066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0463"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593; KEGG:
FT                   sai:Saci_2000 ABC transporter, ATPase component; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter, ATPase component; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64777"
FT                   /db_xref="GOA:E8R8F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F1"
FT                   /protein_id="ADV64777.1"
FT                   /translation="MMLRVEKLSKRFGKTWALSEVSFAYEGARIAVLGPNGSGKTTLLT
FT                   ILAGLRYPTTGRALVNGIEPYVERERAVRAISFMFEKPRFNLGIRIRDIVKILSEDRGC
FT                   GDEAESLARLLGLTEFYDVKLAGLSSGQAQLVGIWASLACWDGVVIIDEPFAHLDIRRA
FT                   GVLANLISRRSDIIFTTHTPEEAEALADYIVILNNGRVVWAGTRDQLVARDVFEAYPLG
FT                   DKQRSLGLLEEEECRVVADLGLTVIVTGCKEEDLAGLVKRGVISGFRRAGVRYVYAGRK
FT                   REEG"
FT   gene            complement(455063..455989)
FT                   /locus_tag="Desmu_0464"
FT   CDS_pept        complement(455063..455989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slg:SLGD_01610 competence/damage-inducible
FT                   protein CinA; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64778"
FT                   /db_xref="GOA:E8R8F2"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F2"
FT                   /protein_id="ADV64778.1"
FT                   /translation="MRAGSGVYVLFSALFMAIPLILSSYPLLGFFPTYVASPHDLEPGT
FT                   RFTYYGIVTDPGFVNHSSLHIVEADVAYLGSDAYEVNLTLYELEGWMHVGIRPLREGGF
FT                   SFTAENVTVLCNARVPLSYQNSSFARLATPKAGEATVAIYGGVAYRDFKRAGFKGRGFF
FT                   SLATPEAYLGFARTYEAEVVDLSTNESLADRIGLPIFVRMGDRYLATDMILVHPAIPQT
FT                   FLNDFGSACPALKSTLEQYFKDVEEKKGGIPIPPREELFLDYVSHIPSDQAWAEAFWDN
FT                   FNVALFPVSYVFVAAGLALLILRLRKA"
FT   sig_peptide     complement(455918..455989)
FT                   /locus_tag="Desmu_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(456508..456636)
FT                   /locus_tag="Desmu_0465"
FT   CDS_pept        complement(456508..456636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64779"
FT                   /db_xref="GOA:E8R8F3"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F3"
FT                   /protein_id="ADV64779.1"
FT                   /translation="MRRTGRGFRGVAAGTVVAVIVLVAVAAYGMVRLTETASLFHR"
FT   sig_peptide     complement(456550..456636)
FT                   /locus_tag="Desmu_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(457007..459052)
FT                   /locus_tag="Desmu_0466"
FT   CDS_pept        complement(457007..459052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_3940 TPR repeat-containing protein;
FT                   SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64780"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F4"
FT                   /protein_id="ADV64780.1"
FT                   /translation="MRKALVATLILLVFLAWLAWGGGLRLLAGLAPRGPAGSTATSGTG
FT                   THATPTVTATPPSPPPSSLNGTLRVLDGEALTANLWSRMRDVNVSEVKPYMDWLLAALG
FT                   PNPAGAMRVEWREGNETLAPEVRVFDTRVGWGQPAGWGYEPPRDVKLVRMGVVRLAFGA
FT                   VLVVTAFYNGGGIDVVIHGAFANASAYLDLFERSLAIADDRYVPPGWLRNDPFYTIEHA
FT                   AGEVRKAVSGWALWRVELPASDGAVLEAGSASYRINRVLLLLEEPVAKLESRMRLSDYL
FT                   EEGNGTVSRITFDNAPFSWTPDLGFWVVVGHPAFALAVRLTHPPGHDLDDLYSYWVPRV
FT                   TLDVILGNASGRVVGLMSPMVPRYLDGYVCGGASTSTALFASSALGAFASVFLLSPMPD
FT                   PSTGLPVPHAISVLHYARYRLSIYAQAYDVDGDGAEDAITLVDTASLPKETVLEKLESV
FT                   TKFYPGIGTPTMLYTGIANATLALPAWLKAPWLDAMLTRALALRPAIVPGSWMGNIVDA
FT                   APANLAMTAGNTETARVAMEQYRWVVGDPDYLAFLDSISRRFEPPSLVRGALPAALAAA
FT                   PVVYEAPPAPRILVVEAEKKEDVQTGVDEHGRPVGYARYEADAGGLNITLHIGNWKNPS
FT                   EWAFAVYVNGELVFEHRWRPDDQVRGREFYYYVHHGGTIYYVFVNW"
FT   sig_peptide     complement(458927..459052)
FT                   /locus_tag="Desmu_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(459369..459596)
FT                   /pseudo
FT                   /locus_tag="Desmu_0467"
FT   gene            complement(459602..461194)
FT                   /locus_tag="Desmu_0468"
FT   CDS_pept        complement(459602..461194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0468"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000601: IPR017441; KEGG: dka:DKAM_0700
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64781"
FT                   /db_xref="GOA:E8R8F5"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F5"
FT                   /protein_id="ADV64781.1"
FT                   /translation="MDASLLLGYVDWVLWASSTAVIVLSVVRHASGSRDAGRWFLAGLT
FT                   GLLIAGFADAVVNALYGGDTGILGSLPYGWVFPAASLGLTLTGGLYIVSGRLEEGVWQV
FT                   LGGLLVVGLGLMALYLAGGRVGGLDRVLYVYVWSSRQGYFTGEAVNISVAVSPPVDTVE
FT                   YVVSWGDGVVEHYTGGAAVNLSHVYASSGAYTVVINASGGGLTGFNSLALSISDKPWTP
FT                   PWPFDIVVSPVAGFFNSLWQALTTPFNLQLLTTSPRLEEGSPEWGLYTAVLDASLTGLG
FT                   FFLALRLIQAAVNGDARGFIDSVKEALVAVLLSLTAPYIYNASVDILNALSMRIVQGVD
FT                   PMPSIASALTLISTGVILGFFIPAAAHLAALLTLILAATAALVAVRHWLTLSIAASTPL
FT                   LAVAYLHPGLRGAVNRVIGLWSGLVLAGPLSAVFMKTWSLQVGGLGQAVTGLLVYAMLP
FT                   NIMGLLGGGVGGAAERIGLFFYTTALKITGASKTRSQGGMVQPRPQDTGEGRVRLHTGR
FT                   GVEGYGRLRVQGN"
FT   sig_peptide     complement(461099..461194)
FT                   /locus_tag="Desmu_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            461309..461884
FT                   /locus_tag="Desmu_0469"
FT   CDS_pept        461309..461884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0469"
FT                   /product="protein of unknown function DUF996"
FT                   /note="COGs: COG2245 membrane protein; InterPro IPR010397;
FT                   KEGG: dka:DKAM_0701 protein of unknown function (DUF996);
FT                   PFAM: protein of unknown function DUF996; SPTR: Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF996)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64782"
FT                   /db_xref="GOA:E8R8F6"
FT                   /db_xref="InterPro:IPR010397"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F6"
FT                   /protein_id="ADV64782.1"
FT                   /translation="MEYETSKIVAGVGAILLAIGGFTPILALIGLILLLIGLKGLSEAY
FT                   RDDTIFTNALYAVIIEFIGLVVFIVLIGASMFSMGLGLGLGGGLHEMGAGLGFLAGLFI
FT                   GLVVLFIFLVVAAVFFRKSFDTLAAKSGEKLFGTAGLLILIGAVLTIILVGAIILLVAW
FT                   IIAAIAFFSAKPPAQEQPQAAQAPPPLP"
FT   sig_peptide     461309..461440
FT                   /locus_tag="Desmu_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(461922..463823)
FT                   /locus_tag="Desmu_0470"
FT   CDS_pept        complement(461922..463823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0470"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR002078; KEGG:
FT                   dka:DKAM_0704 putative TraG protein; SPTR: Putative TraG
FT                   protein; PFAM: Domain of unknown function DUF87; Type IV
FT                   secretion-system coupling protein DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64783"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F7"
FT                   /protein_id="ADV64783.1"
FT                   /translation="MLYHVLPRIGVELDPRVLGYRFTYCLENTGSRLRVYLETETPREA
FT                   LSRFLHVEEYDASLLHRELGSRLYVSEARLRSKRDFWLHDTVIRGLPDLASSLKAPGLM
FT                   CLGFSRSRVLESIYYSRARSLLKHAGRRDPALRAEAGAIVERAGRGVWSIRVLCAAGSR
FT                   RVLEECEERLSNASPTALKWVRGVVEDPGGLAERLKPLEPGILARLAPWGIPVACGSTV
FT                   YSMVELPDPGVHPVGFTRGSPLPDAVPVRSEGDSFRIGVTESGREVRLGIRDLERHVYV
FT                   VGQTGSGKTSLLKLLVHRLHGLGGAAIILVDPHGDMSRELAGEIPGAVFLDPVDAPYGV
FT                   NPLDLPRHRDREYAVSVAIDVLLTVFQEVLKLMSTAVNVRYLLRVILRALYAESDSPTM
FT                   ADVYEAILGLYSGRLVLGDPGDPEWRRQLEVLRSMQRQTLISALSRLEPYARDGFLRRL
FT                   TSRTTIDVGGMLSPGSLTLFSTPKAVLGEDLARLVASTVVLKIWSEVLARARLGEPRTH
FT                   VFLVIDEFQFVADLPVVDTMLSEARKYGLHLVIAHQHTGQLPGSLLQSILTNTGVKLVF
FT                   QVAGGDVEKLSMVDADFSKQLSKALTSLAAGTAVLKLSAGPGEQPPPPIMVRLDKPS"
FT   gene            complement(463840..464103)
FT                   /locus_tag="Desmu_0471"
FT   CDS_pept        complement(463840..464103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0705 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64784"
FT                   /db_xref="GOA:E8R8F8"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F8"
FT                   /protein_id="ADV64784.1"
FT                   /translation="MGLKHVALYSIPVTVTPEPPPGIGEAVSRILSWLYWLAWMAVAGA
FT                   GVYGVLKTVMGDTEEGRRLILGAVAGAVLLAFLWVIISALVS"
FT   gene            464205..465989
FT                   /locus_tag="Desmu_0472"
FT   CDS_pept        464205..465989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0472"
FT                   /product="putative TrbE protein"
FT                   /note="COGs: COG3451 Type IV secretory pathway VirB4
FT                   protein; KEGG: dka:DKAM_0706 putative TrbE protein; SPTR:
FT                   Putative TrbE protein; PFAM: Domain of unknown function
FT                   DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64785"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8F9"
FT                   /protein_id="ADV64785.1"
FT                   /translation="MQYSWWRLKGVSFFTLSDGERDAVLSEWASLLSVIGSGVVLSRRL
FT                   REEYRYRDYVFDASRYEYYALAPFNLDLSGFNAVRAEPLRPRVAGLKGASTMMLDDGRL
FT                   ARIYVVYKYPLSLPEGFTYALLTACDEVALVFKRVSRSRALSMADSVRRRRLGVLGARE
FT                   EASVELAGELASRVIEGADLYEFHLMLTVTAPSLRGLEESAGVLKNLLKSYGLEADAPP
FT                   IQLDLYGFKTRGWVAGLEKKYADTYSLKSFFPLVDEELRDEQGVFLGVSASGSPVVLDL
FT                   WSKPNLNFVILGVSGAGKSMAVKVFLKRLREMDKRITYVGVDPESEYTRIAGLLGASPV
FT                   EIVEGQELGLDPVRLLSEGVLELGQVADLLADLYAVPPRLHGALRRELFVKAEVAGDIG
FT                   GFVESLEGSLRRLLEGATAPPDVYVYTGRLPRLEGSTVFGLGKVRSKRLKALISSLISV
FT                   YAYNKLLSRTRRSVFFIDEAWLFLETPSIMGLLENIARRGRKHGSAFIYVTQRAEDLAR
FT                   TPQGRSILEQSATALILRQEPEGRDTVKAVYRLSDPEADSLVNAPPGRGLLKAGGKRLF
FT                   IQVAATREELEEFSTGGG"
FT   gene            complement(465972..466226)
FT                   /locus_tag="Desmu_0473"
FT   CDS_pept        complement(465972..466226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_2827 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64786"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G0"
FT                   /protein_id="ADV64786.1"
FT                   /translation="MRPSSLMDLLGCVMLAAVMSRRSAERARKPAECVASHAYAESIPG
FT                   ISVAVFLSLRGPMSLSSMSDASSRYMKRWSRASKLPSPR"
FT   sig_peptide     complement(466155..466226)
FT                   /locus_tag="Desmu_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            466319..467224
FT                   /locus_tag="Desmu_0474"
FT   CDS_pept        466319..467224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_2604 protein of unknown function
FT                   DUF214; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64787"
FT                   /db_xref="GOA:E8R8G1"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G1"
FT                   /protein_id="ADV64787.1"
FT                   /translation="MRRRTPGLRSILASAAILTVSAVRKGVAAWLILAVSTPIALAVAL
FT                   ETVVDAVHLYVEEFIVKPSTREALEPGLTGLACRATVSTGSAVYSVMVVAVGGGEACIG
FT                   VDAARVYGGSLNVSINGVTVRINETCSGSVYSPYIVVPSSILSGEEASHCMVFNASQPA
FT                   PTLADAEASLVAEASRVLSAIVEALVLAYAPVASVASYNVLSRLEEEYRALRATGVSSA
FT                   SLTLACLTSLFSLSLPAAVTGVSMGVLAAHASLTAMGSLSIYIPYRPLGTQAAVTPYLV
FT                   TVASLLLGATVYCARRAGQP"
FT   sig_peptide     466319..466396
FT                   /locus_tag="Desmu_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            467221..468282
FT                   /locus_tag="Desmu_0475"
FT   CDS_pept        467221..468282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0862 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64788"
FT                   /db_xref="GOA:E8R8G2"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G2"
FT                   /protein_id="ADV64788.1"
FT                   /translation="MTPGIYVRVYAATLVLALPVAAAIALMLSVTQGVLGFYGGLTRLG
FT                   SGEVAVTGYSLSPFTALVNVTMAEEALGVKASRYELFTLAEYNGVFLIVRGTPGSGGGG
FT                   SGPGLPGGCENCCIVGSEASGILGVRAGDVVLLTSPFNGRRVPVYIEGVADSEPYRYEL
FT                   ACSMGTVLLLRGAPPGYASVVYFNASSVNASRLPGLSVPGNLAGALIVVLSHAGPAARA
FT                   AAYRSVSDAYLSTLGFSSVVVSAVDIAVSTIVASSLYAVGVYAPRLIAGEVRVLRLIGV
FT                   SARRIKLSVLAVEALAASSSWLLAYLLAGRVDPGVRLLLHPVHGGVDPAAYAASLAAGI
FT                   VILTVAVAGWRVE"
FT   sig_peptide     467221..467328
FT                   /locus_tag="Desmu_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            468279..469781
FT                   /locus_tag="Desmu_0476"
FT   CDS_pept        468279..469781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shc:Shell_0861 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64789"
FT                   /db_xref="GOA:E8R8G3"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G3"
FT                   /protein_id="ADV64789.1"
FT                   /translation="MSGRSFLVFLVFTATLLIHVAPFLYTLHPFSTDVWPLIRVSERLV
FT                   SEPWVKIYDDSAFDGYNNRWPGIALASAVASLLTGLNVPFVYGILMAAALSIAMCTGFY
FT                   AVARRLGGSVLSTAAMMALPSFTVFTSAALKEVYSYPLMASAALVILAGSRLGFLTALP
FT                   LLAAAQVVTHHLSTLMTIVIFAEAGVLELVDAFTRGLRASGFYRRAIPYSLLTAAMAYT
FT                   YMEAAGSRIIAEAVDPWDMVTAALYLALYTAIYAASRGRPESPAWRGVVSGLLLTAAVA
FT                   PAVWLSWGFYSYDASSIIPYAAGFILVLSTPRRETVLSNAAAVSAAGVLSFTAFSKPGM
FT                   GSIAHRVLNYAAIYLGFTVVKETRTACVIALAGFIIASGVMAQLLLGMDQASFYWVYRD
FT                   GDSAAAGFLESFTGDTGVIGDAKLYYMEEMRLRVDTALLLRLLYTGRCPSNSIIAVSSE
FT                   NVLKGFAEASSVYRLTDTARRLLGETPVVYSSHAYSLYWCPP"
FT   sig_peptide     468279..468338
FT                   /locus_tag="Desmu_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            469778..470440
FT                   /locus_tag="Desmu_0477"
FT   CDS_pept        469778..470440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0477"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro IPR003439:
FT                   IPR003593: IPR017871; KEGG: hbu:Hbut_1410 ABC transporter;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   Predicted ABC transporter; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64790"
FT                   /db_xref="GOA:E8R8G4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G4"
FT                   /protein_id="ADV64790.1"
FT                   /translation="MRVLELRNVWKTYTGVTVLSGVNLEVEEGEAVTVKGRNGSGKTTL
FT                   CRIASLMEKPDAGSVRLHGRDAGFSSEASMARLRLLYIGYVDQQYTLIPWLTVWRNIEL
FT                   PLVILGWGREERRRRVAELLDALELKGRGGDYPYRLSAGQRQRVAIARALAKKPRLLVM
FT                   DEPFSSLDDHSSGLVVDLLKNYVAAEKASILATTTGTGPQLGSRLLVLGDGRIQGST"
FT   gene            470495..470917
FT                   /locus_tag="Desmu_0478"
FT   CDS_pept        470495..470917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0478"
FT                   /product="flagellar protein G"
FT                   /note="InterPro IPR013373; KEGG: dka:DKAM_0699 flagellar
FT                   protein G; SPTR: FlaG_arch domain containing protein,
FT                   Archaeal flagellar protein G; TIGRFAM: archaeal flagellin
FT                   N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64791"
FT                   /db_xref="GOA:E8R8G5"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G5"
FT                   /protein_id="ADV64791.1"
FT                   /translation="MTRGVRGISEVTAIIVMIMIAVVAAFGVKSYIDYQSSKLPSTDIA
FT                   VARYTVSYSAPGTGVVALVVSNLLPGGLNVTSVTIVLSNGTQVTPQMTPLTAGGRSDVY
FT                   LVLPVSLQPGVSVSKVLVGVTDLSSGRSQVVFAAGG"
FT   sig_peptide     470495..470575
FT                   /locus_tag="Desmu_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            470964..472223
FT                   /locus_tag="Desmu_0479"
FT   CDS_pept        470964..472223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0479"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG0630 Type IV secretory pathway VirB11
FT                   protein involved in flagella biosynthesis; InterPro
FT                   IPR003593: IPR001482; KEGG: dka:DKAM_0698 flagella-related
FT                   protein I; PFAM: type II secretion system protein E; SMART:
FT                   AAA ATPase; SPTR: Flagella-related protein I; PFAM: Type
FT                   II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64792"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G6"
FT                   /protein_id="ADV64792.1"
FT                   /translation="MPAEGILAEYTVGAYRVRLYVDAGVYRYEATPLLDQRIVGLVESR
FT                   LRDIVMLARRGMDLSDVIAGVLGVERTLVPEAVYAARTLLGYRVLQVLLDDPFVEDISV
FT                   TGPGPIWVRHRLAASDPRVDFIETNLKVGSLEEVAELQQLIALKCGTYVSASRPIVDAQ
FT                   LPLEDGGHRVHIVSALTAPHRPEIAVRKKPRSPPSMTRLIEEGVLPASVAEYFRMLVEK
FT                   GMSLIIAGPPGSGKTTLLRSILYSYIPLNWKIVIIEDTGEVDPPMGSAWARYTSAELGA
FT                   VKVDLFDLAKAALRSSATRLIVVGETRGAEARVLVQAMLSGMGGLTTFHGGSPEEVVAR
FT                   LTSPPISLSPQQVAMFTAVAFMGFAEKPRRVVKRVSELIPGEGGVGYVDVWVRERDGLE
FT                   AGLTDILKRSRRLGGGVAEH"
FT   gene            472210..473631
FT                   /locus_tag="Desmu_0480"
FT   CDS_pept        472210..473631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0697 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64793"
FT                   /db_xref="GOA:E8R8G7"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G7"
FT                   /protein_id="ADV64793.1"
FT                   /translation="MQSIRRVAEAALAAYREMALLVDPRVERYRRARVELATAVAALLA
FT                   SPLIIFLAAVNGLTGWVILVAGLAPVAAAWLPVVDTVASARSLRGLMDAELPFYIVAAA
FT                   SACRTGLEPLQLLEHASSSRVFKGLRELGERFSALSSLLGAGDALRNASTVAGGRTRLF
FT                   LAGYSSALSTGTVLEYMLRSAGEAVRDEWSNVSRMLERRGEMGVIAALTAAVAPALTVG
FT                   FTLLMGGAVASYILASLLAAVFAAAVLIPDYPLPFRLVVDARVARLLLALEAAGLLALA
FT                   TPLAYGFYTGGWVPRWLAASTSVVAVLLGVPGFLLAYTAAAGVRGLGRVAEDSMRHVRV
FT                   HRSLHLYDTGLLESMASKPARLWIVDYVAEVIGFHRGLGEADPDVYAVFTVFLNDSLRA
FT                   LWAYLAASTITAAAVLASPILVKALTVLAPSTGVAWLTGYVDLLATGVAASKLVFGRNI
FT                   STLIPGLLTLLYVAL"
FT   gene            473677..474042
FT                   /locus_tag="Desmu_0481"
FT   CDS_pept        473677..474042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0696 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64794"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G8"
FT                   /protein_id="ADV64794.1"
FT                   /translation="MEAATSAAASIILLVAVAPALAYLASVALREAGGVEGYAAPGNTG
FT                   VLYLLRDGSGFRLYVYVEKPPRSLMLHDSSGLAINLLEYCGSAWFKTCVATVNASLKPP
FT                   VVMYVDGVAVEGRVVTR"
FT   sig_peptide     473677..473742
FT                   /locus_tag="Desmu_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            474039..474791
FT                   /locus_tag="Desmu_0482"
FT   CDS_pept        474039..474791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0695 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64795"
FT                   /db_xref="GOA:E8R8G9"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8G9"
FT                   /protein_id="ADV64795.1"
FT                   /translation="MRGQAEVYGALVMAMLLVAGVGVYRAMVNQAYSVVNTVGSAVSSD
FT                   ALRRSENIYFSLEGAALTLRSTTSTVVRSLIVYDSSSVLYSNDTPVELAPGMEATYVLP
FT                   ADAAARLAQGSATVGVFTVNGGFTTWDPVEQALQAQGYRDVRIHVVDVPVYPSEKPLFN
FT                   YSGSGVLESITLYTYSASITVTRIIVDGIQVNTVPLVAGASGSLIPAQFSTVTLPLNAV
FT                   FKSSIQVYGYASGSGALKTIILTIALQP"
FT   sig_peptide     474039..474131
FT                   /locus_tag="Desmu_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(474788..476434)
FT                   /locus_tag="Desmu_0483"
FT   CDS_pept        complement(474788..476434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0878 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64796"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H0"
FT                   /protein_id="ADV64796.1"
FT                   /translation="MEARLDYRVRALIDASSSLKGVGVDPWSIRALLSPYDYESIVYEG
FT                   VKHPRVTVWGVGGGEWGRLNTGSAVAAAGGLLVARAGRGFRVEAGGVKHYASKVAVASA
FT                   PGAAVVAFYVNRYSSIAYSTPLASGVIEEAYRGEPAACSIGYRLATCVFRDGRSLLVAE
FT                   GRLLEVGVPVEAVALHEGKAIVESGGWLLEVDGNGFKPLVKARGVFAGLTGCSLLLNTG
FT                   GRLSVLDGASLTPLMDAVDGSASGHGDVIVVDKGVALEIHESTGVLKASIPKTPEARCW
FT                   ATPAGVLCCRRAFCGLVEPGVEAVRLEPVVNGVRAVRLESTVPVWVNGEPVGESRIIRV
FT                   DGGVLKPAVIRVEARHLLGDIVLEAVAPGVKPSVTGEAVAWVSETGHSCGGIGVLEVRV
FT                   EHGELPPGVSLYATVDGRRLRVDRVLEACIQRPVHEVVVEAVDDSGGSVEVARIPVETV
FT                   EARTPRLGYRVIEEGEGPLVLIETDAVVERALACNRNGCTPVKPVKHGDGYVVKPPGGR
FT                   LPEYIIVKLSWMGFKRLEKISLDEEQGRRRG"
FT   gene            476594..476863
FT                   /locus_tag="Desmu_0484"
FT   CDS_pept        476594..476863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0652 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64797"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H1"
FT                   /protein_id="ADV64797.1"
FT                   /translation="MGIDAHVNLRARELEELLLFKYLRLLEELKVVESRVDSSDLSEED
FT                   KARLKAILEILEEKVFNELREAREEKEGLYESTAYTYVSAGEAQ"
FT   gene            476891..478696
FT                   /locus_tag="Desmu_0485"
FT   CDS_pept        476891..478696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0485"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="COGs: COG1166 Arginine decarboxylase (spermidine
FT                   biosynthesis); InterPro IPR002985: IPR000183; KEGG:
FT                   dka:DKAM_0651 Orn/DAP/Arg decarboxylase 2; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; SPTR: Arginine decarboxylase;
FT                   PFAM: Pyridoxal-dependent decarboxylase, C-terminal sheet
FT                   domain; Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; TIGRFAM: arginine decarboxylase,
FT                   biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64798"
FT                   /db_xref="GOA:E8R8H2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H2"
FT                   /protein_id="ADV64798.1"
FT                   /translation="MLNTITLVWVYDREMSSSEWSLDVARELWGLNHSIRGDTITVDDE
FT                   GYLAISIGGSSVRIKDVMEKYGFDVAYIRVLPLIGKAMRLVYETFTELARIHGFKGGLQ
FT                   PVFPMKVNPIDIVIDAIWRYGEKYGWGFNTGSIGELELLSKYAGKGPRILVYDGVLSDN
FT                   VARILEGFREKGWRVVVDVESEHDLDILSKHPELEVGLRIKPLFKPGGKWAHSAGLEGK
FT                   FGLTVNTLVKLREEYKWIEERARLLHVHAGSQIYKWSDVEAFINEVYNIYVQLTANGFS
FT                   RLELVDPGGGLAYPYLDTRSGSIESPDYTVVDYFNHMLRVFSRLDKHPVLVYEGGRYIV
FT                   AAHRIVVAKVVDVRPYSAEQLSSTGTSVVEDVLRGVRTIRDLKAVLKEYRRLIHRGSQG
FT                   QQYTLEERELAEDLVSKIREEVVLKLSELLRAEPSSVDEVINDPFLYKLATSPSKRYIL
FT                   NLSIFADIPDSVLVNQYFQVAPVQRLNEKPDVVAVLGDLTCDSMGEIGEYVSHVRMHVK
FT                   ADDWFTRMDLRLVMAPYKRLKLGGVPLHLPVKGENYYVAILDTGAYQDPLTMKHNLIYG
FT                   APEIIMDEVDGEPKIEVVERNGKYL"
FT   gene            complement(478693..480276)
FT                   /locus_tag="Desmu_0486"
FT   CDS_pept        complement(478693..480276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0486"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1031 Fe-S oxidoreductase; InterPro
FT                   IPR006638: IPR007197; KEGG: dka:DKAM_0650 radical SAM
FT                   domain protein; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: Radical SAM domain
FT                   protein; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64799"
FT                   /db_xref="GOA:E8R8H3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H3"
FT                   /protein_id="ADV64799.1"
FT                   /translation="MLEKIVILDGYTDEPAGLGVPPYINTYPRLIAGAVWNRVRDAEIR
FT                   YWTIDEARRSLGAFIEEARKSSLLVVVSGVEVPGRYLGGRPLSLRELETILLLTRGVDK
FT                   ILVGPAARYGFASGGGSIAVESKRLKNLFTEIVTGDPEVYMDELVQHGFEKARPWLLRE
FT                   SYELADKAFKLGARIVLQHPNYGRNLIVEVETYRGCSRWLTGGCSFCIEPRYGRPIMRG
FT                   LKGIVEEAEALYSLGVRHIRLGRQPDILAYMSEDTGREEFPRPNPEALEKLFHGIRSVA
FT                   PGLVTLHIDNVNPGTIVSHVDESVKALKTIVKYHTPGDVAALGIESFDEKVVKANNLKV
FT                   GPEEALEAIRIVNRVGGLRGWNGMPHLLPGVNLIYGLPGESRETYRVNLEYLTRIMKEG
FT                   LMVRRLNIRRVAVLENTPLWLKRSEVEYLLRKHEGLYRLHRVKVMRLFDKAMLKRILPP
FT                   GTLLYGLIAEKHVAGYTMARFPGSYPVAVKVKGLIPVWSTITARVKGYSAKSVVGEAVA
FT                   VQPCPSSMGG"
FT   gene            complement(480239..481411)
FT                   /locus_tag="Desmu_0487"
FT   CDS_pept        complement(480239..481411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0487"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="COGs: COG0409 Hydrogenase maturation factor;
FT                   InterPro IPR002780; KEGG: dka:DKAM_0649 hydrogenase
FT                   formation HypD protein; PFAM: hydrogenase formation HypD
FT                   protein; SPTR: Hydrogenase formation HypD protein; TIGRFAM:
FT                   hydrogenase expression/formation protein HypD; PFAM:
FT                   Hydrogenase formation hypA family; TIGRFAM: hydrogenase
FT                   expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64800"
FT                   /db_xref="GOA:E8R8H4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H4"
FT                   /protein_id="ADV64800.1"
FT                   /translation="MSMQLRERGLAVKLAERIREESKRVLSEHGGDEIRIMNFCGTHEW
FT                   TITHYGLRSLMPPWINLIAGPGCPVCITPGYYIDVLVDVSFEKDTVVLTYGDAFKLPGS
FT                   RGKQPRSLFHAKAMGGNVKVVYSFRDAITEAAREPGRRHVFLAVGFETTMPSTAIPLAA
FT                   GEVPGNLYVLSAYRLTPPIMRFLAEAHPEVRLDGVIAPGHVSTVIGAEAWRFIADEYGI
FT                   PVVVSGFEPLDVLLSIYMIIRNLAEGKPRLMNEYSRVVAPEGNKYALNAMWEVYEARDS
FT                   YWRGIGVVPLSGAVHRPRYSGHDFFESTGLRETVTDDKHPGCICDKVVLGLAKPTQCPL
FT                   FMKACTPGNPYGPCMVSSEGTCRIWAENTPLLHGAVAWNAGENSDPRRVH"
FT   gene            complement(481419..482042)
FT                   /locus_tag="Desmu_0488"
FT   CDS_pept        complement(481419..482042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0488"
FT                   /product="molybdenum cofactor cytidylyltransferase"
FT                   /note="COGs: COG2068 Uncharacterized MobA-related protein;
FT                   KEGG: dka:DKAM_0648 nucleotidyl transferase; SPTR:
FT                   Nucleotidyl transferase; PFAM: Uncharacterized protein
FT                   family UPF0007"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64801"
FT                   /db_xref="GOA:E8R8H5"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H5"
FT                   /protein_id="ADV64801.1"
FT                   /translation="MIACIVPAAGFSTRFPWNKMLYTLDKPLVVQTLENISASTYVSRV
FT                   ILVTGHESSRVSRVVEEHASSRLKERLRVVYNPDYAAGMSSSVRKGLESIRDEARSLKG
FT                   IMVNPGDAAWIHPGVYDYVALRFLESGKKIAVASYRGRRGHPIIFSSDLYAELTAIDEE
FT                   TQGLKAVVRRHLDDTLLVETGYPGVLLDLDTVLDLNRVKEYSWR"
FT   gene            complement(482068..482721)
FT                   /locus_tag="Desmu_0489"
FT   CDS_pept        complement(482068..482721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0489"
FT                   /product="putative phosphate transport regulator"
FT                   /note="COGs: COG1392 Phosphate transport regulator (distant
FT                   homolog of PhoU); InterPro IPR018445; KEGG: dka:DKAM_0647
FT                   phosphate transport regulator-like protein; PFAM: Putitive
FT                   phosphate transport regulator; SPTR: Phosphate transport
FT                   regulator-like protein; PFAM: Protein of unknown function
FT                   DUF47; TIGRFAM: conserved hypothetical protein TIGR00153"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64802"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H6"
FT                   /protein_id="ADV64802.1"
FT                   /translation="MSLPRGRYFESMFSSIREHARTVEIGVSKLSELVSSIQGGVETVS
FT                   RLYGELNRVEEHGDELKRSIMEELKATYLHPDDRENLLRFVLSLDDALGYAKSAGKRIL
FT                   IAVESGIVIDEKIQALMKEMTEKSLTASRKIIELFESMSRDPARALSISHEVEELEEKI
FT                   DELRLEAIAMIYSACSREVKPECLVLPQIVDDIEGISDVFEDIADIYRLFAVSR"
FT   gene            482960..483379
FT                   /locus_tag="Desmu_0490"
FT   CDS_pept        482960..483379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0490"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="KEGG: dka:DKAM_0646 transcriptional regulator, TrmB;
FT                   SPTR: Transcriptional regulator, TrmB; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64803"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H7"
FT                   /protein_id="ADV64803.1"
FT                   /translation="MSSPEYESIYDIRFLMKRGIVLTLPLLKTLDAVITLKKVTADDVA
FT                   KYTGRARTIESRYLSRLNKIGIVAKVKEGRRVYYIEPVEAVREAIQKYGDNMMVEQLAH
FT                   QISLPADIVKLIIDLMKSGKIPPPQPAGGQQGQAT"
FT   sig_peptide     482960..483082
FT                   /locus_tag="Desmu_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(483372..483674)
FT                   /locus_tag="Desmu_0491"
FT   CDS_pept        complement(483372..483674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0645 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64804"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H8"
FT                   /protein_id="ADV64804.1"
FT                   /translation="MITTKARSDFSDSIIVNDNIIEISLKPRKRMISLRVSEDDLEIID
FT                   KFAARNGSVSRTYLLTKLVEAVAEGLRRSNGNVSSIVISFKGGSSETVSIQLNIK"
FT   gene            484068..484352
FT                   /locus_tag="Desmu_0492"
FT   CDS_pept        484068..484352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0492"
FT                   /product="protein of unknown function DUF211"
FT                   /note="COGs: COG1888 conserved hypothetical protein;
FT                   InterPro IPR003831; KEGG: dka:DKAM_0644 protein of unknown
FT                   function DUF211; PFAM: protein of unknown function DUF211;
FT                   SPTR: Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ArCR, COG1888"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64805"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8H9"
FT                   /protein_id="ADV64805.1"
FT                   /translation="MLKRIILDVLYPVRGTSIVDLAKSIVEITGVSSVSITVKEVDVDT
FT                   QNILVMVEGSDISFEDVRDAIEKEGGVIHSIDQVVAGERIIEPPEYLVE"
FT   gene            484358..485128
FT                   /locus_tag="Desmu_0493"
FT   CDS_pept        484358..485128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0493"
FT                   /product="Mn2+-dependent serine/threonine protein kinase"
FT                   /note="KEGG: dka:DKAM_0643 Mn2+-dependent serine/threonine
FT                   protein kinase; SPTR: Mn2+-dependent serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64806"
FT                   /db_xref="GOA:E8R8I0"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I0"
FT                   /protein_id="ADV64806.1"
FT                   /translation="MNTNILELLDGFSKQSRILVVDSEKLVLKEYGGEAGLIKWLVVNL
FT                   SSTPVKMYPFVFNPRSRMEREVSFLRTDTPGFMKPGLRVVDYIGVRIIRDYVEGEEVDS
FT                   STSPQVFRVLGRSLGMLHCSGWALGDTKVSNFVSNDGWVYIVDAEQAVETWRKEHFSWD
FT                   LVVFASTLGISCYSSCVTNQRAYLERIEAFLQGYLENPCAPVREAVYSLTEGDSRLLLF
FT                   LLVPFPLNMGVSKLLKEMQGLTHRDESIPTWSPR"
FT   gene            complement(485268..486347)
FT                   /locus_tag="Desmu_0494"
FT   CDS_pept        complement(485268..486347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0494"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3842 ABC-type spermidine/putrescine
FT                   transport systems ATPase components; InterPro IPR003439:
FT                   IPR003593: IPR017871: IPR013611; KEGG: dka:DKAM_0641 ABC
FT                   transporter related; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; SMART:
FT                   AAA ATPase; SPTR: ABC transporter related; PFAM: ABC
FT                   transporter; TOBE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64807"
FT                   /db_xref="GOA:E8R8I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I1"
FT                   /protein_id="ADV64807.1"
FT                   /translation="MTRVRLEGVSKYYGAVVAAEDVNIEIQSGEFFTLLGPSGCGKTTT
FT                   LRIIAGFETPDKGRVYFDDEDVTFVKPYKRNTSMVFQNYALWPHMTVYENVAYGLKLRK
FT                   KELGLTDEDIRKMVKEALELVKLSGMENRYPLQLSGGQQQRVALARALVVKPRVLLLDE
FT                   PLSNLDAKLRIEMREELRKLQRSLNLTTIYVIHDQVEAMSLSDRIAVMNKGRVVQVGSP
FT                   KELYFKPRSLFVADFLGRSSIYPGELVSQSGEYAEARLADADIIVRGVTPVEKLPRKVS
FT                   VVIRPEIIRLGGGRAEEGDTVVKGVVDFAMFLGEKVEARVKIGNLPLLVYLPNTVDVST
FT                   GNEVELTLPWRNIIILPSD"
FT   gene            complement(486369..488609)
FT                   /locus_tag="Desmu_0495"
FT   CDS_pept        complement(486369..488609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0495"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1178 ABC-type Fe3+ transport system
FT                   permease component; InterPro IPR000515; KEGG: dka:DKAM_0640
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64808"
FT                   /db_xref="GOA:E8R8I2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I2"
FT                   /protein_id="ADV64808.1"
FT                   /translation="MSRGSILLLAVSIVFLTASLIGDALLDTGSSKLVNYALMLAGLAA
FT                   GALMVARGLYNYESVKYSFTMSFLALVFLIYIFVILLIDAYGYPQSFAVLLTPYTGVAV
FT                   AGYLRGKIAEAREKARIRGEGVPLTRRIRNTVSQLDATMWFFTVFGLAYLTLFMVVPIV
FT                   LVLMYSFTPPAGGEWWSNFYSVLRTRSYVNLDPIVKDWWRMIEIPGVGKILVVRGVDYG
FT                   PVVNSLVVASIVTVFATLLGIIVAFVLARYRFPGHTLLRILAIVPLFNTPFINSYVVKL
FT                   IWGQDGPVSSLFNTFFGFKLRVEGIVGVMLAQIVTFFPIVYLNAYNSFINIDPSTEEQA
FT                   ENLGAKGFRLFRTVTLPLALPGIAAGSILVFVFSLEDLGAPIVFNVQSLMSYKIYMGIR
FT                   TTTGLISPEVAALGVVLLLLTLVSFLAIRNYVGMRSYAMISRGGRLNPRVRRPGLLGMI
FT                   AVYLAVFPVVLFAMLPQVGVVLVSLGVLKPYPGATGIELSMPSDIFQYIGKVLSDPSIY
FT                   RYLVNTLLYAGVSVLIAVFLATAVGYSVSRLKIKWLANILDSLSTSPLAIPGLVLALGY
FT                   YYFFYILANALSQLVPGAVTYLLPGSLSFATWLVFIIAFSVRRLPYVVRSVFAGFQQVH
FT                   ENLEEAAMNLGASRMRVVFGVILPFIIGYILSGALLGFIYMATEVSTSITFGGMNDAYA
FT                   PLTYYMAQNIAGAAGQGPMLVAAMGTILILIQLVVVVIVVYVFKQRYAFIGV"
FT   sig_peptide     complement(488517..488609)
FT                   /locus_tag="Desmu_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(488688..490310)
FT                   /locus_tag="Desmu_0496"
FT   CDS_pept        complement(488688..490310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0496"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1840 ABC-type Fe3+ transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   dka:DKAM_0639 extracellular solute-binding protein, family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: Extracellular solute-binding protein, family 1; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64809"
FT                   /db_xref="GOA:E8R8I3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I3"
FT                   /protein_id="ADV64809.1"
FT                   /translation="MNRALTTTQALILVLALIVAAIGALVIIRLLPPPQTTTTTTQPAT
FT                   TTTTTTTTTTQPATTTTTTTGKPTYAEYPWLDQLKQLTSERGVKLIVITRHEQSILTAT
FT                   RNAFLNSPVARELGITDIQFVAAPAELWTSYIDNAAKAGTPIDVAWGGGPTLFNNLDAA
FT                   GYLLPVDPSKPEFNAVMYELNKIPKTIGGAETFKVDGNGLIHWIGASVSSFGFTVNLVR
FT                   LNQYGLPMPQKWEDLASPQYARYLPDIPQIATADPTMSTSNTRIFEIILQAKGWEEGWR
FT                   ILTLLAANAVIYQGSSDARDAVIRGDVAVGTTIDFYGYMAQQVNPNCKYIAPQGETIVN
FT                   SDPIALVKTTKHLVHAVAFMAWVLNEYGGQQIWLLQDINRLPVNPKVFETQAGQSRQDL
FT                   KQALQDAMYSQSIPFNETLSASWVNAVIYYFKATLVNPHDDLKATWARIAQAYLDGKIS
FT                   REWFTYLTKYISKPLSFKDPVTGSTVSFTVDYAISINQKMMSDASVYQALMSQWESLAR
FT                   ERYLNALNLLQDALAGKPVPSGP"
FT   sig_peptide     complement(490188..490310)
FT                   /locus_tag="Desmu_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(490551..492500)
FT                   /locus_tag="Desmu_0497"
FT   CDS_pept        complement(490551..492500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0497"
FT                   /product="Protein of unknown function DUF2223"
FT                   /note="COGs: COG4945 Membrane-anchored protein predicted to
FT                   be involved in regulation of amylopullulanase; InterPro
FT                   IPR019248; KEGG: dka:DKAM_0638 membrane-anchored protein
FT                   predicted to be involved in regulation of
FT                   amylopullulanase-like protein; PFAM: Protein of unknown
FT                   function DUF2223; SPTR: Membrane-anchored protein predicted
FT                   to be involved in regulation of amylopullulanase-like
FT                   protein; PFAM: Domain of unknown function (DUF2223)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64810"
FT                   /db_xref="GOA:E8R8I4"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I4"
FT                   /protein_id="ADV64810.1"
FT                   /translation="MHRILVSLLIISLLLLPGIAILPRAETQQPLKTVTVAVDLAHGES
FT                   DKYLNYIMGNLTFVNWKIIPKGSTINSDVLKDVDILLIGQPTVAFTPDELDAISKWLDT
FT                   GRKALYVAGDSDYGGGPTTIDNVNKLLEYIGAKLRLEQAAAYSDPSMNYTYKGVTYPTC
FT                   TAAYYRMLAFVEPDNIPGLSTWMLDQGVTKPILMHGPGVVIWVDENGNYRDPVKDTFPG
FT                   LIRIAWFHKAYIGDNKPPAPYVYNPVTYGQGAGWFDFVAYAAEYWSSKNVVITVASESL
FT                   YGDYEPAWASSYYNVSLDGPRFVENLLKWWIKLVVQPSYMADKVLEVNDPSGDDKGQGT
FT                   LRYPTNPVFKPGVFDMLKFTVLQDKEYIYLQIQVKDLGGNPWGGPNGFCLQHIQVYIKT
FT                   TDNTLPVNTSTMGLYVNLAPGWNYALAAVPGWGNTPFPDGEVSALFKADGSLIADEYNN
FT                   GTLFDVYAFTNANIIEVKIAKSLLGDTGNIGNWIWYVFLTSYDGFGEKKIRGIQAGDPG
FT                   EWALGGGDPQALLANVQPKVVDLLAPSEQEQYTMLSSYDTAAGKPATVYGVKGGSIYYP
FT                   PVTVTTTITTTVTTTQTYVSTTTETVTTTQVSTTTLTSTTTSISTQLDVTTTGIIAVIT
FT                   LVIGIAVGMLFKKK"
FT   sig_peptide     complement(492426..492500)
FT                   /locus_tag="Desmu_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(492590..494830)
FT                   /locus_tag="Desmu_0498"
FT   CDS_pept        complement(492590..494830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0498"
FT                   /product="metallophosphoesterase"
FT                   /note="COGs: COG3889 solute binding protein; InterPro
FT                   IPR003529: IPR004843; KEGG: dka:DKAM_0637
FT                   metallophosphoesterase; PFAM: metallophosphoesterase; SPTR:
FT                   Metallophosphoesterase; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64811"
FT                   /db_xref="GOA:E8R8I5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I5"
FT                   /protein_id="ADV64811.1"
FT                   /translation="MRITSLLLLILLLSGSIHVAIHVATGETPPAIPSITSGVAEIITA
FT                   NIGPVAPAIVSPGDTYTIELRPQYSSLPVDSAYMWTVKPVGDQLVVFNYTLTLTTQGSG
FT                   RYSLSIPSTAEEGLYDLVLKAGSTSYTVPRSIWVVKSWPTVLRFIENTDIHFITGQPDV
FT                   FTGDTCRFAGFTIDNLLSPHFILWLGDTADTASSNEYVMASAYRYAYLYNIPVLGIAGN
FT                   HDYSSGGSYYTNYLGPTKWFRVLAGKLLIIGIWSPEQGYPSWEDLAFAEEVLKNYSSIP
FT                   YKMILVHHPPFYYQGELYTRYDDETVLKPYVPGGPSTPLSSYWSTNMTAFRYFLKMVED
FT                   YNVTMVLSGHTHRDFFVKYTSTRTGTTTLFLTFTTLAHGSASYDGLSLMELDLSTGSLS
FT                   FPLAPPTFTGFKNSTRALALNSIPIGVYPVANSLGWSNLTFTYMNAIYSTGGYSFRLEN
FT                   NNLSWINFSGRLVWSLPWSTSSFNYTVQWAFNGASIRIIDYKIIEGRLYLLIELNLPYQ
FT                   AGISFTIYGAPDAKPPTAILKKIVPSTPRVNATATIYVDLSDEGWGISPYNLSVRLGDR
FT                   VITRSPIPGDNTFTMTPSTYTEQFNRMSLVITVRVESATTVTLPLTIQVADNAGNTGSY
FT                   VFNITFQAATTTTQPATTTTTTTTTTQPATTTTTTTQPVTTTTTQQTTTTTTTTTTTTT
FT                   TTTTTTTTTTSPATTTETGVAQASGSTLVIAVVAVVVVAVVAFLLLRSLRGG"
FT   sig_peptide     complement(494753..494830)
FT                   /locus_tag="Desmu_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            494904..495338
FT                   /locus_tag="Desmu_0499"
FT   CDS_pept        494904..495338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0499"
FT                   /product="Resolvase, Holliday junction-type"
FT                   /note="COGs: COG1591 Holliday junction resolvase; InterPro
FT                   IPR014428: IPR002732; KEGG: dka:DKAM_0635 holliday junction
FT                   resolvase; PFAM: Resolvase, Holliday junction-type; SPTR:
FT                   Holliday junction resolvase; PFAM: Archaeal holliday
FT                   junction resolvase (hjc)"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64812"
FT                   /db_xref="GOA:E8R8I6"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I6"
FT                   /protein_id="ADV64812.1"
FT                   /translation="MTNRSRGFQHERDLARRLWEHGFAVVRAPASGSRARVLRYPDIVA
FT                   IYRGRVIALEVKTLREEKPVYVRREQVEKLAEFSRRAGAMPFIAVKYVGEGEWFLVPLD
FT                   RLVEAGEGNYKIPVEAVREGLRLKALVSQVKGDKSILDYT"
FT   gene            complement(495351..496919)
FT                   /locus_tag="Desmu_0500"
FT   CDS_pept        complement(495351..496919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0500"
FT                   /product="ATPase, PilT family"
FT                   /note="COGs: COG1855 ATPase (PilT family); InterPro
FT                   IPR006596: IPR003593; KEGG: dka:DKAM_0634 ATPase; SMART:
FT                   Nucleotide binding protein PINc; AAA ATPase; SPTR: PilT
FT                   protein domain protein; PFAM: Type II/IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64813"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I7"
FT                   /protein_id="ADV64813.1"
FT                   /translation="MGFRIAGETVYIPDLSALTQGAVSRLISEGRVVGKVVIHRSLIQI
FT                   LEYHASKGRVIGYTGLEEVKRLREHSDSGTIGLEITGERLKGPITDEEQVVNEVNAVVR
FT                   EYAYSVNGVLITGSELQYQVAKAMGVQVILVRDREQGRLGFERFFTENTMSIHLKEGVA
FT                   PVAKVGRPGEWRFTRLGDKPLTRQEIEEMANEIIEATRSRSDAFIEIDRAGSTIVQLGS
FT                   YRIVITRPPLSDGWEITAVRPLKKLRLEDYNLPEELVKRLNERAEGILIAGAPGMGKTT
FT                   FAQALAEYYMRMNKVVKTVESPRDMMLPPDITQYSKHYADIGELHDILLLSRPDYTVFD
FT                   EMRTDEDFKLFADLRLAGIGMIGVVHATSPIDAVQRFIGRVELGMIPSIIDTVIFIRNG
FT                   QVDKVYEVKMTVKLPTGLREAELSRPVVEVRDFLTGELEYEIYTFGEQTVVVPVKKLKG
FT                   KHPTHEKVIEELGKLMPEADIRFENDAIVVSITRSDLRKYNKKIKRLRKIEEKYNLPIR
FT                   VRIEE"
FT   gene            497084..498598
FT                   /locus_tag="Desmu_0501"
FT   CDS_pept        497084..498598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0501"
FT                   /product="metallophosphoesterase, calcineurin superfamily"
FT                   /note="KEGG: dka:DKAM_0633 metallophosphoesterase,
FT                   calcineurin superfamily; SPTR: Metallophosphoesterase,
FT                   calcineurin superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64814"
FT                   /db_xref="GOA:E8R8I8"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I8"
FT                   /protein_id="ADV64814.1"
FT                   /translation="MTRDSSLLVITLLLLVLPSLMPPPGVSAQTPLSLYEKTRRVIPGN
FT                   LPWYPLIIIGDNRPSDVNAVDPPGVFYQAVNEAENALPLAFIGLGDHVGLGTLDQYVKL
FT                   YEILNKTRLENIWMTPGNHDVAYSGVNGTGFDFWRQFIGPDSMVVDDIPGWRIALIDSE
FT                   TDISTWGQQIQAAYNSTGGRMLLLGFHRPLYPNVNHNLKQGYDTVLLGYMNSNGWPALV
FT                   LQAHFHAWVSYRYNGTEFLIVGGTGAPLYSCTDVSAPGAVCSSTFHYLVLTLYPNGTYT
FT                   YTPVKLGEGSGTLRVIPLNSTAYLVANSKIDVYGNPVEYPVRLRFKAQGLDVYVVARIP
FT                   ASSGVVFALDPATGRLLVSQGVDYYVYIASSNGSIVVNGGSRELDLSQYLQGRSVSVET
FT                   PVEVVKAETVTSTSIAYITRTATKTITSTYSTTLTETSVTTVTETQQLPPTTITVQRNV
FT                   TSTYTTTVPLIVEHEAPGGDAYLYIAAVLGVIAVAELAVIIFVKKK"
FT   sig_peptide     497084..497167
FT                   /locus_tag="Desmu_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(498600..499931)
FT                   /locus_tag="Desmu_0502"
FT   CDS_pept        complement(498600..499931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0502"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2403 GTPase; KEGG: dka:DKAM_0632
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64815"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8I9"
FT                   /protein_id="ADV64815.1"
FT                   /translation="MPRKVVILGASGRDFHNFNMFYRDNPEYRVVAFLQTQIPGISGRR
FT                   YPPSLAGSLYPDGIPILSMDYLEEVVRVHGVEEAVLAYSDLTYSELGSVLSRAVSLGLS
FT                   FRIHGPADTMLESIRPVIAVTGVKTGAGKSMVSREVALELRRRGLKTGVVRHPMPYGDL
FT                   EKSAVQSFHSFEDLDKYNATVEEREEYEHYLKLGFPVYAGVDYGRILRLLESENDVILW
FT                   DGGNNDWPFYKPDFMITVADAMRPGIEASSFPGEVNLRMCDAVIINKVDQAKPGAVDRI
FT                   KESILARNPDAHVSLGESVVTVDNPKVIEGKKVLVIEDSPTVTHGGAPYAAGYVAALKH
FT                   GAQPVDPRGFATGFFKKMYEEYPHMGPILPSTGYRPEQLRELEETIRRAPVDAVVLGTP
FT                   SDITKLIKVDKPVARVEFRLRIVEGPSIKEYVDMFLEKARKKAL"
FT   gene            complement(500086..502599)
FT                   /locus_tag="Desmu_0503"
FT   CDS_pept        complement(500086..502599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0503"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="COGs: COG0574 Phosphoenolpyruvate synthase/pyruvate
FT                   phosphate dikinase; InterProIPR018274: IPR000121:
FT                   IPR006319: IPR002192: IPR 008279; KEGG: dka:DKAM_0631
FT                   phosphoenolpyruvate synthase; PFAM: pyruvate phosphate
FT                   dikinase PEP/pyruvate-binding; PEP-utilising protein mobile
FT                   region; PEP-utilizing protein; SPTR: Phosphoenolpyruvate
FT                   synthase; TIGRFAM: phosphoenolpyruvate synthase; PFAM:
FT                   PEP-utilising enzyme, mobile domain; PEP-utilising enzyme,
FT                   TIM barrel domain; Pyruvate phosphate dikinase,
FT                   PEP/pyruvate binding domain; TIGRFAM: phosphoenolpyruvate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64816"
FT                   /db_xref="GOA:E8R8J0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J0"
FT                   /protein_id="ADV64816.1"
FT                   /translation="MSKESRFVLWLEEVRKDDVPLVGGKNANLGEMINAGIPVPPGFAV
FT                   TAYAFKYFLEKTGLGEKIYGMLRKLDVNNTKELEETTARIREMIMNQPMPKEVEDEIKK
FT                   YYLELAGKLGLDPGKLRVAVRSSATAEDLPEASFAGQQDTYLNVYGADNVVYYVKRCWA
FT                   SLFTARATFYRVAQGIPHERTFMSVTVQKMVNSKSAGVMFTLHPVTGDENVVVIEGSWG
FT                   LGESVVGGKVTPDEFIVDKKTLSIVERHLNKKTFMITFDPALGRNVHLKWDEQKGRWVS
FT                   EEGEGVNPPLTQIAHPDKPALSDDEVKRLAELALLIQKHYGKHMDIEWAIDSDLPFPSN
FT                   VFIVQARPETVWSTKKAKEAEKKPTEVKGKTVKLGEAKVLVKGLPASPGVGAGVARVIF
FT                   DPKSKEAMEFKEGDILVTKMTDPDWVPLMKKARAIVTDEGGMTSHAAIVSRELGIPAVV
FT                   GTGSATQVIKTGIEVTVDGGRGVIYEGIVEDLVKPKTEAPQVAGAVASVGISPEQLLPL
FT                   YPVTATKIYMNLGEPDAIEKYKDLPFDGIGLMRIEFIFTDWVQYHPLYLIEIGKPEIVV
FT                   NKLAEGIAKVAQAIYPRPVVVRFSDFKTNEYRGLKGGEKYEPDERNPMIGWRGVSRYIH
FT                   PKYEPAFRLEVRAIRKVREEMGLTNVWVMFPFVRTTWELEKAIKIMEEEGLKRSKDFKV
FT                   WAMAEVPSIALLADEFAKYVDGFSIGSNDLTQLVLGADRDSNILAEMGYFDERDPAVLQ
FT                   AIRMIIEKAHSRGATVSICGQAPSVYPEIVEFLVKYGIDSISVNPDAVISTRRLVASIE
FT                   RKIMLDAVRNARHIRESTRLFDTVG"
FT   gene            complement(502711..504219)
FT                   /locus_tag="Desmu_0504"
FT   CDS_pept        complement(502711..504219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0504"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="COGs: COG0439 Biotin carboxylase; InterProIPR011761:
FT                   IPR011764: IPR005481: IPR005479: IPR 005482; KEGG:
FT                   dka:DKAM_0630 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; SPTR:
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64817"
FT                   /db_xref="GOA:E8R8J1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J1"
FT                   /protein_id="ADV64817.1"
FT                   /translation="MPRRIMVAGRGEAAVRIARTLVEKGYHPLGIYTEKDEASPHRRYM
FT                   LEEAKVSSYMDVKEIVEAALELGAEAVHPCYGFLENNPEFHREVARRGLVPIGPPPSLI
FT                   EFTRDKPAVKTLAEKLDVPTLPWSIVDDDADLEEFARAHGYPLVLKPARGAWGRGIRVL
FT                   WSEKDAEQLKTAVKEAEKLYGDRRIYVEPYMGSAKLLEVQVIGDGEKVIHLYEREASLQ
FT                   DDYLKTVIEAPSKTVSKELRDKLVGYAVAVGEALRLRNTATVEFLYDVRSRTLFLNEVN
FT                   PGLSPEHVATEAVTGVDIVEKQVEAALYSALDLRQENISLNGWAFEAKVFNKKPFKGEP
FT                   SSGVVKSYNEPAGLGVAVDSGVAAGLKLSEEYVLLAKVLAWGGSRATALGRLRRALSEM
FT                   SIDGVQTNIPVLRELLALREIEEGVYTVRLLEEKRGELESKLREKMLLHSIVAVSLIEH
FT                   GDRDARKTLMQGKLTPEAVAEESARVKRSAWFYYARLRERLRRR"
FT   gene            complement(504241..504906)
FT                   /locus_tag="Desmu_0505"
FT   CDS_pept        complement(504241..504906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0534 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64818"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J2"
FT                   /protein_id="ADV64818.1"
FT                   /translation="MRNGEILEVGNEHTVELSRLHKALRCIEDALDETGVSDLRAEIAG
FT                   GRLIVENTAGLREILSDWDCGYPVEYGDPVGSYRRLYNRSLDLYVKGLRPYLRQWIHET
FT                   FNNGFEYYGIVGETGEAYVLRSMQRGKVVLPRLRHVFAAHTHPEEHANPSPRDLSTILE
FT                   ELSIGVLGHCVESLIDGLCIIRVKPVGLDEYIEALKALRKGEWAFFSKAGFIRLARVM"
FT   gene            complement(504903..506135)
FT                   /locus_tag="Desmu_0506"
FT   CDS_pept        complement(504903..506135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0506"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR010182: IPR002933:
FT                   IPR011650; KEGG: dka:DKAM_0629 succinyl-diaminopimelate
FT                   desuccinylase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein; SPTR: Succinyl-diaminopimelate
FT                   desuccinylase; TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: Peptidase
FT                   family M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   acetylornithine deacetylase or succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64819"
FT                   /db_xref="GOA:E8R8J3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J3"
FT                   /protein_id="ADV64819.1"
FT                   /translation="MDEAGMREVAGRILSGSIEYPTVLGESYEDIVDFYRELLSEHGVH
FT                   VTVHRVPDELVRKTLPREFNPEKPRFILLARIGSGDRIIQFNGHYDVVAPGEGWETPPF
FT                   KPVIRGDLVYGRGATDMKGGIAAVLTAMISLAEGREPGVVVEAALVPDEEIGGRTGTGY
FT                   LVSELGSKPDYVVIAEPSGLDNIYIGHRGNVWGIVKTYGRQAHGSAPWLGDNAFEKMIV
FT                   FAQVFLKKYRELISLRKSSYMYEDERAAQPTITPGGALYAPGSINIVPGEAGFSIDRRL
FT                   IVEEKVEDVAREIKDMVEKVAAELGVQASFTLVESSPPAFTPPSHEYTVLLSKVVEKTT
FT                   GVEPRKTICVGGLDLRYYTLKGIPAVSYGPGEVGLAHKPNEYIRLSDVVKAAAIYAEYV
FT                   REFEKTGAPRS"
FT   gene            complement(506204..506437)
FT                   /locus_tag="Desmu_0507"
FT   CDS_pept        complement(506204..506437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0507"
FT                   /product="ferredoxin"
FT                   /note="InterPro IPR017896: IPR001080; KEGG: dka:DKAM_0628
FT                   ferredoxin; SPTR: Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64820"
FT                   /db_xref="GOA:E8R8J4"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J4"
FT                   /protein_id="ADV64820.1"
FT                   /translation="MYKVKIEPRENCISDMVCVSICPDVFEMNPDDNKSQIVGKYREGG
FT                   NIAVGVIPDDLAQCAQDAANACPVQIIHVEKA"
FT   gene            506519..507328
FT                   /locus_tag="Desmu_0508"
FT   CDS_pept        506519..507328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0508"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: dka:DKAM_0627 cation efflux protein; PFAM:
FT                   cation efflux protein; SPTR: Cation efflux protein;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: Cation efflux family; TIGRFAM: cation diffusion
FT                   facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64821"
FT                   /db_xref="GOA:E8R8J5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J5"
FT                   /protein_id="ADV64821.1"
FT                   /translation="MGAVKAMGTIWVVAATGIAGSVMKILGGVLYGSNTLFVDALTSVA
FT                   NMASLISILWFRRLAYTPPDSDHHFGHERFEYIGVLPMLITYGFVAGLSVARLYYVREY
FT                   RVELNAFYLALAAMLMYGVAVASSRRAPPSLRAYGAFTVSELLEGLVGVVASLGGALYS
FT                   YLVDYGGAVLLTSYIFYEIYEEGRRLSSFMADEAPPLEVYERVVETAESMGYNVESLRL
FT                   RTIVPGRYHGDMVLQPKSTAPSDLRELRRVLQGRGVDVCIETEKLNS"
FT   sig_peptide     506519..506575
FT                   /locus_tag="Desmu_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(507318..507929)
FT                   /locus_tag="Desmu_0509"
FT   CDS_pept        complement(507318..507929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0509"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="COGs: COG2095 Multiple antibiotic transporter;
FT                   InterPro IPR002771; KEGG: dka:DKAM_0626 multiple antibiotic
FT                   resistance (MarC)-related protein; PFAM: multiple
FT                   antibiotic resistance (MarC)-related protein; SPTR:
FT                   Multiple antibiotic resistance (MarC)-related protein;
FT                   PFAM: MarC family integral membrane protein; TIGRFAM:
FT                   membrane protein, MarC family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64822"
FT                   /db_xref="GOA:E8R8J6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J6"
FT                   /protein_id="ADV64822.1"
FT                   /translation="MEYLIALLSYFTQLIAIMNPFSAIPTFMSLTEGLDHRRRIAIVKK
FT                   AYLAGLILVTVFTLVGRYILEAFNISVASLRVGGGIILMTIALDMLGDDVRTKRMHPGD
FT                   IAVVPIATPLIIGPGTITTILLLTSSSTGVAEVALILLAGVTACSATFLILGLSDVLTR
FT                   LLSMSTVRAIGRFMALIIAGVAVEMIVHGIHSYYIELFKS"
FT   sig_peptide     complement(507882..507929)
FT                   /locus_tag="Desmu_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(507936..509270)
FT                   /locus_tag="Desmu_0510"
FT   CDS_pept        complement(507936..509270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0510"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro IPR006680; KEGG: dka:DKAM_0625
FT                   amidohydrolase; PFAM: amidohydrolase; SPTR: Amidohydrolase;
FT                   PFAM: Amidohydrolase family; TIGRFAM: dihydroorotase,
FT                   multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64823"
FT                   /db_xref="GOA:E8R8J7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J7"
FT                   /protein_id="ADV64823.1"
FT                   /translation="MPTLLIKNAGIPLSSGDIVEANIYVEDGVITYVGKREAQADEVLD
FT                   AGGRITVPGGIDIHAHIYDQAYAGNEDWETGSLAAAFGGLTTVVDMPLRTIVDNERVLE
FT                   EKLEEARRNSYLNYGVIGGFINEKNYTVIPELARRGVRLFKFFTCRPFKISDDALPEAF
FT                   EHVAIANGVAVVHAEDEALIGYWERKLSTQNTITAYHSSRTGSTEASAIYRVGYIGLDV
FT                   GARVHIAHLSSREGVEAVANLKKKTSITSEVTPHHLFFTREDSARFGAYLKVAPTLKSI
FT                   EDRDALWRGLEAGVIDAYVSDNAPAPRSMKEVNVWEAWGGVPNLEVMMPFLFTYGVLQR
FT                   RLSLARFIEVTARNPARILGVYPLKGELAVGSHADIVVLETGSPRKITASTHHHKVDWT
FT                   PWEGMELYGHPYHLIVNGSVLIEGRELVGKKGLGIYIGELKPRRR"
FT   gene            509334..509558
FT                   /pseudo
FT                   /locus_tag="Desmu_0511"
FT   gene            complement(509579..512479)
FT                   /locus_tag="Desmu_0512"
FT   CDS_pept        complement(509579..512479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0512"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="COGs: COG0495 Leucyl-tRNA synthetase;
FT                   InterProIPR001412: IPR004493: IPR015413: IPR020754: IPR
FT                   013155; KEGG: dka:DKAM_0624 leucyl-tRNA synthetase; PFAM:
FT                   tRNA synthetase valyl/leucyl anticodon-binding; tRNA
FT                   synthetase class I (M); Lysyl-tRNA synthetase, class Ic;
FT                   SPTR: Leucyl-tRNA synthetase; TIGRFAM: leucyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (I, L, M and V);
FT                   Anticodon-binding domain; TIGRFAM: leucyl-tRNA synthetase,
FT                   archaeal and cytosolic family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64824"
FT                   /db_xref="GOA:E8R8J8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J8"
FT                   /protein_id="ADV64824.1"
FT                   /translation="MSAEGFLEWLRSIEAKWQARWRESRVFQADPVPGKPKYFITVPYP
FT                   YSNAPLHIGHGRTYTMGDIVARYKRLKGFNVLYPMAFHITGTPVLAVSEMIARGEERVV
FT                   NMYKSYIKYYVDDESRVNEILESFKNPLNLAVFFAERIQSDFDALGYSIDWRRRFHTGE
FT                   PIYNRFVTWQFMKLREKGLITTGDHVVTYCLLHKQPEGEDDIQDADVNPVEVLEYTAVK
FT                   FHDRERNAYLAAATLRPETIYGAINIWVNPAAKYLELLWRGERIIVSEKAYVKLLHQHP
FT                   EDEIRIVAEMQGRELVGRRVVSPLGRELIVLPAEFVDPDNATGIVYSEPSDAPYDYVAL
FT                   QELKARREMLKEYGVDPGVVDALEPVRIIEVPGLSDHHAKVAVEKAGITSQLDARLEEV
FT                   TREVYREQYYSGVMIVDDPVLKGVPVKEAREIVRRRLLEAGQAFTFYELNRKARCRAGG
FT                   EIIVAKIKGQWFLDYGVKEVKEKVREYIERELTVIPEKYRKAFLDTLEWLDKRPCARKR
FT                   GIGTPLPWSPEWIIESLSDSTIYMAFYTVVHKIRENGVKPEQLTPEVFDYVFLGLGDPV
FT                   EVSARTGIPLRVLEEMRSEFTYWYPVDHRHTSIPHISNHLSFYIIHHAVIFPREHWPRM
FT                   ITLNETVIREGAKMSKSKGNVIPLRDIARLYSADLFRLYISWAASLDSVLDWRERDVAV
FT                   VADSLRRLVELAKTALSTECRNTGLDDPVSTWFIDRFNQLVKAASESIEHMEIREYVQN
FT                   SLFNVLSLVDKYRDIAGEKYICGVKQVLRDWITVLNPVIPHITEEIHELMGGKGFLSLS
FT                   SWPSPREPVNPEVDAAVDNAIMLQEDIREVVSLLKKTPSRIYIIVAPEWKRKVALEALK
FT                   GGSLKEVVDSMRTTYGLRGREAEIVEVYNYFKKHPNEQVKNVASQLEYSIYKYMAPYYS
FT                   RRFGVEVEVLWEDEARSKGIPKAERALPLKPSIFIA"
FT   gene            complement(512532..513677)
FT                   /locus_tag="Desmu_0513"
FT   CDS_pept        complement(512532..513677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0513"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: dka:DKAM_0623 major
FT                   facilitator superfamily MFS_1 protein; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: Major facilitator
FT                   superfamily MFS_1 protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64825"
FT                   /db_xref="GOA:E8R8J9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8J9"
FT                   /protein_id="ADV64825.1"
FT                   /translation="MSSRLLTVFIILGLVSLFADMAYEGAISVRGSYLSVIGAPVIAAG
FT                   LAGVGWLASYGSRFLSGVVSDYFRRPRVLWLLVFTGYFVNVIAIPLLAFTRRWELVIAL
FT                   IVFERLGKGLRAPARDVILAEVSEGMGKGLGFGIHEAMDQAGAVLGPLIASLILASSSQ
FT                   DYSRVFTALGVPGAVAVILVAAAWFLYPSPKSITARGVGVGFKGLTRGYYVYTLGFIFF
FT                   GLGLVSWDIVGYYARSTGFTGDYIALLYTVAMLVDGVLAIPSGILYDRVGVRSAVLAPL
FT                   AAAVAGVLLPLLQVNPFIPVVAWGLAMGAYETNVRVAVADLVPREKRAFAYGLYGLAEG
FT                   LAVFTGGIIQAGILGSAGIQALAIYIAVVELLGAAVFTVVR"
FT   sig_peptide     complement(513600..513677)
FT                   /locus_tag="Desmu_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(513870..515096)
FT                   /locus_tag="Desmu_0514"
FT   CDS_pept        complement(513870..515096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0514"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: tag:Tagg_1127 oxidoreductase
FT                   domain-containing protein; PFAM: oxidoreductase domain
FT                   protein; SPTR: Oxidoreductase domain protein; PFAM:
FT                   Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64826"
FT                   /db_xref="GOA:E8R8K0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K0"
FT                   /protein_id="ADV64826.1"
FT                   /translation="MLRVGFVGSGFVARFHLRAFASVPNAIVSSVYSPTGRRDLVALAR
FT                   EIGYPEPSVYSDLREMLRKEKIDALWILTPNHTRLDVTRTIVEEVTQGSSVKAVAYEKP
FT                   LARNLEEAAGILELVRKAGLLHGYLENQVFAPSVVRGREIAWRRGAALTGRPYLSRAAE
FT                   EHGGPHSHWFWNPAYSGGGVLLDMGCHSIEAGRYLLSEPGKNYKDLKPVKVVGFTETLK
FT                   WRRPLYVEKLLKAHGVDYRVIPVEDYARVVITYEAEDGTLAVAESSNAWSFVGPGLRLT
FT                   FELFGPEYYMSINTLQPELFVFFSREVKGPAGEDLVEKQAAEQGLMPALPDEAFAYGYI
FT                   YEDQEFTRAFAENKTPRENLFHAVEVMELLMAAYKSAEIGEPVKLPDPSLREYRPLPYR
FT                   RALEEHGGK"
FT   sig_peptide     complement(515034..515096)
FT                   /locus_tag="Desmu_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(515128..516528)
FT                   /locus_tag="Desmu_0515"
FT   CDS_pept        complement(515128..516528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0515"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   tag:Tagg_1121 extracellular solute-binding protein family
FT                   1; PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: Extracellular solute-binding protein family 1; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64827"
FT                   /db_xref="GOA:E8R8K1"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K1"
FT                   /protein_id="ADV64827.1"
FT                   /translation="MNRNLLIAIVVLAIVVIGGVAYYLSTQQPRKEVTIVVLSPEWEPG
FT                   KILEQLSANFTSYAQEKLGYPVKVVFDFTPWGTYYQRVTSIVTARSSEADIIFSDSQWL
FT                   GELFEGGHIIDLTDWINNDPDMKAATQDTYENLVKFYMTYPQGSNRYVGVPGYADAVML
FT                   LYYRKDLFNDPVERANFKAKYGYDLPSTLEDFKRLDWLQLKDIAEFFTRRAGETLAGQT
FT                   LTEDFYGITLVLSRDYDYISCSFLSMFWSWGAELWNPSTMDPRSYINSTQGVEALQFLH
FT                   NLTRYMPPSPATYDYDKVITTFAQGKAAMTVLWPSMAPALFDPATSRVSDKIGVAILPQ
FT                   HNGVRYITLGGQPLVISSYSNHKEEAKLFIKWFYTVAYKDYSLRVGFTARKSIAQSSDF
FT                   VNSKPWARAFVESLPYAKDFWNIPFYGRMLEIQQKYWNMVVAGQIDPKTAMDKIAEEQW
FT                   GVVQQFKK"
FT   sig_peptide     complement(516442..516528)
FT                   /locus_tag="Desmu_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            516677..517576
FT                   /locus_tag="Desmu_0516"
FT   CDS_pept        516677..517576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0516"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; InterPro IPR000515; KEGG:
FT                   tag:Tagg_1122 binding-protein-dependent transporter inner
FT                   membrane component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64828"
FT                   /db_xref="GOA:E8R8K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K2"
FT                   /protein_id="ADV64828.1"
FT                   /translation="MIKAGRGRNANPWILVLPAFMLLLLFNIFPLVWSLGLSFYSFSLI
FT                   IRQKPNFVWVSNYANLITSQETWDRFAKTGVFIGYSLILQFGLALLFSLLLFGEFKGRK
FT                   VVITALTIPLMIAPVASALIFRYLFDEMFGPVNQFLRSHLGVSPLWFSNELSPIGVPYA
FT                   MLMVILVETWIWTPFVMFLIMAGISAIPQDLVEQSRVDGLRFRYVFRFVILPYVKPMLA
FT                   IALIFRFMDSLKTFDTVYVLTAGGPGTTTELISVHIYKLAFERWDFGSATALSYLVLVI
FT                   VIFATNLFMHYLMGGGER"
FT   sig_peptide     516677..516778
FT                   /locus_tag="Desmu_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            517573..518409
FT                   /locus_tag="Desmu_0517"
FT   CDS_pept        517573..518409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0517"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: tag:Tagg_1123
FT                   binding-protein-dependent transporter inner membrane
FT                   component; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR:
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64829"
FT                   /db_xref="GOA:E8R8K3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K3"
FT                   /protein_id="ADV64829.1"
FT                   /translation="MSVVRDLTGYRVKKVLRYLLLLILTSIWLLPVYAMFSIAFRPRWD
FT                   MYGNLFIPAAITLENFVEAYNYGAFSAIVNSIVLTAGGTGIALLLAVLAAYAFSRFNMR
FT                   GKNLLMFYILSTRMMPGITLVIPIFVMYYNLGLKGTYLGLILVYSMMTLPLSLWMIKSF
FT                   IDDVPRDIDEAAILDGHSTWYILFKITLPSITPGLAASAAFAAIAVWNEFLFALLLSSI
FT                   ETKPTSVLLSSIRGERGFNWGRVASIEVVYILPIVLLVFWLQRYILRGLTFGTVKR"
FT   sig_peptide     517573..517674
FT                   /locus_tag="Desmu_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            518415..519536
FT                   /locus_tag="Desmu_0518"
FT   CDS_pept        518415..519536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0518"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR003593:
FT                   IPR017871: IPR002332; KEGG: tag:Tagg_1124 ABC
FT                   transporter-like protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64830"
FT                   /db_xref="GOA:E8R8K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K4"
FT                   /protein_id="ADV64830.1"
FT                   /translation="MVLLEARGVSKSYNDRKILDDVSFHIDQGELCVILGPPGSGKTTL
FT                   LKIIAGLVRQDEGSILLNGESIDDKPPSQRPVSMMFETLALYSHLTVYENIASPLIAAK
FT                   KTPEEIDRRVRELAGVLKIEHLLERKADKLSGGERQRVAMARALAKDASIYLLDEPFAN
FT                   LDAKIRHALRTEFKKLKQALGKTIVLATSDPLDALSLGDKIIVIRWGKVYQVGDPLTIY
FT                   RRPKGLWLSRYLTGGLLNELEVAWRGGELVVEGINRMRLSLPRELLELILGRGIEKATL
FT                   ASYIDGCSISRSSRGCKGLGIKAKYIGAEYRGSEYIVYASEADRIFKCLMHPAEFTLMD
FT                   LKYGDEVEVCIDLSNTIVFAGSDSEEEDDSGLG"
FT   gene            519499..520629
FT                   /locus_tag="Desmu_0519"
FT   CDS_pept        519499..520629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0519"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3839 ABC-type sugar transport systems
FT                   ATPase components; InterPro IPR003439: IPR003593:
FT                   IPR005116; KEGG: tag:Tagg_1125 ABC transporter-like
FT                   protein; PFAM: ABC transporter related; TOBE
FT                   domain-containing protein; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter; TOBE
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64831"
FT                   /db_xref="GOA:E8R8K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K5"
FT                   /protein_id="ADV64831.1"
FT                   /translation="MTLRRRMIVVSVEIRGVSKKFGKVEALKGIDLFIRSGEFFAILGP
FT                   SGCGKTTLLRIIAGLEKPSTGRVFFDGVDVTGYPAEYRNVAMVFQFYALYPTTVYENIA
FT                   LPLKSRKYKGKEIYERVRKISEVVGLSDKLNLHVNKLSVADKQRVALARAMAREPNLYL
FT                   LDEPLTILDPVSRIIMRSELKRVQRELGQTVIYVTHDQVEALTLADRIAVMSFGRVEQV
FT                   GEPDAIYNNPVNTYVGWFLGEPGMNFIDVQVSGEGLAIGGSAIYVNRDMAAVLRKKGFD
FT                   RVLLGFRGENAIVSRHSGGGGVSFASRVSVIEFLGTRYIITLEAGGQEFKVVMDTKRFE
FT                   ELSPKVGEEVYVRIRDSYIRLYDPEGRIIELSEGDK"
FT   gene            520629..520907
FT                   /locus_tag="Desmu_0520"
FT   CDS_pept        520629..520907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_1126 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64832"
FT                   /db_xref="GOA:E8R8K6"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K6"
FT                   /protein_id="ADV64832.1"
FT                   /translation="MKTSRGFIEKTLLIVGLIGLALIIQPFSRDAYTWGWYVLMAATTL
FT                   YVASTLTPTSYHGTRFLLRYALTLTIVLLVVASFILLSIKLAPLLVG"
FT   sig_peptide     520629..520721
FT                   /locus_tag="Desmu_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(521029..522576)
FT                   /locus_tag="Desmu_0521"
FT   CDS_pept        complement(521029..522576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0521"
FT                   /product="ABC transporter transmembrane protein"
FT                   /note="KEGG: dka:DKAM_0488 ABC transporter transmembrane
FT                   protein; SPTR: ABC transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64833"
FT                   /db_xref="GOA:E8R8K7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K7"
FT                   /protein_id="ADV64833.1"
FT                   /translation="MKPFIYDFKRAFIRKATLTALILFIMAGVGLTYMVAQSMLAGSQR
FT                   LLYNGVAVAELDAESRVLRVNIGLYDNELKPLSPSFTATLELGNTWLLLGRYSIEGTGP
FT                   LEIPLPESPVPLTGYRIIPLTLNVTAMHVGSVEVKETITMRLTQSSSNASRYYGCEAIG
FT                   AHAFSWIHPASSLEVCGSIIPAGGKLYVVMAAAGEFQGELSLYYSIKESNYSYTYWESR
FT                   GPMVSNISGMSYLGTIREALKTYVYEAAVDPKLLESSRPVEIRLALLSREGEILGGLEI
FT                   SMGLTNPAVEAITEFVAGTGVGLFSGFFPIVVLYLGYVLIAKPKTQGALEFILARPITR
FT                   RDLYLTRYAAGVLVALAAPAVFTIALYTGVYSTLRVALNPLDALLIYLGLAASLAGFYT
FT                   LCYYIAVEARGASYLAITITLYLLYLIGFQILGFMIAFTVGHSIEDYLKLTYKLYYLSP
FT                   MRLADLVTALVLYRHGYLGAAVLEVVKPEYIAVATAAWIIVPFTAGLVRFKRKNLAG"
FT   sig_peptide     complement(522451..522576)
FT                   /locus_tag="Desmu_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(522573..523556)
FT                   /locus_tag="Desmu_0522"
FT   CDS_pept        complement(522573..523556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0522"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439: IPR003593: IPR017871;
FT                   KEGG: dka:DKAM_0487 ABC transporter related; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64834"
FT                   /db_xref="GOA:E8R8K8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K8"
FT                   /protein_id="ADV64834.1"
FT                   /translation="MYLYLVLNMHQVYYRPSYHLATWGSALIEVSGIFKSFGGRRVLSD
FT                   VSFKVGDGEVVGYVGLNGAGKTTTIRIITGVLNPDKGEVLVDGYSVLREKRKASERIGW
FT                   VPELPIFETEFKALDYFVYLAGYHGLSRGEAVRLGRELLEKVGLGDAVYKRLSEYSQGM
FT                   KKRFALAVSLIGNPQNFVFDEVLNGLDPQGIAFFRELTRGFKKEGRAVLFSSHILKEVE
FT                   QIADKVVFIHKGRIIGVYTMEDIARLAQPSIRIRLVEPSGEALRVLEGYGEIRVEGSEV
FT                   VVKTDASPDEVISRLVEKGVKLMEFRREERDLESFFFELIKKGEAG"
FT   gene            523588..523770
FT                   /pseudo
FT                   /locus_tag="Desmu_0523"
FT   gene            complement(523747..523875)
FT                   /pseudo
FT                   /locus_tag="Desmu_0524"
FT   gene            524069..524602
FT                   /locus_tag="Desmu_0525"
FT   CDS_pept        524069..524602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0525"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="COGs: COG2110 phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1; InterPro IPR002589;
FT                   KEGG: iho:Igni_0438 hypothetical protein; PFAM: Appr-1-p
FT                   processing domain protein; SMART: Appr-1-p processing
FT                   domain protein; SPTR: Appr-1-p processing domain protein;
FT                   PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64835"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8K9"
FT                   /protein_id="ADV64835.1"
FT                   /translation="MRLRLKGLIVEVVAGDITLFQGDALVNPANTYGYMGGGVALAIRK
FT                   KGGDVIEEEAVKQAPIPIGGAVVTTGGSLGVKAVIHAPTVVEPGGASSPVNVYKATAAA
FT                   LSKVLENGFRKIAFPLMGAGVGGVPPAESARAMARALREHGAGAALTIHVYVRDPGLVG
FT                   DVVRAFIEEGFQPA"
FT   sig_peptide     524069..524113
FT                   /locus_tag="Desmu_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            524667..526208
FT                   /locus_tag="Desmu_0526"
FT   CDS_pept        524667..526208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0526"
FT                   /product="Amidohydrolase 3"
FT                   /note="COGs: COG1574 metal-dependent hydrolase with the
FT                   TIM-barrel fold; InterPro IPR018228: IPR013108; KEGG:
FT                   dka:DKAM_0730 predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold; PFAM: Amidohydrolase 3; SPTR: Predicted
FT                   metal-dependent hydrolase with the TIM-barrel fold; PFAM:
FT                   Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64836"
FT                   /db_xref="GOA:E8R8L0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L0"
FT                   /protein_id="ADV64836.1"
FT                   /translation="MSRVKCFLNGRVYTGFKPLRVEEALTVAYGRVLYAGEEGKALALC
FT                   RMLGGEAVDLEGKTILPGFIDSHMHLDGVGLQLSTLDLRGVGSIEELKEKVREYAASHS
FT                   GGPVVGRGWDQEFFREKRWPTRWDLDEAVVDRPVILVRVCGHAAVLNTKAMELAGLIHV
FT                   ESPWVVRDESGEATGVILEGAVGEALRVLQGSMDTREKALLMRRALEYAASLGVTTLGF
FT                   MSCSGDSLRALMLLHSEWRYPRVRVYVEPGLLRELSKLGFTGGFGSEYLRVKGVKAFAD
FT                   GSLGARTAWLSKPYSDDPLNTGRQLISRSELEGLVEEASRAGFQVAVHAIGDAAVDLVL
FT                   DVYRSARGSGVRHRIEHASVIRPEQVAEASSLGIAVSVQPRFAVSDWWAGQRLGDERLK
FT                   WLYPFKTMAGRGVALGFSTDAPVEPLNPWETIYAAVAREGGEALTLEEALHYYTYGSAY
FT                   VLGEEGELGTLTEGKLADLIVVDRDPFKTPLGELRGIRVVETYVGGERVLVQPPS"
FT   gene            complement(526193..526456)
FT                   /locus_tag="Desmu_0527"
FT   CDS_pept        complement(526193..526456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0527"
FT                   /product="thiamineS protein"
FT                   /note="InterPro IPR003749; KEGG: dka:DKAM_0734 thiamineS
FT                   protein; PFAM: thiamineS protein; SPTR: ThiamineS protein;
FT                   PFAM: ThiS family; TIGRFAM: MoaD family protein, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64837"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L1"
FT                   /protein_id="ADV64837.1"
FT                   /translation="MTLRVKVLLLGVLADAAGTHMEEHALKDGSRVSELIEAVVKRHSG
FT                   LKALVETLPVLNIYVNGRHVDLNHALGDGDEVVIAPPFYEGG"
FT   sig_peptide     complement(526400..526456)
FT                   /locus_tag="Desmu_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(526440..526928)
FT                   /locus_tag="Desmu_0528"
FT   CDS_pept        complement(526440..526928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0528"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041: IPR006058: IPR002888; KEGG: dka:DKAM_0735
FT                   aerobic-type carbon monoxide dehydrogenase, small subunit
FT                   CoxS/CutS - like protein; PFAM: [2Fe-2S]-binding
FT                   domain-containing protein; ferredoxin; SPTR: Aerobic-type
FT                   carbon monoxide dehydrogenase, small subunit CoxS/CutS-like
FT                   protein; PFAM: 2Fe-2S iron-sulfur cluster binding domain;
FT                   [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64838"
FT                   /db_xref="GOA:E8R8L2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L2"
FT                   /protein_id="ADV64838.1"
FT                   /translation="MKVSFRVNGKPVELDVEPNELLINTLRNRLGLTGVKYGCGIGECG
FT                   ACTVLIDGEPALSCLVLTVDVNGREVETVEGLTSEREPSPVQKAFMEEGAVQCGYCTPG
FT                   FIVMAEYMRRRRVEPSDENIREYLKGNLCRCTGYVNIYKAVRRALQQDPRGSPDDSKG"
FT   gene            complement(526925..527833)
FT                   /locus_tag="Desmu_0529"
FT   CDS_pept        complement(526925..527833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0529"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR016166: IPR002346: IPR005107; KEGG: dka:DKAM_0736
FT                   aerobic-type carbon monoxide dehydrogenase, middle subunit
FT                   CoxM/CutM - like protein; PFAM: molybdopterin dehydrogenase
FT                   FAD-binding; CO dehydrogenase flavoprotein domain protein;
FT                   SPTR: Aerobic-type carbon monoxide dehydrogenase, middle
FT                   subunit CoxM/CutM-like protein; PFAM: FAD binding domain in
FT                   molybdopterin dehydrogenase; CO dehydrogenase flavoprotein
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64839"
FT                   /db_xref="GOA:E8R8L3"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L3"
FT                   /protein_id="ADV64839.1"
FT                   /translation="MGLKPSMINYRNTHIIPFSFNYYEPASLREALEILSELGGSARIL
FT                   AGGTDLLVKMKTRQVEPKAVVNIKRIRELKGITVEDGRVRIKALTTLREIEESPIVAKY
FT                   IPALRDAVKQMASIQVRSMATIGGNLCNASPAADTAPPLLVHNASVKIVGLNRERTVPL
FT                   ASFFKGPGSTVLEPGEILAEVIVEAEPGSSAFMKIGRVAVDLAVASAAVYVELNGDIVE
FT                   EARIAAGAVAPTPIRCPVAEGALKGRRLSEVGLNVFKPIEGEVKPISDARASAEYRRHL
FT                   VRILAHDAFWRAVEALKRDAE"
FT   gene            complement(527824..530169)
FT                   /locus_tag="Desmu_0530"
FT   CDS_pept        complement(527824..530169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0530"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674: IPR008274; KEGG: dka:DKAM_0737 aerobic-type
FT                   carbon monoxide dehydrogenase, large subunit CoxL/CutL-like
FT                   protein; PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; SPTR: Aerobic-type carbon
FT                   monoxide dehydrogenase, large subunit CoxL/CutL-like
FT                   protein; PFAM: Molybdopterin-binding domain of aldehyde
FT                   dehydrogenase; Aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64840"
FT                   /db_xref="GOA:E8R8L4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L4"
FT                   /protein_id="ADV64840.1"
FT                   /translation="MYSFIGKRTIRRDALAKTSGTLRFVNDLEAPGMLIGRILRSPYAF
FT                   ADIKRIDVSEAERIGAVTLTPDEVPQKPFNPRLVSVHEVTFKDTYVLTKKPRYIGDAVA
FT                   AVAAPSEELAQRALESIRVEYERIYEPILDPFKAMEPGAPLIHEKIMKGSEWIRVEGNI
FT                   AASLNYVEGDVDKAFQESDVVLERRFKTGKRYHMQLEPKAVLCVPEPGGKLTIYSTTQS
FT                   IHNTRILVSQIFDIPLSRVNVVKIPIGGSFGSSIQVNYLVPIAVALCLKSGKPVKIAYT
FT                   REEDILDHSNFVFHFRIKVGAKRNGVLTGAEFENTLDVGAHQVQPYPLLGTSLGWFVSM
FT                   YKWRNIRYIGRAVYTNKTPACALRGYGAPEVQWAVETIMDELAEELGVDPVELRLKNYV
FT                   GRGEIFWGQGPTVKSIIRSDGVPELLEKGKELIGWDKRGDPRGKKGRFRRGIGVARGFH
FT                   TSGAGGPISGEVIDYTGCILKLNEDGTLDYITALQDHGGGTLDAHVKIISEVLGVPPEL
FT                   VNLASASTENTPYDVCTHASRGTYVGGEAARRAAEIVKSKIFEYAARLVGKAVNPEAFK
FT                   IRYDEGLKQAVVYIEGTDVRIPLSEIARAAWQRNWGTIGAFVSYRATSAPPSFTVYFVE
FT                   VEVDTWTGRVKPIRVVAGADVGTPVNPDMVEGQLHGGFAMAWGMAFTEDMVYEENGELA
FT                   GRGLITDYKIPTIADVPAPEDFKVIIASSYEPTGPFGAKGIGEAAMNPAVGAIANAVYN
FT                   AIGVRFYELPITPGKIVEALRKGGVQWD"
FT   gene            complement(530154..530630)
FT                   /locus_tag="Desmu_0531"
FT   CDS_pept        complement(530154..530630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0531"
FT                   /product="(2Fe-2S)-binding domain-containing protein"
FT                   /note="COGs: COG2080 Aerobic-type carbon monoxide
FT                   dehydrogenase small subunit CoxS/CutS homologs; InterPro
FT                   IPR001041: IPR006058: IPR002888; KEGG: dka:DKAM_0738
FT                   aerobic-type carbon monoxide dehydrogenase, small subunit
FT                   CoxS/CutS - like protein; PFAM: [2Fe-2S]-binding
FT                   domain-containing protein; ferredoxin; SPTR: Aerobic-type
FT                   carbon monoxide dehydrogenase, small subunit CoxS/CutS-like
FT                   protein; PFAM: 2Fe-2S iron-sulfur cluster binding domain;
FT                   [2Fe-2S] binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64841"
FT                   /db_xref="GOA:E8R8L5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L5"
FT                   /protein_id="ADV64841.1"
FT                   /translation="MIVRFKLNGVAVEVDAPPSEILLDTLRLRLKVRSVKRGCERGECG
FT                   SCTVLLDGKPVASCMLLTPQVEGRSVVTVEGLQGDPLLGKLVESFTEKGAVQCGFCTPG
FT                   ILLTAWAAIREGRIRERKDIAEYIGNLCRCTGYVKIAEAVWSTVEKVGKQCTPS"
FT   gene            complement(530627..531505)
FT                   /locus_tag="Desmu_0532"
FT   CDS_pept        complement(530627..531505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0532"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="COGs: COG1319 Aerobic-type carbon monoxide
FT                   dehydrogenase middle subunit CoxM/CutM homologs; InterPro
FT                   IPR016166: IPR002346: IPR005107; KEGG: dka:DKAM_0739
FT                   molybdopterin dehydrogenase FAD-binding; PFAM:
FT                   molybdopterin dehydrogenase FAD-binding; CO dehydrogenase
FT                   flavoprotein domain protein; SPTR: Molybdopterin
FT                   dehydrogenase FAD-binding; PFAM: FAD binding domain in
FT                   molybdopterin dehydrogenase; CO dehydrogenase flavoprotein
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64842"
FT                   /db_xref="GOA:E8R8L6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L6"
FT                   /protein_id="ADV64842.1"
FT                   /translation="MFYRIPEVKYHRPASLEEALELLGKLSGKARILAGGTDLVLDLKI
FT                   KRYDVSDLIDVSGLKELKYITDEGGVLRIGALTTIQEIADSTIVAEKTPLLKKAAEEFA
FT                   YWQVRNIATIGGNLCNASPAADTAPPLMVHEAWVRAVSMDGERRIPLKEFFKGPRTTAL
FT                   KPNEILAEVSIPYSQGEAWRYAYHKLGRRRGHDISVVSIAVAVRVEEGVFRDVRIALGS
FT                   VAPTPVRAWSVEEELKGREASVENINRAVEKITGDIKPISDARASAEYRLHVSKELLRD
FT                   MLTGLVEGGRR"
FT   gene            complement(531516..533858)
FT                   /locus_tag="Desmu_0533"
FT   CDS_pept        complement(531516..533858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0533"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="COGs: COG1529 Aerobic-type carbon monoxide
FT                   dehydrogenase large subunit CoxL/CutL homologs; InterPro
FT                   IPR000674: IPR008274; KEGG: dka:DKAM_0740 aldehyde oxidase
FT                   and xanthine dehydrogenase, molybdopterin binding; PFAM:
FT                   aldehyde oxidase and xanthine dehydrogenase molybdopterin
FT                   binding; aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead; SPTR: Aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; PFAM:
FT                   Molybdopterin-binding domain of aldehyde dehydrogenase;
FT                   Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64843"
FT                   /db_xref="GOA:E8R8L7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L7"
FT                   /protein_id="ADV64843.1"
FT                   /translation="MGGALSLLEKWLSARELLVVGKRVTRVDSLEKALGKAMFTEDYFI
FT                   DYFMGNALYVKQVLSTHPHARLKGISLPDALKGKGVRLITARDIPGENQVGYSLPDQPL
FT                   LAEGKVRYHGEVVALVASTSLDDALRAVEEVRVDYEPLPYVLDPLEAMARSDVLVHEEA
FT                   GSNIAFRTRVRRGSVEEGFSRAHVVVENEYRLHHQEHAYLETEAALAIPSMENGVTVIG
FT                   GLQYPHLGQRIVARVLGLPSSRVKIIAPYVGGGFGGKDDEGPLTCAKAALVAYLTGKPA
FT                   LLVYSREESMRIHPKREAAIIRYKSGADSEGRLTAIEVTIIHDTGAYANRGPFILWRAT
FT                   MHASGPYIVPNAKVDGYAVYTNKVYQGSFRGFGNLSIQFAVERQMDQLAEKLGLDPVEF
FT                   RLRNIVREGSHTITGQLLDHSVGVAEALKRVAEASRWRERRREIEEYNKSGGRFKRGIG
FT                   VAVAWHGISTSRGVPDWSNAYVKIEQDGSVTLYTGIVEIGQGSPSSAHVQIVSELLGVT
FT                   PDRVRVVHGSTDAPDAGATHASRGSSIGGIGVYMAAAVLRERLAGLASRIMGVPVEDLV
FT                   FAGNKVYSRNNPDKQLQLRDLVKEAVARGVELSATGYFFLPKGRFDDSTGQGFAYPAYS
FT                   YMVVVSEVEVDTLTGVVKVTRVYPGLAAGRVINPVQVEGQIEGAIAQGIGYTLMERLVF
FT                   DEKGALINVNLTDYVVPSMRDMPEVAEPVYVEDLFKYGPFGAKGVGEMALIPMPASIAN
FT                   AVSHALGVNVTETPLTPEKVLKAMGRL"
FT   gene            533968..535323
FT                   /locus_tag="Desmu_0534"
FT   CDS_pept        533968..535323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0534"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.5"
FT                   /note="COGs: COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolase; InterPro IPR002195: IPR004722: IPR006680;
FT                   KEGG: dka:DKAM_0741 putative allantoinase; PFAM:
FT                   amidohydrolase; PRIAM: Allantoinase; SPTR: Dihydroorotase;
FT                   TIGRFAM: dihydroorotase, multifunctional complex type;
FT                   PFAM: Amidohydrolase family; TIGRFAM: allantoinase;
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64844"
FT                   /db_xref="GOA:E8R8L8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L8"
FT                   /protein_id="ADV64844.1"
FT                   /translation="MSLLVRNGLVVTSKGVLRADVRIQDGVITSVGRHLDSSGVDEVID
FT                   ASGMLVFPGVIDEHVHMREPGLEYKDDFTHGSRAALKGGVTTVVEHPNTLPPVDEPGKL
FT                   VAKARLLEQKAYVDFALLGVLHDGNTHLFEDMLAEGAAGFKVFMGPTTGNIPPPSEPSL
FT                   YEVLRESGRMGVTVAFHAEDHALVTYFTEKARSTGGMDPALHDDARPPLVEEYSVVKIA
FT                   AIAKHTGGRPLIVHISSAQALEAVSQAKRAGVEIYGETCPHYLLLDKPDYARYGSLIKV
FT                   NPPIRGGVHRARLVEAVAKGGVDTVGSDHAPHAPEEKRRDIWSAASGMPGVQTLLPSML
FT                   DLALRNIIPLTRIPLLLAENPAKLWGLWPRKGFIDVGFDGDLVIVDPGSETLVTEEWLE
FT                   YKYKLTPFTGWRFKGRVRHVVIRGRVALRDGVITGEQKGVWVKPIRIPGYSS"
FT   gene            535337..536260
FT                   /locus_tag="Desmu_0535"
FT   CDS_pept        535337..536260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0535"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="COGs: COG0540 Aspartate carbamoyltransferase
FT                   catalytic chain; InterPro IPR002082: IPR006130: IPR006132:
FT                   IPR006131; KEGG: dka:DKAM_0742 aspartate
FT                   carbamoyltransferase catalytic subunit; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; SPTR: Aspartate
FT                   carbamoyltransferase; TIGRFAM: aspartate
FT                   carbamoyltransferase; PFAM: Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain;
FT                   Aspartate/ornithine carbamoyltransferase, Asp/Orn binding
FT                   domain; TIGRFAM: aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64845"
FT                   /db_xref="GOA:E8R8L9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8L9"
FT                   /protein_id="ADV64845.1"
FT                   /translation="MNKGSDVISALQFTRSDVERLITIAEELRRRLEAGERIEAAKGRI
FT                   LFTAFFEPSTRTRLSFQFAMVRLGGSVVDLGPEEVTSRAKGESPEDTLRTVDSYNPDVI
FT                   VVRHREPGFASKAAEICRAPVVNAGDGYNEHPTQALLDVYTIWRSLGRVDGVSIGLMGD
FT                   LKYGRTVSSLSYILSNFRDVTIYFISPPALRPREEVLRILDQRRTRYEFAESLDEVVSR
FT                   VDVLYVTRLQKERMSPEEYERLKGSYTVSYESLRKYGRIPLIMHPLPRVWELTPDVDVL
FT                   PQAIYFEQARNGLYMRMALLKTILGV"
FT   gene            complement(536309..536647)
FT                   /locus_tag="Desmu_0536"
FT   CDS_pept        complement(536309..536647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpe:Tpen_1629 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64846"
FT                   /db_xref="GOA:E8R8M0"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M0"
FT                   /protein_id="ADV64846.1"
FT                   /translation="MVKMEHHVVAAALILILTVALTYRYPVEIAVSALLVLLGAWIAVT
FT                   GLLAKPGRHEASVKTPTSRVAFGGLTATLGAALMVSAVTKDARAALIAVITLLSLTITA
FT                   AIIIERKL"
FT   sig_peptide     complement(536582..536647)
FT                   /locus_tag="Desmu_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(536654..538144)
FT                   /locus_tag="Desmu_0537"
FT   CDS_pept        complement(536654..538144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0172 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64847"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M1"
FT                   /protein_id="ADV64847.1"
FT                   /translation="MGVELVGLRCVKCGAPLPQPEKGSEYVRCEYCGTVQRVVDASQYT
FT                   ERLKSEIYSWIRELLPVSTVGVQTIDVLARHNIFIANIKPRILPEYASLKAKVLKLLST
FT                   PLVLPRGIGLKPDIDDPRKAFEKLARVESLSQMVVVDEDREFYSGVYATYVLNAHLSNY
FT                   VETALSGDIDAAVRNLEKLAESLPGTGVEEAVLHRVKGVANAMKAWSSLEKGDYTSAMP
FT                   LLETASLELSKARSLASGSPQLAMMLPPVDVELKLVEAMRNIAECEKALFEAGRQPQEA
FT                   AAFIARYIRTVEEVRSRVKRDIGVYLELSESLKSLYLSRLGRETVEVLPGEGEVALPLY
FT                   VVSISYTFVTGSLVWKKGREYRDHLLVLATHPYASKPVTDTFRLTSGFLDRLKGREEKL
FT                   TVDTVSKALSTLKRDHLRVPAVPPLIDRAAAEALVDSYLANVSSRLQGKVKTGASHTEK
FT                   LIYAPARIRGGDIYIEALGETQVALGPHLDVVLKLAVR"
FT   gene            complement(538153..539160)
FT                   /locus_tag="Desmu_0538"
FT   CDS_pept        complement(538153..539160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0975 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64848"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M2"
FT                   /protein_id="ADV64848.1"
FT                   /translation="MAWKIWKSDAERFEEEYGKALNERNKGNLDGAVEHFNKAAEIASA
FT                   SGDQGLKAKGALAAAMASIYSLVKSPSEAALKQAMASLRSLNPEAELDLALPYRVKAGE
FT                   LYRELEALSAYLTLPRIDIGKLRGMKPGELDELSKRYEEAAGILLQYGRDKFLLEDLLK
FT                   LDTPQKTALRLLALSRLMKAVLAEREDPGRAVELYTEAVGYLSSIADQRYSATASKWLE
FT                   KAGKSTKCWICGRDMQGEDVHFVYLPATITPYIAKRYGEEAPNMLVESGGGQYIAVCTA
FT                   CYTAMYNLGDAISRHYYELAMKALEDAVRRLQMEIDALRNECRARWVAGAGRPR"
FT   gene            complement(539172..540167)
FT                   /locus_tag="Desmu_0539"
FT   CDS_pept        complement(539172..540167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0539"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG4260 Putative virion core protein (lumpy
FT                   skin disease virus); InterPro IPR001107; KEGG:
FT                   tag:Tagg_0976 band 7 protein; PFAM: band 7 protein; SPTR:
FT                   Band 7 protein; PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64849"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M3"
FT                   /protein_id="ADV64849.1"
FT                   /translation="MSRRTNVIEWVNPGPDDILWVYPYEDIRWGSVVVVHEYEAAVFMR
FT                   DGKIYDVLPPGRHTITTQNIPLLTRAYNLVMGYGETPFKARIVFISLKQFKGRFGTSTR
FT                   VKLGPRTLYMTELQAYGEYWFRVADPVLFLTQVAGAVPELSTPAVTEFLRGLFTEQFIQ
FT                   ELANYTAIDVYTRLTEVTTRIKTGTIYEALKQRGIELIDVKIGGVSLPQLEKMEKEDPT
FT                   YGLPLLLAIQKGEEDKVLEIIRTVETMRALGRSPGVGVLGALVALPQMLPQTMAPQVQQ
FT                   QPQQPQVQQPQQKSPTDKLRELKKMLDEGLITREEYEQLKKEILEEFKRS"
FT   gene            complement(540168..540707)
FT                   /locus_tag="Desmu_0540"
FT   CDS_pept        complement(540168..540707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tag:Tagg_0977 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64850"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M4"
FT                   /protein_id="ADV64850.1"
FT                   /translation="MSIDELLTQAKGDRSLVEKILSVFPGYKGYKDKEVLRETDRIVRE
FT                   KLYTLLKDASGELRALFREITGAQGYSTLAGEVERLLYRCDALAERVRHAPYGYKPFFN
FT                   VVRINSDDLYRLLQYDASLAAGAVSLRNTVANARRTLASIGVGGLDVKSIEEAIRVLEA
FT                   KLDERNLALMKAVEVA"
FT   gene            complement(540762..542090)
FT                   /locus_tag="Desmu_0541"
FT   CDS_pept        complement(540762..542090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0541"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /note="COGs: COG0160 4-aminobutyrate aminotransferase and
FT                   related aminotransferase; InterPro IPR005814; KEGG:
FT                   pab:PAB0086 pyridoxal phosphate-dependent aminotransferase;
FT                   PFAM: aminotransferase class-III; SPTR: Pyridoxal
FT                   phosphate-dependent aminotransferase; PFAM:
FT                   Aminotransferase class-III; TIGRFAM: 4-aminobutyrate
FT                   aminotransferase, prokaryotic type"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64851"
FT                   /db_xref="GOA:E8R8M5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M5"
FT                   /protein_id="ADV64851.1"
FT                   /translation="MVLDPGPIPRPFTLKYFPFKAVEGRGARVLDAEGREFIDFVSGAA
FT                   VYNVGINREEVVNAVVDQARRLLNYTSLYFYMEEPVRLARKLVEVTPGRFDKRVVYGFT
FT                   GSDAAEIALTSSMNYTGKPWLLSFTGSFHGTLYLSLSASGIFAGRGRGAAVYRRVLYAE
FT                   YPNPYRNKWGVDGYEKPGELTALALSEVEEKIREAKGDVAAVIFEPVEGDAGVVVPPAG
FT                   FLKGLREVADRHGVVLIGDEVQTGIGRTGSMWAVEHFSVEPDLLLAGKALGGGMPISAV
FT                   IGRAEILESQPLLGLGFTNMGHAVCARAALATIEVVEKEHLAERARVLGEHASKRLREI
FT                   AERVEAVGDVRGLGLMIGVEVVRDKASRRPDRATALKTCWRAWEKGLLVTTLGSHGNVL
FT                   RIMPPLTISMEELDKGIDVLEESLRDAVEGRVPDEVLGFMQGW"
FT   gene            542349..543635
FT                   /locus_tag="Desmu_0542"
FT   CDS_pept        542349..543635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0542"
FT                   /product="hydroxymethylpyrimidine transporter CytX"
FT                   /note="COGs: COG1457 Purine-cytosine permease and related
FT                   protein; InterPro IPR012732: IPR001248; KEGG:
FT                   shc:Shell_0907 hydroxymethylpyrimidine transporter CytX;
FT                   PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; SPTR: Hydroxymethylpyrimidine transporter CytX;
FT                   TIGRFAM: hydroxymethylpyrimidine transporter CytX; PFAM:
FT                   Permease for cytosine/purines, uracil, thiamine, allantoin;
FT                   TIGRFAM: NCS1 nucleoside transporter family; probable
FT                   hydroxymethylpyrimidine transporter CytX"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64852"
FT                   /db_xref="GOA:E8R8M6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012732"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M6"
FT                   /protein_id="ADV64852.1"
FT                   /translation="MAGYELDLKPVPRGERSLGFPEVFSIWFGAGISIAEFWAGAMLVG
FT                   VLGLNLPSAILATILGHLLGNTILAAVSLMGYYSGVPTMVLSRISLGSRGSIAASIANY
FT                   LQLVGWTAVMLVVAARASETVLAEASGLKGWMVYSSSIMLIGLAVVAWALTGVKGWRRV
FT                   ELASAAALAVLSAWLTAVVASSRDLPRLLAEPLVIDERFWLGVDLAAAMPVSWAPVAAD
FT                   YSRFSRSGLAAFWGTYVGYFASSSLFYIIGALSNLLVNQPDPVGVIAVYGLGVPAMLLV
FT                   VLSTTTTTFLDVYSAAISLKNTLPRIDIRKHIVVAGVLGIGVGLVFPVESYEWFLLLIG
FT                   GVFTSLSGVMVADFLRNRLAYVEWRDPVVHVETRGLVAWVAGTVLYILLSASSILPEVE
FT                   IPLFSDIGAITGSTLPSLAVSTLLALILG"
FT   gene            543641..544714
FT                   /locus_tag="Desmu_0543"
FT   CDS_pept        543641..544714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0543"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="COGs: COG0309 Hydrogenase maturation factor;
FT                   InterPro IPR011854: IPR000728: IPR010918; KEGG:
FT                   tro:trd_0023 hydrogenase expression/formation protein HypE;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; SPTR: Hydrogenase
FT                   expression/formation protein HypE; PFAM: AIR synthase
FT                   related protein, N-terminal domain; AIR synthase related
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64853"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M7"
FT                   /protein_id="ADV64853.1"
FT                   /translation="MGPYRIGKVDKKVFEEIIFPHLGAVAGEVAVGPSYGVDFAVVDVG
FT                   DKSLIFEVDPVFVVPQYGWERSGWFAVHILASDVAVSGVPPRYLFIDLNLPLSMRDEEL
FT                   KTLWMAIHRECEKLGIAIVGGHTGRYGGVDYPMLGGAVMMGVTGRGNYVTPADARPGDL
FT                   VLMTKGPAVEAAGILSVMFPSVLEAEYGSGFAREAQGIFWLQTVVPDALALAGAGLKTV
FT                   VTAMHDATEYGVWGALHDVSESSRVGIRVYRDRLFIRGDVAKVLKAFEKYTGMEIDPFA
FT                   AISEGTLIATVKRSRVSEALEALRRAGVEAAVIGEVVEGSGVELVDASGVSRVDRPLQD
FT                   PFWPVFFEVMEKLGGGR"
FT   gene            544711..546075
FT                   /locus_tag="Desmu_0544"
FT   CDS_pept        544711..546075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0544"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="COGs: COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   InterPro IPR004399: IPR013749: IPR019293; KEGG:
FT                   ape:APE_2400.1 phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1;
FT                   Phosphomethylpyrimidine kinase; PRIAM:
FT                   Phosphomethylpyrimidine kinase; SPTR: Trifunctional ThiDN
FT                   protein; TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase; Archaeal
FT                   phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64854"
FT                   /db_xref="GOA:E8R8M8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M8"
FT                   /protein_id="ADV64854.1"
FT                   /translation="MKQIPVALTIAGSDSGGGAGVQADLKTFAAMGVHGASAITSITAQ
FT                   NTREVRAIHDVPPEIVKAQIEAVVEDIGVDAAKTGMLSNSGIIRVVAEAVERYGFPLVV
FT                   DPVMIAKSGARLLREDAVEELKRLLRLAKVVTPNIPEAEVLLGEEIKGIGDAERAAREI
FT                   AERYGCEAVVVKGGHMKGDLVIDVLYHAGRITEFKGRRIERRTKHGTGCSFSAAIAAGL
FT                   AKGRSIEEAVRVARELVETAIEYGLEVGGGHGPVNPSAYIYIPAERYRVLVNVEEAVRM
FT                   LKDNEKLVNALVPEVGINIGMAIEHPYARTPMDVAAVPGRITRYRDGLMVPGKPEFGVS
FT                   RHIANAVLTAMRINPSIRAAADIAMPDGWEEAARGLGFKTSYFDRRLEPPEVKRVEGGT
FT                   TRWGVEWAVRRTGGVIPDIIADYGEHGKEPLLLVLGETATDVAGKIVRLARTLHG"
FT   gene            546153..546806
FT                   /locus_tag="Desmu_0545"
FT   CDS_pept        546153..546806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0545"
FT                   /product="BioY protein"
FT                   /note="COGs: COG1268 conserved hypothetical protein;
FT                   InterPro IPR003784; KEGG: afo:Afer_0230 BioY protein; PFAM:
FT                   BioY protein; SPTR: BioY protein; PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64855"
FT                   /db_xref="GOA:E8R8M9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8M9"
FT                   /protein_id="ADV64855.1"
FT                   /translation="MKQRKRGAICVPQQKVLVESKTQGSIALKALMREALIIVLGVAGL
FT                   ALSARIRLILPFTPVPFTLQTLVLFYEILALGRRAWRITATYVLLGLAGLPVFAYGGGP
FT                   GYVSSPTFGYLLGFTVAAAVGGWIIGGGLLVTPRRLLTALAASITAVYALGAAYLAAWV
FT                   TILSNAPLHVALAMAVAQGIAPFIALDVVKALIAAGALYATNKAATWIRYGSRR"
FT   gene            547198..547722
FT                   /locus_tag="Desmu_0546"
FT   CDS_pept        547198..547722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0546"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="COGs: COG1853 Conserved protein/domain typically
FT                   associated with flavoprotein oxygenase DIM6/NTAB family;
FT                   InterPro IPR002563; KEGG: smr:Smar_0547 flavin reductase
FT                   domain-containing protein; PFAM: flavin reductase domain
FT                   protein FMN-binding; SPTR: Flavin reductase domain protein,
FT                   FMN-binding; PFAM: Flavin reductase like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64856"
FT                   /db_xref="GOA:E8R8N0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N0"
FT                   /protein_id="ADV64856.1"
FT                   /translation="MEKPYRLLYPLRTFLVTSGVYPEHFDVMTADWVVVLSGEPFMVGV
FT                   SVSPRRYTHRLLKKHGEFVVAVPTLSMLRGVWLAGTESGPSKVPRLGFKLRRGEVVKAP
FT                   LVEDAVANLECRVVDSRVYGDHEFFAGEVVKEHYAPEAYPGMEPSLSAGFLLHVAGGRF
FT                   TTVSSVIHGAD"
FT   sig_peptide     547198..547263
FT                   /locus_tag="Desmu_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            547933..549552
FT                   /locus_tag="Desmu_0547"
FT   CDS_pept        547933..549552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0547"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR002293; KEGG: dka:DKAM_0746 amino acid transporter,
FT                   putative; SPTR: Amino acid transporter, putative; PFAM:
FT                   Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64857"
FT                   /db_xref="GOA:E8R8N1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N1"
FT                   /protein_id="ADV64857.1"
FT                   /translation="MSEEVVFTRRASGLVRELSWIDIALWSIATPAASGMTYYAVKALG
FT                   YPDTYGGNIALAFIVAGIIFLPLTIAFYLIVASFPRSNSMYVVVSRTLHPVLGYLPFWY
FT                   YIVGGGGAMCAGFIMYIGLKAFSGPLTVAGIATGSKGLLDAANAMVDPVIQLIVAVVLV
FT                   FILWLLNLGGMKVIKWTMRIGTVIPLVVTLATLIALASLGPGAGTKAFDAVYGEGASSK
FT                   IISAALDEKTAGSYGISALTPNSLFTGTYGMLFWTLWAWTGLEVTTFVGSEVKDPSRSY
FT                   LRGLLIGYIAVMLLYVFNAMVLPYVFGYDFLAAYAYLKSEHPEVLESILPGKPLPDPSV
FT                   PFYVSIAFPNPWLSIVVGLAYFLWYLNTAIPVWVAAVRGFFSMSFDRALPEKMASVSPR
FT                   FAAPTWANHVTALIGVLGAVVTYYESLGSELATALISWLDFSLFIFVWPVGLALALMPW
FT                   WRPDIFERTVFKSKIVTSVIGIIVFAIGWWLMLYTSYPEPTVQMLNILAGTIGIAIYVA
FT                   MMARNRARGIDPSKIYGQIPPA"
FT   gene            549604..550554
FT                   /locus_tag="Desmu_0548"
FT   CDS_pept        549604..550554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0548"
FT                   /product="Icc family phosphoesterase"
FT                   /note="COGs: COG2129 phosphoesterase related to the Icc
FT                   protein; KEGG: kcr:Kcr_0333 Icc family phosphoesterase;
FT                   SPTR: Icc family phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64858"
FT                   /db_xref="GOA:E8R8N2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N2"
FT                   /protein_id="ADV64858.1"
FT                   /translation="MLRIFFSVDVHGSTLVWRKWIKASEEYRVNALILAGDLTGKVLVP
FT                   IVSHPDGTWTARYFGSRWVMKSEAEVRSFEERLEGAGAYYVRVDERGLEELKANPDAVN
FT                   KVMFEKMAERFRSWLDFLTSRVDTGKVAVIVMPGNDDEPFIDDIIKAYADKGVIYPLER
FT                   VVELQGVEIVSSPFVNPTPWKTPRELEEKELEKHLEKQVSRLRDPSKAVFNFHAPPYNT
FT                   MLDLAPKLTRDLRVVTVAGVPQYEHVGSKAVRKVIERHQPLIGLHGHIHESGGQDTVGR
FT                   TIVVNPGSEYSEGVLKGYIIEIDGGRLLNYYRVEG"
FT   gene            550557..551396
FT                   /locus_tag="Desmu_0549"
FT   CDS_pept        550557..551396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kcr:Kcr_0334 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64859"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N3"
FT                   /protein_id="ADV64859.1"
FT                   /translation="MTHHFVGLPAEGFAEEAVGIVEKARERGVVLRIMGALGIYIHCRD
FT                   KPESLRLYDALGRFKDKGLVFTDLDLAAYGKQRGAVMDLFEKELGFKYDPYVKALFAGK
FT                   RLIYHHPGGLYHVDVFFDKLEFSHDVYLGDKPGKGVLELDYPTLPLAYLVLEKLQIHRI
FT                   NWKDLVDLAVIFHAHRLCGEGGGKADCIDEEAVATPLADDWGFWYDAVVNIGKVKDILA
FT                   EAVKQGKIQEADATLITGRLDRLLATIEAKPKTKNWVKRSKVGTSKPWYREVEELER"
FT   gene            551636..553207
FT                   /locus_tag="Desmu_0550"
FT   CDS_pept        551636..553207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0550"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   shc:Shell_0849 extracellular solute-binding protein family
FT                   5; PFAM: extracellular solute-binding protein family 5;
FT                   SPTR: Extracellular solute-binding protein family 5; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 5
FT                   Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64860"
FT                   /db_xref="GOA:E8R8N4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N4"
FT                   /protein_id="ADV64860.1"
FT                   /translation="MKALGKVAAVILVLAVAVAGVAVYMYVSSRQAGVKPPVEAKPVVI
FT                   GVTDSVTDLDPANAYDFFTWEILSNIMEGLVKYEPGTLNIVPGLAESWSTSQDQMTWTF
FT                   KLRSGLKFSDGTPLTARDVVRSIERVMRINGDPAWLVTDFVENVTAPDDVTVVFKLRKP
FT                   TPYFLSLLTTPPYFPVNPKYAQDKVDSDQTAGGAGPYRIASFQRDVEIRLEPNPYYYGE
FT                   KPKAPIIIKKYGSSSALRLALESGEIDVAWRTLNPSDIIALKSRSDVKVIEVPGTFIRY
FT                   ICLNTRLDPTSNKLVRQALAAAINRSEIIEVALKGAGQPLYSMIPVGMWSYVSVFKEKY
FT                   GDGNLELARSLLRQAGFSESKKLTIELWYTPTHYGDTEKDVAAILKEQLEKTGLITVTV
FT                   KSAEWSTYVDYARKGNMMMYLLGWYPDYLDPDDYTTPFLKSTANSWTGTGYANPTMDQL
FT                   LEQASSTGNQTLREQLYRQVQEILGEDVPYIPLYQGVLYIVARQGVEGIQPSPTMLFYY
FT                   WTVYKT"
FT   sig_peptide     551636..551731
FT                   /locus_tag="Desmu_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            553245..554261
FT                   /locus_tag="Desmu_0551"
FT   CDS_pept        553245..554261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0551"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: tsi:TSIB_1053 ABC-type dipeptide transport system,
FT                   permease component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR: ABC-type
FT                   dipeptide transport system, permease component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64861"
FT                   /db_xref="GOA:E8R8N5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N5"
FT                   /protein_id="ADV64861.1"
FT                   /translation="MPGLGRYLVIRALMIVPTVLILYTLVFIVLRVLPGDPVLAVVGTK
FT                   NISPEQLEYLRRLAGLDKPLYQQYVDYLIGVFKGDFGRTLANPVGKPVADYLAERLPAT
FT                   IELTVFAFIVSVVIGLSTGLAAAVKNRSRMDAAMRVYSIVSYSLFIPILGITLQYVFGV
FT                   LLKILPTGGRLSARYYVEPVTGFMLIDTLIAGDPGAFADAVAHLVLPSLTLGIVLSGSY
FT                   TRLVRNNMVEVLRSDFIRSYRARGIPEGRVLRYAFKNVLIPVVTYMGLQVAMLLGGAVL
FT                   TETTFSWPGIGRFIVERIEYRDYTSIQGVVVVYALIVGLVSLVVDAVYALIDPRVRY"
FT   sig_peptide     553245..553364
FT                   /locus_tag="Desmu_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            554261..555115
FT                   /locus_tag="Desmu_0552"
FT   CDS_pept        554261..555115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0552"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: tsi:TSIB_1054 ABC-type dipeptide transport system,
FT                   permease component; PFAM: binding-protein-dependent
FT                   transport systems inner membrane component; SPTR: ABC-type
FT                   dipeptide transport system, permease component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64862"
FT                   /db_xref="GOA:E8R8N6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N6"
FT                   /protein_id="ADV64862.1"
FT                   /translation="MTMLRNILGRVLKGFPPSSRFMAAAGLAIVSTIALMAVLAPLISP
FT                   YDPVARVAPPYQPPSLEHPFGVNHVGYDVLSRIIWGSRVVLYIVVLSAVLSMGIGVPLG
FT                   VVSGYYGGLLDRALSTVMDSIYAFPSLVLAIAVAAVLGPSPLNVAISLAVVYVPTYFRM
FT                   VRSEALRLKNMLFIEAMRLLGYPGHHIMMSILRNSAQTILVIFTLSTADAVLTEAALGY
FT                   LGLSITWPQPDWGLDLRSGQGEIINGYWWISMFPGFFIVLLSLGFALIGEALSDYFSVK
FT                   TRE"
FT   sig_peptide     554261..554410
FT                   /locus_tag="Desmu_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            555125..556066
FT                   /locus_tag="Desmu_0553"
FT   CDS_pept        555125..556066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0553"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterProIPR003439:
FT                   IPR003593: IPR017871: IPR010066: IPR 013563; KEGG:
FT                   apo:Arcpr_0086 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64863"
FT                   /db_xref="GOA:E8R8N7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N7"
FT                   /protein_id="ADV64863.1"
FT                   /translation="MLRVEGLKTYFYTLSGIVRAVDGVSIEVKEGEWVSIVGESGSGKS
FT                   TLAYSIVNLVPPPGRIVGGSIVFKGRDLLKLPESEMRSIRGGRIGFVFQDPLTSLDPLR
FT                   TVGDQLSEVIETHQGLNHKEALEKAARLLEEVGIPASRVKSYPHQLSGGQRQRIAIAMA
FT                   IALKPDLVIADEPTTALDVIVQDQIMDLFTGIKASGSSIILITHDIALASERSDRIVVM
FT                   YGGKVVEYGASRDIVERPGHPYTAGLIESVPDLWSDKQVKSIPGNPPDLRDPPKGCRFH
FT                   PRCPYASEECRVREPPLIDMGNGHYVACLLRR"
FT   sig_peptide     555125..555193
FT                   /locus_tag="Desmu_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            556073..557056
FT                   /locus_tag="Desmu_0554"
FT   CDS_pept        556073..557056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0554"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterProIPR003439:
FT                   IPR003593: IPR017871: IPR010066: IPR 013563; KEGG:
FT                   shc:Shell_0853 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64864"
FT                   /db_xref="GOA:E8R8N8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N8"
FT                   /protein_id="ADV64864.1"
FT                   /translation="METLVKTVDVAKYYYPKRDIGEILRGRRRVVKAVDGVTLDVYRGE
FT                   VLSIVGESGSGKTTLGRIMIGLEEPSKGTVLFHGKPLHELLEREKHVRLKAQMIYQDPY
FT                   SSLDPRVKIGDQLAKPLVIHRLANPEEARIRVMEMLKDVGLTPPEEVFERYPHQLSGGQ
FT                   RQRIAIARAMLVEPEFLVADEPVSMIDVSLRAGILELLMRFKERYGLTMVFITHDLSVA
FT                   KLISNRIAIMYLGKVVEVGDSRRVLENPLHPYTRALLSAVPSIHGRKIARLKITGEIPD
FT                   PFNIPSGCRFHPRCPYASEECRVREPGLVEAEKGHLVACFKPLLGP"
FT   gene            complement(557034..557771)
FT                   /locus_tag="Desmu_0555"
FT   CDS_pept        complement(557034..557771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0555"
FT                   /product="phosphoribosyltransferase"
FT                   /note="COGs: COG0503 Adenine/guanine
FT                   phosphoribosyltransferase and related PRPP-binding protein;
FT                   InterPro IPR000836; KEGG: dka:DKAM_0532 adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   SPTR: Adenine phosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64865"
FT                   /db_xref="GOA:E8R8N9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8N9"
FT                   /protein_id="ADV64865.1"
FT                   /translation="MGEDSLTRLDYRFMAVDLLKAYKELMDYRMLEEITGLDTQSLWRY
FT                   VRRGVKPNSKRAASLFNKLTSRDLVENLVKRELVEVGNGIYGLYRVAYNIPLLKVLSYV
FT                   AFREFRDCGVNTVATVESDGIPLATRIAEVMNAKLVVAKHRPEIGAKGYHQASYISRDP
FT                   PAYTILFTPADALSRRDRVLIVDDLLNTGKTSRALLQLVKAAGAKPVGLFSIISIGDSW
FT                   HRILSRELEKIYVVLMLTGLEAA"
FT   gene            complement(557837..557980)
FT                   /pseudo
FT                   /locus_tag="Desmu_0556"
FT   gene            558304..558720
FT                   /locus_tag="Desmu_0557"
FT   CDS_pept        558304..558720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dka:DKAM_0516 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64866"
FT                   /db_xref="GOA:E8R8P0"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8P0"
FT                   /protein_id="ADV64866.1"
FT                   /translation="MGGIHGRLARLSGVMVGVIELIVVVLVGVLTVLTIYVTIRDILVL
FT                   LENPASTGIQVLVTDIFTIIIYAEIIRSMSILSGKLGKSMLSSLAEIGFIVAIREALLT
FT                   ALTGKPMDLLVSSLSLLVATVVVYIVEDRLQGGA"
FT   sig_peptide     558304..558405
FT                   /locus_tag="Desmu_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            558816..559064
FT                   /locus_tag="Desmu_0558"
FT   CDS_pept        558816..559064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Desmu_0558"
FT                   /product="ferredoxin"
FT                   /note="InterPro IPR017896; KEGG: dka:DKAM_0514 ferredoxin;
FT                   SPTR: Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Desmu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADV64867"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E8R8P1"
FT                   /protein_id="ADV64867.1"
FT                   /translation="MAKYKVIVNRSICLACGAAVAACSEVFELGDDNGKNRVVAKYSVE
FT