(data stored in ACNUC7421 zone)

EMBL: CP002394

ID   CP002394; SV 1; circular; genomic DNA; STD; PRO; 4681672 BP.
XX
AC   CP002394; ADFH01000000-ADFH01000129;
XX
PR   Project:PRJNA38423;
XX
DT   29-DEC-2010 (Rel. 107, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Bacillus cellulosilyticus DSM 2522, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Bacillus cellulosilyticus DSM 2522
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4681672
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Jeffries C., Kyrpides N., Ivanova N., Mikhailova N., Brumm P., Mead D.,
RA   Woyke T.;
RT   "Complete sequence of Bacillus cellulosilyticus DSM 2522";
RL   Unpublished.
XX
RN   [2]
RP   1-4681672
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Jeffries C., Kyrpides N., Ivanova N., Mikhailova N., Brumm P., Mead D.,
RA   Woyke T.;
RT   ;
RL   Submitted (14-DEC-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; aedca6ae67bafdec7aabbceba2c5b222.
DR   BioSample; SAMN00007429.
DR   CABRI; DSM 2522.
DR   EnsemblGenomes-Gn; Bcell_R0001.
DR   EnsemblGenomes-Gn; Bcell_R0002.
DR   EnsemblGenomes-Gn; Bcell_R0003.
DR   EnsemblGenomes-Gn; Bcell_R0004.
DR   EnsemblGenomes-Gn; Bcell_R0005.
DR   EnsemblGenomes-Gn; Bcell_R0006.
DR   EnsemblGenomes-Gn; Bcell_R0007.
DR   EnsemblGenomes-Gn; Bcell_R0008.
DR   EnsemblGenomes-Gn; Bcell_R0009.
DR   EnsemblGenomes-Gn; Bcell_R0010.
DR   EnsemblGenomes-Gn; Bcell_R0011.
DR   EnsemblGenomes-Gn; Bcell_R0012.
DR   EnsemblGenomes-Gn; Bcell_R0013.
DR   EnsemblGenomes-Gn; Bcell_R0014.
DR   EnsemblGenomes-Gn; Bcell_R0015.
DR   EnsemblGenomes-Gn; Bcell_R0016.
DR   EnsemblGenomes-Gn; Bcell_R0017.
DR   EnsemblGenomes-Gn; Bcell_R0018.
DR   EnsemblGenomes-Gn; Bcell_R0019.
DR   EnsemblGenomes-Gn; Bcell_R0020.
DR   EnsemblGenomes-Gn; Bcell_R0021.
DR   EnsemblGenomes-Gn; Bcell_R0022.
DR   EnsemblGenomes-Gn; Bcell_R0023.
DR   EnsemblGenomes-Gn; Bcell_R0024.
DR   EnsemblGenomes-Gn; Bcell_R0025.
DR   EnsemblGenomes-Gn; Bcell_R0026.
DR   EnsemblGenomes-Gn; Bcell_R0027.
DR   EnsemblGenomes-Gn; Bcell_R0028.
DR   EnsemblGenomes-Gn; Bcell_R0029.
DR   EnsemblGenomes-Gn; Bcell_R0030.
DR   EnsemblGenomes-Gn; Bcell_R0031.
DR   EnsemblGenomes-Gn; Bcell_R0032.
DR   EnsemblGenomes-Gn; Bcell_R0033.
DR   EnsemblGenomes-Gn; Bcell_R0034.
DR   EnsemblGenomes-Gn; Bcell_R0035.
DR   EnsemblGenomes-Gn; Bcell_R0036.
DR   EnsemblGenomes-Gn; Bcell_R0037.
DR   EnsemblGenomes-Gn; Bcell_R0038.
DR   EnsemblGenomes-Gn; Bcell_R0039.
DR   EnsemblGenomes-Gn; Bcell_R0040.
DR   EnsemblGenomes-Gn; Bcell_R0041.
DR   EnsemblGenomes-Gn; Bcell_R0042.
DR   EnsemblGenomes-Gn; Bcell_R0043.
DR   EnsemblGenomes-Gn; Bcell_R0044.
DR   EnsemblGenomes-Gn; Bcell_R0045.
DR   EnsemblGenomes-Gn; Bcell_R0046.
DR   EnsemblGenomes-Gn; Bcell_R0047.
DR   EnsemblGenomes-Gn; Bcell_R0048.
DR   EnsemblGenomes-Gn; Bcell_R0049.
DR   EnsemblGenomes-Gn; Bcell_R0050.
DR   EnsemblGenomes-Gn; Bcell_R0051.
DR   EnsemblGenomes-Gn; Bcell_R0052.
DR   EnsemblGenomes-Gn; Bcell_R0053.
DR   EnsemblGenomes-Gn; Bcell_R0054.
DR   EnsemblGenomes-Gn; Bcell_R0055.
DR   EnsemblGenomes-Gn; Bcell_R0056.
DR   EnsemblGenomes-Gn; Bcell_R0057.
DR   EnsemblGenomes-Gn; Bcell_R0058.
DR   EnsemblGenomes-Gn; Bcell_R0059.
DR   EnsemblGenomes-Gn; Bcell_R0060.
DR   EnsemblGenomes-Gn; Bcell_R0061.
DR   EnsemblGenomes-Gn; Bcell_R0062.
DR   EnsemblGenomes-Gn; Bcell_R0063.
DR   EnsemblGenomes-Gn; Bcell_R0064.
DR   EnsemblGenomes-Gn; Bcell_R0065.
DR   EnsemblGenomes-Gn; Bcell_R0066.
DR   EnsemblGenomes-Gn; Bcell_R0067.
DR   EnsemblGenomes-Gn; Bcell_R0068.
DR   EnsemblGenomes-Gn; Bcell_R0069.
DR   EnsemblGenomes-Gn; Bcell_R0070.
DR   EnsemblGenomes-Gn; Bcell_R0071.
DR   EnsemblGenomes-Gn; Bcell_R0072.
DR   EnsemblGenomes-Gn; Bcell_R0073.
DR   EnsemblGenomes-Gn; Bcell_R0074.
DR   EnsemblGenomes-Gn; Bcell_R0075.
DR   EnsemblGenomes-Gn; Bcell_R0076.
DR   EnsemblGenomes-Gn; Bcell_R0077.
DR   EnsemblGenomes-Gn; Bcell_R0078.
DR   EnsemblGenomes-Gn; Bcell_R0079.
DR   EnsemblGenomes-Gn; Bcell_R0080.
DR   EnsemblGenomes-Gn; Bcell_R0081.
DR   EnsemblGenomes-Gn; Bcell_R0082.
DR   EnsemblGenomes-Gn; Bcell_R0083.
DR   EnsemblGenomes-Gn; Bcell_R0084.
DR   EnsemblGenomes-Gn; Bcell_R0085.
DR   EnsemblGenomes-Gn; Bcell_R0086.
DR   EnsemblGenomes-Gn; Bcell_R0087.
DR   EnsemblGenomes-Gn; Bcell_R0088.
DR   EnsemblGenomes-Gn; Bcell_R0089.
DR   EnsemblGenomes-Gn; Bcell_R0090.
DR   EnsemblGenomes-Gn; Bcell_R0091.
DR   EnsemblGenomes-Gn; Bcell_R0092.
DR   EnsemblGenomes-Gn; Bcell_R0093.
DR   EnsemblGenomes-Gn; Bcell_R0094.
DR   EnsemblGenomes-Gn; Bcell_R0095.
DR   EnsemblGenomes-Gn; Bcell_R0096.
DR   EnsemblGenomes-Gn; Bcell_R0097.
DR   EnsemblGenomes-Gn; Bcell_R0098.
DR   EnsemblGenomes-Gn; Bcell_R0099.
DR   EnsemblGenomes-Gn; Bcell_R0100.
DR   EnsemblGenomes-Gn; Bcell_R0101.
DR   EnsemblGenomes-Gn; Bcell_R0102.
DR   EnsemblGenomes-Gn; Bcell_R0103.
DR   EnsemblGenomes-Gn; Bcell_R0104.
DR   EnsemblGenomes-Gn; Bcell_R0105.
DR   EnsemblGenomes-Gn; Bcell_R0106.
DR   EnsemblGenomes-Gn; Bcell_R0107.
DR   EnsemblGenomes-Gn; Bcell_R0108.
DR   EnsemblGenomes-Gn; Bcell_R0109.
DR   EnsemblGenomes-Gn; Bcell_R0110.
DR   EnsemblGenomes-Gn; Bcell_R0111.
DR   EnsemblGenomes-Gn; Bcell_R0112.
DR   EnsemblGenomes-Gn; Bcell_R0113.
DR   EnsemblGenomes-Gn; Bcell_R0114.
DR   EnsemblGenomes-Gn; Bcell_R0115.
DR   EnsemblGenomes-Gn; Bcell_R0116.
DR   EnsemblGenomes-Gn; Bcell_R0117.
DR   EnsemblGenomes-Gn; EBG00001450296.
DR   EnsemblGenomes-Gn; EBG00001450297.
DR   EnsemblGenomes-Gn; EBG00001450298.
DR   EnsemblGenomes-Gn; EBG00001450299.
DR   EnsemblGenomes-Gn; EBG00001450300.
DR   EnsemblGenomes-Gn; EBG00001450301.
DR   EnsemblGenomes-Gn; EBG00001450302.
DR   EnsemblGenomes-Gn; EBG00001450303.
DR   EnsemblGenomes-Gn; EBG00001450304.
DR   EnsemblGenomes-Gn; EBG00001450305.
DR   EnsemblGenomes-Gn; EBG00001450306.
DR   EnsemblGenomes-Gn; EBG00001450307.
DR   EnsemblGenomes-Gn; EBG00001450308.
DR   EnsemblGenomes-Gn; EBG00001450309.
DR   EnsemblGenomes-Gn; EBG00001450310.
DR   EnsemblGenomes-Gn; EBG00001450311.
DR   EnsemblGenomes-Gn; EBG00001450312.
DR   EnsemblGenomes-Gn; EBG00001450313.
DR   EnsemblGenomes-Gn; EBG00001450314.
DR   EnsemblGenomes-Gn; EBG00001450315.
DR   EnsemblGenomes-Gn; EBG00001450316.
DR   EnsemblGenomes-Gn; EBG00001450317.
DR   EnsemblGenomes-Gn; EBG00001450318.
DR   EnsemblGenomes-Gn; EBG00001450319.
DR   EnsemblGenomes-Gn; EBG00001450320.
DR   EnsemblGenomes-Gn; EBG00001450321.
DR   EnsemblGenomes-Gn; EBG00001450322.
DR   EnsemblGenomes-Gn; EBG00001450323.
DR   EnsemblGenomes-Gn; EBG00001450324.
DR   EnsemblGenomes-Gn; EBG00001450325.
DR   EnsemblGenomes-Gn; EBG00001450326.
DR   EnsemblGenomes-Gn; EBG00001450327.
DR   EnsemblGenomes-Gn; EBG00001450328.
DR   EnsemblGenomes-Gn; EBG00001450329.
DR   EnsemblGenomes-Gn; EBG00001450330.
DR   EnsemblGenomes-Gn; EBG00001450331.
DR   EnsemblGenomes-Gn; EBG00001450332.
DR   EnsemblGenomes-Gn; EBG00001450333.
DR   EnsemblGenomes-Gn; EBG00001450334.
DR   EnsemblGenomes-Gn; EBG00001450335.
DR   EnsemblGenomes-Gn; EBG00001450336.
DR   EnsemblGenomes-Gn; EBG00001450337.
DR   EnsemblGenomes-Gn; EBG00001450338.
DR   EnsemblGenomes-Gn; EBG00001450339.
DR   EnsemblGenomes-Gn; EBG00001450340.
DR   EnsemblGenomes-Gn; EBG00001450341.
DR   EnsemblGenomes-Gn; EBG00001450342.
DR   EnsemblGenomes-Gn; EBG00001450343.
DR   EnsemblGenomes-Gn; EBG00001450344.
DR   EnsemblGenomes-Gn; EBG00001450345.
DR   EnsemblGenomes-Gn; EBG00001450346.
DR   EnsemblGenomes-Gn; EBG00001450347.
DR   EnsemblGenomes-Gn; EBG00001450348.
DR   EnsemblGenomes-Gn; EBG00001450349.
DR   EnsemblGenomes-Gn; EBG00001450350.
DR   EnsemblGenomes-Gn; EBG00001450351.
DR   EnsemblGenomes-Gn; EBG00001450352.
DR   EnsemblGenomes-Gn; EBG00001450353.
DR   EnsemblGenomes-Gn; EBG00001450354.
DR   EnsemblGenomes-Gn; EBG00001450355.
DR   EnsemblGenomes-Gn; EBG00001450356.
DR   EnsemblGenomes-Gn; EBG00001450357.
DR   EnsemblGenomes-Gn; EBG00001450358.
DR   EnsemblGenomes-Gn; EBG00001450359.
DR   EnsemblGenomes-Gn; EBG00001450360.
DR   EnsemblGenomes-Gn; EBG00001450361.
DR   EnsemblGenomes-Gn; EBG00001450362.
DR   EnsemblGenomes-Gn; EBG00001450363.
DR   EnsemblGenomes-Gn; EBG00001450364.
DR   EnsemblGenomes-Gn; EBG00001450365.
DR   EnsemblGenomes-Gn; EBG00001450366.
DR   EnsemblGenomes-Gn; EBG00001450367.
DR   EnsemblGenomes-Gn; EBG00001450368.
DR   EnsemblGenomes-Gn; EBG00001450369.
DR   EnsemblGenomes-Gn; EBG00001450370.
DR   EnsemblGenomes-Gn; EBG00001450371.
DR   EnsemblGenomes-Gn; EBG00001450372.
DR   EnsemblGenomes-Gn; EBG00001450373.
DR   EnsemblGenomes-Gn; EBG00001450374.
DR   EnsemblGenomes-Gn; EBG00001450375.
DR   EnsemblGenomes-Gn; EBG00001450376.
DR   EnsemblGenomes-Gn; EBG00001450377.
DR   EnsemblGenomes-Gn; EBG00001450378.
DR   EnsemblGenomes-Gn; EBG00001450379.
DR   EnsemblGenomes-Gn; EBG00001450380.
DR   EnsemblGenomes-Gn; EBG00001450381.
DR   EnsemblGenomes-Gn; EBG00001450382.
DR   EnsemblGenomes-Gn; EBG00001450383.
DR   EnsemblGenomes-Gn; EBG00001450384.
DR   EnsemblGenomes-Gn; EBG00001450385.
DR   EnsemblGenomes-Gn; EBG00001450386.
DR   EnsemblGenomes-Gn; EBG00001450387.
DR   EnsemblGenomes-Gn; EBG00001450388.
DR   EnsemblGenomes-Gn; EBG00001450389.
DR   EnsemblGenomes-Gn; EBG00001450390.
DR   EnsemblGenomes-Gn; EBG00001450391.
DR   EnsemblGenomes-Gn; EBG00001450392.
DR   EnsemblGenomes-Gn; EBG00001450393.
DR   EnsemblGenomes-Gn; EBG00001450394.
DR   EnsemblGenomes-Gn; EBG00001450395.
DR   EnsemblGenomes-Gn; EBG00001450396.
DR   EnsemblGenomes-Gn; EBG00001450397.
DR   EnsemblGenomes-Gn; EBG00001450398.
DR   EnsemblGenomes-Gn; EBG00001450399.
DR   EnsemblGenomes-Gn; EBG00001450400.
DR   EnsemblGenomes-Gn; EBG00001450401.
DR   EnsemblGenomes-Gn; EBG00001450402.
DR   EnsemblGenomes-Gn; EBG00001450403.
DR   EnsemblGenomes-Gn; EBG00001450404.
DR   EnsemblGenomes-Gn; EBG00001450405.
DR   EnsemblGenomes-Gn; EBG00001450406.
DR   EnsemblGenomes-Gn; EBG00001450407.
DR   EnsemblGenomes-Gn; EBG00001450408.
DR   EnsemblGenomes-Gn; EBG00001450409.
DR   EnsemblGenomes-Gn; EBG00001450410.
DR   EnsemblGenomes-Gn; EBG00001450411.
DR   EnsemblGenomes-Gn; EBG00001450412.
DR   EnsemblGenomes-Gn; EBG00001450413.
DR   EnsemblGenomes-Gn; EBG00001450414.
DR   EnsemblGenomes-Gn; EBG00001450415.
DR   EnsemblGenomes-Gn; EBG00001450416.
DR   EnsemblGenomes-Gn; EBG00001450417.
DR   EnsemblGenomes-Gn; EBG00001450418.
DR   EnsemblGenomes-Gn; EBG00001450419.
DR   EnsemblGenomes-Gn; EBG00001450420.
DR   EnsemblGenomes-Gn; EBG00001450421.
DR   EnsemblGenomes-Gn; EBG00001450422.
DR   EnsemblGenomes-Gn; EBG00001450423.
DR   EnsemblGenomes-Gn; EBG00001450424.
DR   EnsemblGenomes-Gn; EBG00001450425.
DR   EnsemblGenomes-Gn; EBG00001450426.
DR   EnsemblGenomes-Gn; EBG00001450427.
DR   EnsemblGenomes-Gn; EBG00001450428.
DR   EnsemblGenomes-Gn; EBG00001450429.
DR   EnsemblGenomes-Gn; EBG00001450430.
DR   EnsemblGenomes-Gn; EBG00001450431.
DR   EnsemblGenomes-Gn; EBG00001450432.
DR   EnsemblGenomes-Gn; EBG00001450433.
DR   EnsemblGenomes-Gn; EBG00001450434.
DR   EnsemblGenomes-Gn; EBG00001450435.
DR   EnsemblGenomes-Gn; EBG00001450436.
DR   EnsemblGenomes-Gn; EBG00001450437.
DR   EnsemblGenomes-Tr; Bcell_R0001-1.
DR   EnsemblGenomes-Tr; Bcell_R0002-1.
DR   EnsemblGenomes-Tr; Bcell_R0003-1.
DR   EnsemblGenomes-Tr; Bcell_R0004-1.
DR   EnsemblGenomes-Tr; Bcell_R0005-1.
DR   EnsemblGenomes-Tr; Bcell_R0006-1.
DR   EnsemblGenomes-Tr; Bcell_R0007-1.
DR   EnsemblGenomes-Tr; Bcell_R0008-1.
DR   EnsemblGenomes-Tr; Bcell_R0009-1.
DR   EnsemblGenomes-Tr; Bcell_R0010-1.
DR   EnsemblGenomes-Tr; Bcell_R0011-1.
DR   EnsemblGenomes-Tr; Bcell_R0012-1.
DR   EnsemblGenomes-Tr; Bcell_R0013-1.
DR   EnsemblGenomes-Tr; Bcell_R0014-1.
DR   EnsemblGenomes-Tr; Bcell_R0015-1.
DR   EnsemblGenomes-Tr; Bcell_R0016-1.
DR   EnsemblGenomes-Tr; Bcell_R0017-1.
DR   EnsemblGenomes-Tr; Bcell_R0018-1.
DR   EnsemblGenomes-Tr; Bcell_R0019-1.
DR   EnsemblGenomes-Tr; Bcell_R0020-1.
DR   EnsemblGenomes-Tr; Bcell_R0021-1.
DR   EnsemblGenomes-Tr; Bcell_R0022-1.
DR   EnsemblGenomes-Tr; Bcell_R0023-1.
DR   EnsemblGenomes-Tr; Bcell_R0024-1.
DR   EnsemblGenomes-Tr; Bcell_R0025-1.
DR   EnsemblGenomes-Tr; Bcell_R0026-1.
DR   EnsemblGenomes-Tr; Bcell_R0027-1.
DR   EnsemblGenomes-Tr; Bcell_R0028-1.
DR   EnsemblGenomes-Tr; Bcell_R0029-1.
DR   EnsemblGenomes-Tr; Bcell_R0030-1.
DR   EnsemblGenomes-Tr; Bcell_R0031-1.
DR   EnsemblGenomes-Tr; Bcell_R0032-1.
DR   EnsemblGenomes-Tr; Bcell_R0033-1.
DR   EnsemblGenomes-Tr; Bcell_R0034-1.
DR   EnsemblGenomes-Tr; Bcell_R0035-1.
DR   EnsemblGenomes-Tr; Bcell_R0036-1.
DR   EnsemblGenomes-Tr; Bcell_R0037-1.
DR   EnsemblGenomes-Tr; Bcell_R0038-1.
DR   EnsemblGenomes-Tr; Bcell_R0039-1.
DR   EnsemblGenomes-Tr; Bcell_R0040-1.
DR   EnsemblGenomes-Tr; Bcell_R0041-1.
DR   EnsemblGenomes-Tr; Bcell_R0042-1.
DR   EnsemblGenomes-Tr; Bcell_R0043-1.
DR   EnsemblGenomes-Tr; Bcell_R0044-1.
DR   EnsemblGenomes-Tr; Bcell_R0045-1.
DR   EnsemblGenomes-Tr; Bcell_R0046-1.
DR   EnsemblGenomes-Tr; Bcell_R0047-1.
DR   EnsemblGenomes-Tr; Bcell_R0048-1.
DR   EnsemblGenomes-Tr; Bcell_R0049-1.
DR   EnsemblGenomes-Tr; Bcell_R0050-1.
DR   EnsemblGenomes-Tr; Bcell_R0051-1.
DR   EnsemblGenomes-Tr; Bcell_R0052-1.
DR   EnsemblGenomes-Tr; Bcell_R0053-1.
DR   EnsemblGenomes-Tr; Bcell_R0054-1.
DR   EnsemblGenomes-Tr; Bcell_R0055-1.
DR   EnsemblGenomes-Tr; Bcell_R0056-1.
DR   EnsemblGenomes-Tr; Bcell_R0057-1.
DR   EnsemblGenomes-Tr; Bcell_R0058-1.
DR   EnsemblGenomes-Tr; Bcell_R0059-1.
DR   EnsemblGenomes-Tr; Bcell_R0060-1.
DR   EnsemblGenomes-Tr; Bcell_R0061-1.
DR   EnsemblGenomes-Tr; Bcell_R0062-1.
DR   EnsemblGenomes-Tr; Bcell_R0063-1.
DR   EnsemblGenomes-Tr; Bcell_R0064-1.
DR   EnsemblGenomes-Tr; Bcell_R0065-1.
DR   EnsemblGenomes-Tr; Bcell_R0066-1.
DR   EnsemblGenomes-Tr; Bcell_R0067-1.
DR   EnsemblGenomes-Tr; Bcell_R0068-1.
DR   EnsemblGenomes-Tr; Bcell_R0069-1.
DR   EnsemblGenomes-Tr; Bcell_R0070-1.
DR   EnsemblGenomes-Tr; Bcell_R0071-1.
DR   EnsemblGenomes-Tr; Bcell_R0072-1.
DR   EnsemblGenomes-Tr; Bcell_R0073-1.
DR   EnsemblGenomes-Tr; Bcell_R0074-1.
DR   EnsemblGenomes-Tr; Bcell_R0075-1.
DR   EnsemblGenomes-Tr; Bcell_R0076-1.
DR   EnsemblGenomes-Tr; Bcell_R0077-1.
DR   EnsemblGenomes-Tr; Bcell_R0078-1.
DR   EnsemblGenomes-Tr; Bcell_R0079-1.
DR   EnsemblGenomes-Tr; Bcell_R0080-1.
DR   EnsemblGenomes-Tr; Bcell_R0081-1.
DR   EnsemblGenomes-Tr; Bcell_R0082-1.
DR   EnsemblGenomes-Tr; Bcell_R0083-1.
DR   EnsemblGenomes-Tr; Bcell_R0084-1.
DR   EnsemblGenomes-Tr; Bcell_R0085-1.
DR   EnsemblGenomes-Tr; Bcell_R0086-1.
DR   EnsemblGenomes-Tr; Bcell_R0087-1.
DR   EnsemblGenomes-Tr; Bcell_R0088-1.
DR   EnsemblGenomes-Tr; Bcell_R0089-1.
DR   EnsemblGenomes-Tr; Bcell_R0090-1.
DR   EnsemblGenomes-Tr; Bcell_R0091-1.
DR   EnsemblGenomes-Tr; Bcell_R0092-1.
DR   EnsemblGenomes-Tr; Bcell_R0093-1.
DR   EnsemblGenomes-Tr; Bcell_R0094-1.
DR   EnsemblGenomes-Tr; Bcell_R0095-1.
DR   EnsemblGenomes-Tr; Bcell_R0096-1.
DR   EnsemblGenomes-Tr; Bcell_R0097-1.
DR   EnsemblGenomes-Tr; Bcell_R0098-1.
DR   EnsemblGenomes-Tr; Bcell_R0099-1.
DR   EnsemblGenomes-Tr; Bcell_R0100-1.
DR   EnsemblGenomes-Tr; Bcell_R0101-1.
DR   EnsemblGenomes-Tr; Bcell_R0102-1.
DR   EnsemblGenomes-Tr; Bcell_R0103-1.
DR   EnsemblGenomes-Tr; Bcell_R0104-1.
DR   EnsemblGenomes-Tr; Bcell_R0105-1.
DR   EnsemblGenomes-Tr; Bcell_R0106-1.
DR   EnsemblGenomes-Tr; Bcell_R0107-1.
DR   EnsemblGenomes-Tr; Bcell_R0108-1.
DR   EnsemblGenomes-Tr; Bcell_R0109-1.
DR   EnsemblGenomes-Tr; Bcell_R0110-1.
DR   EnsemblGenomes-Tr; Bcell_R0111-1.
DR   EnsemblGenomes-Tr; Bcell_R0112-1.
DR   EnsemblGenomes-Tr; Bcell_R0113-1.
DR   EnsemblGenomes-Tr; Bcell_R0114-1.
DR   EnsemblGenomes-Tr; Bcell_R0115-1.
DR   EnsemblGenomes-Tr; Bcell_R0116-1.
DR   EnsemblGenomes-Tr; Bcell_R0117-1.
DR   EnsemblGenomes-Tr; EBT00001604418.
DR   EnsemblGenomes-Tr; EBT00001604419.
DR   EnsemblGenomes-Tr; EBT00001604420.
DR   EnsemblGenomes-Tr; EBT00001604421.
DR   EnsemblGenomes-Tr; EBT00001604422.
DR   EnsemblGenomes-Tr; EBT00001604423.
DR   EnsemblGenomes-Tr; EBT00001604424.
DR   EnsemblGenomes-Tr; EBT00001604425.
DR   EnsemblGenomes-Tr; EBT00001604426.
DR   EnsemblGenomes-Tr; EBT00001604427.
DR   EnsemblGenomes-Tr; EBT00001604428.
DR   EnsemblGenomes-Tr; EBT00001604429.
DR   EnsemblGenomes-Tr; EBT00001604430.
DR   EnsemblGenomes-Tr; EBT00001604431.
DR   EnsemblGenomes-Tr; EBT00001604432.
DR   EnsemblGenomes-Tr; EBT00001604433.
DR   EnsemblGenomes-Tr; EBT00001604434.
DR   EnsemblGenomes-Tr; EBT00001604435.
DR   EnsemblGenomes-Tr; EBT00001604436.
DR   EnsemblGenomes-Tr; EBT00001604437.
DR   EnsemblGenomes-Tr; EBT00001604438.
DR   EnsemblGenomes-Tr; EBT00001604439.
DR   EnsemblGenomes-Tr; EBT00001604440.
DR   EnsemblGenomes-Tr; EBT00001604441.
DR   EnsemblGenomes-Tr; EBT00001604442.
DR   EnsemblGenomes-Tr; EBT00001604443.
DR   EnsemblGenomes-Tr; EBT00001604444.
DR   EnsemblGenomes-Tr; EBT00001604445.
DR   EnsemblGenomes-Tr; EBT00001604446.
DR   EnsemblGenomes-Tr; EBT00001604447.
DR   EnsemblGenomes-Tr; EBT00001604448.
DR   EnsemblGenomes-Tr; EBT00001604449.
DR   EnsemblGenomes-Tr; EBT00001604450.
DR   EnsemblGenomes-Tr; EBT00001604451.
DR   EnsemblGenomes-Tr; EBT00001604452.
DR   EnsemblGenomes-Tr; EBT00001604453.
DR   EnsemblGenomes-Tr; EBT00001604454.
DR   EnsemblGenomes-Tr; EBT00001604455.
DR   EnsemblGenomes-Tr; EBT00001604456.
DR   EnsemblGenomes-Tr; EBT00001604457.
DR   EnsemblGenomes-Tr; EBT00001604458.
DR   EnsemblGenomes-Tr; EBT00001604459.
DR   EnsemblGenomes-Tr; EBT00001604460.
DR   EnsemblGenomes-Tr; EBT00001604461.
DR   EnsemblGenomes-Tr; EBT00001604462.
DR   EnsemblGenomes-Tr; EBT00001604463.
DR   EnsemblGenomes-Tr; EBT00001604464.
DR   EnsemblGenomes-Tr; EBT00001604465.
DR   EnsemblGenomes-Tr; EBT00001604466.
DR   EnsemblGenomes-Tr; EBT00001604467.
DR   EnsemblGenomes-Tr; EBT00001604468.
DR   EnsemblGenomes-Tr; EBT00001604469.
DR   EnsemblGenomes-Tr; EBT00001604470.
DR   EnsemblGenomes-Tr; EBT00001604471.
DR   EnsemblGenomes-Tr; EBT00001604472.
DR   EnsemblGenomes-Tr; EBT00001604473.
DR   EnsemblGenomes-Tr; EBT00001604474.
DR   EnsemblGenomes-Tr; EBT00001604475.
DR   EnsemblGenomes-Tr; EBT00001604476.
DR   EnsemblGenomes-Tr; EBT00001604477.
DR   EnsemblGenomes-Tr; EBT00001604478.
DR   EnsemblGenomes-Tr; EBT00001604479.
DR   EnsemblGenomes-Tr; EBT00001604480.
DR   EnsemblGenomes-Tr; EBT00001604481.
DR   EnsemblGenomes-Tr; EBT00001604482.
DR   EnsemblGenomes-Tr; EBT00001604483.
DR   EnsemblGenomes-Tr; EBT00001604484.
DR   EnsemblGenomes-Tr; EBT00001604485.
DR   EnsemblGenomes-Tr; EBT00001604486.
DR   EnsemblGenomes-Tr; EBT00001604487.
DR   EnsemblGenomes-Tr; EBT00001604488.
DR   EnsemblGenomes-Tr; EBT00001604489.
DR   EnsemblGenomes-Tr; EBT00001604490.
DR   EnsemblGenomes-Tr; EBT00001604491.
DR   EnsemblGenomes-Tr; EBT00001604492.
DR   EnsemblGenomes-Tr; EBT00001604493.
DR   EnsemblGenomes-Tr; EBT00001604494.
DR   EnsemblGenomes-Tr; EBT00001604495.
DR   EnsemblGenomes-Tr; EBT00001604496.
DR   EnsemblGenomes-Tr; EBT00001604497.
DR   EnsemblGenomes-Tr; EBT00001604498.
DR   EnsemblGenomes-Tr; EBT00001604499.
DR   EnsemblGenomes-Tr; EBT00001604500.
DR   EnsemblGenomes-Tr; EBT00001604501.
DR   EnsemblGenomes-Tr; EBT00001604502.
DR   EnsemblGenomes-Tr; EBT00001604503.
DR   EnsemblGenomes-Tr; EBT00001604504.
DR   EnsemblGenomes-Tr; EBT00001604505.
DR   EnsemblGenomes-Tr; EBT00001604506.
DR   EnsemblGenomes-Tr; EBT00001604507.
DR   EnsemblGenomes-Tr; EBT00001604508.
DR   EnsemblGenomes-Tr; EBT00001604509.
DR   EnsemblGenomes-Tr; EBT00001604510.
DR   EnsemblGenomes-Tr; EBT00001604511.
DR   EnsemblGenomes-Tr; EBT00001604512.
DR   EnsemblGenomes-Tr; EBT00001604513.
DR   EnsemblGenomes-Tr; EBT00001604514.
DR   EnsemblGenomes-Tr; EBT00001604515.
DR   EnsemblGenomes-Tr; EBT00001604516.
DR   EnsemblGenomes-Tr; EBT00001604517.
DR   EnsemblGenomes-Tr; EBT00001604518.
DR   EnsemblGenomes-Tr; EBT00001604519.
DR   EnsemblGenomes-Tr; EBT00001604520.
DR   EnsemblGenomes-Tr; EBT00001604521.
DR   EnsemblGenomes-Tr; EBT00001604522.
DR   EnsemblGenomes-Tr; EBT00001604523.
DR   EnsemblGenomes-Tr; EBT00001604524.
DR   EnsemblGenomes-Tr; EBT00001604525.
DR   EnsemblGenomes-Tr; EBT00001604526.
DR   EnsemblGenomes-Tr; EBT00001604527.
DR   EnsemblGenomes-Tr; EBT00001604528.
DR   EnsemblGenomes-Tr; EBT00001604529.
DR   EnsemblGenomes-Tr; EBT00001604530.
DR   EnsemblGenomes-Tr; EBT00001604531.
DR   EnsemblGenomes-Tr; EBT00001604532.
DR   EnsemblGenomes-Tr; EBT00001604533.
DR   EnsemblGenomes-Tr; EBT00001604534.
DR   EnsemblGenomes-Tr; EBT00001604535.
DR   EnsemblGenomes-Tr; EBT00001604536.
DR   EnsemblGenomes-Tr; EBT00001604537.
DR   EnsemblGenomes-Tr; EBT00001604538.
DR   EnsemblGenomes-Tr; EBT00001604539.
DR   EnsemblGenomes-Tr; EBT00001604540.
DR   EnsemblGenomes-Tr; EBT00001604541.
DR   EnsemblGenomes-Tr; EBT00001604542.
DR   EnsemblGenomes-Tr; EBT00001604543.
DR   EnsemblGenomes-Tr; EBT00001604544.
DR   EnsemblGenomes-Tr; EBT00001604545.
DR   EnsemblGenomes-Tr; EBT00001604546.
DR   EnsemblGenomes-Tr; EBT00001604547.
DR   EnsemblGenomes-Tr; EBT00001604548.
DR   EnsemblGenomes-Tr; EBT00001604549.
DR   EnsemblGenomes-Tr; EBT00001604550.
DR   EnsemblGenomes-Tr; EBT00001604551.
DR   EnsemblGenomes-Tr; EBT00001604552.
DR   EnsemblGenomes-Tr; EBT00001604553.
DR   EnsemblGenomes-Tr; EBT00001604554.
DR   EnsemblGenomes-Tr; EBT00001604555.
DR   EnsemblGenomes-Tr; EBT00001604556.
DR   EnsemblGenomes-Tr; EBT00001604557.
DR   EnsemblGenomes-Tr; EBT00001604558.
DR   EnsemblGenomes-Tr; EBT00001604559.
DR   EuropePMC; PMC3617157; 23593409.
DR   GOA; P0DJ97.
DR   GOA; P0DJ98.
DR   InterPro; IPR011493; GLUG.
DR   InterPro; IPR013378; Listeria/Bacterioides_rpt.
DR   InterPro; IPR025883; Cadherin-like_b_sandwich.
DR   InterPro; IPR042229; Listeria/Bacterioides_rpt_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP002394.
DR   SILVA-SSU; CP002394.
DR   StrainInfo; 158031; 1.
DR   UniProtKB/Swiss-Prot; P0DJ97; Y380_BACCJ.
DR   UniProtKB/Swiss-Prot; P0DJ98; Y381_BACCJ.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086228
CC   Source DNA available from David Mead (dmead@lucigen.com)
CC   Organism available from DSMZ: DSM 2522
CC   Contacts: David Mead (dmead@lucigen.com)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Bacillus cellulosilyticus N-4, DSM 2522
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Soil
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 2522, ATCC 21833, FERM P-1141, JCM 9156
CC   biotic_relationship :: Free living
CC   trophic_level       :: Missing
CC   rel_to_oxygen       :: Facultative
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi06090
CC   Type Strain         :: Yes
CC   Funding Program     :: DOE-GLBRC 2008
CC   Gene Calling Method :: Prodigal
CC   Isolation Site      :: Soil
CC   Cell Shape          :: Rod-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Sporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 37C
CC   Gram Staining       :: Gram+
CC   Diseases            :: None
CC   Phenotypes          :: Alkaliphile
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: 454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4681672
FT                   /organism="Bacillus cellulosilyticus DSM 2522"
FT                   /strain="DSM 2522"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="soil"
FT                   /db_xref="taxon:649639"
FT   gene            139..1494
FT                   /locus_tag="Bcell_0001"
FT   CDS_pept        139..1494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   chromosomal replication initiator protein DnaA; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28293"
FT                   /db_xref="GOA:E6TRJ9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRJ9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU28293.1"
FT                   /translation="MENLNDLWDQALKKIEEKVSKPSFDTWFKFTKADSIDQSTNTITV
FT                   IAPNEFARDWLENRYFAIITETLNELTGAELEARFILPKEDKNDDIELLEKVKSPSKAP
FT                   VTTNDEKPKHMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKT
FT                   HLMHAIGHYVIDHKPNAKVVYLSSEKFTNEFINSIRDNKAVNFRNKYRNVDVLLIDDIQ
FT                   FLAGKEQTQEEFFHTFNALHEERKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPP
FT                   DLETRIAILRKKAKAENLDIPNEVMLYIANQIDTNIRELEGALIRVVAYSSLINQDMNA
FT                   DLAAVALKDIIPNAKPKTITIKDIQKTVAETFQIRVEELKAKKRTKNVAYPRQIAMYLS
FT                   RELTDNSLPKIGTEFGGRDHTTVIHAHEKITKLFSTDSDLQKQIQEIKDQLK"
FT   gene            1869..3011
FT                   /locus_tag="Bcell_0002"
FT   CDS_pept        1869..3011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: bpf:BpOF4_07960 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28294"
FT                   /db_xref="GOA:E6TRK0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK0"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADU28294.1"
FT                   /translation="MKFSINRDQFVQSVQHVSKAISPRTTIPVLTGIKIEASFDGVTLT
FT                   GSDSDISIESFIPLEDEEIQNVELEQPGSIVLPARFFAEIVKKLPEDTIELSVSEQFVT
FT                   TLKSGSSVFNLNGLDPNEYPRLPEIEEDNVFKLKTDLLKNIIRQTVFAVSTVETRPILT
FT                   GVHWAIEEGTLACTATDSHRLAMRNAKAETNTNDLSFSNVVIPGKSLNELSKILDDNEE
FT                   WVDIIVTENQILFKAKNLLFFSRLLDGNYPATNNMIPTNSKTNVKLETKKFMQAIERAL
FT                   LLSRDGKNNVVNLKTLSNTHLEITSVTPEVGKVTEDVATLDFNGEELRISFNGKNIIDA
FT                   LRVIDSTEVTIDFTGAMSPFVIKPTEHENMLHLFSPVRTY"
FT   gene            3217..3447
FT                   /locus_tag="Bcell_0003"
FT   CDS_pept        3217..3447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: lsl:LSL_0003
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28295"
FT                   /db_xref="GOA:E6TRK1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK1"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADU28295.1"
FT                   /translation="MENLEQKVTIHDDYITLGQLLKEVGLISTGGQAKWFLQDTLVVVN
FT                   EENENRRGKKLYAGDVIVIDDFGSILIEKES"
FT   gene            3451..4572
FT                   /locus_tag="Bcell_0004"
FT   CDS_pept        3451..4572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: DNA replication and repair protein RecF;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28296"
FT                   /db_xref="GOA:E6TRK2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK2"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADU28296.1"
FT                   /translation="MYIKQITIRDYRNYDHLTLPFNNKINVIIGENAQGKTNLMESIYV
FT                   LAMAKSHRTTKDKELIRWDQPFAKVEGQINNKNGPLQMEVIFSTKGKKVKINHLEKKRL
FT                   SEYIGSCNIVMFAPEDLSLVKGSPQIRRRFLDMEMGQIHPVYLYYLSQYHKQLKQRNQW
FT                   LKDVLQKKQKPDATMLDVMTDQLIISAGHVIEKRYDFIKKLQKWAAPIHHDISRGLESL
FT                   EINYVPSINVSEDMDLSTLLTVLKEEFDRLKDNELRRGITLIGPHRDDLQFLVNGRDIQ
FT                   TFGSQGQQRTTALSVKLAELELIHEKVGEYPILLLDDVLSELDDHRQSHLLNTIQGKVQ
FT                   TFVTTTSVDGIEHATLRNADMFYVQEGKIEVKK"
FT   gene            4583..4852
FT                   /locus_tag="Bcell_0005"
FT   CDS_pept        4583..4852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28297"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK3"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0005"
FT                   /protein_id="ADU28297.1"
FT                   /translation="MFIHLGADMVIRANKIIAILDHQSKDLSQDNLDFIDYQIKNKKTV
FT                   AITDDDNPKSIVVTDKEVYLSPISSQTLKRRAETVTILDEEEMM"
FT   gene            4948..6870
FT                   /locus_tag="Bcell_0006"
FT   CDS_pept        4948..6870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: DNA gyrase, B subunit; PFAM: DNA topoisomerase type
FT                   IIA subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain-containing protein;
FT                   DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28298"
FT                   /db_xref="GOA:E6TRK4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADU28298.1"
FT                   /translation="MKKLTMEQQSYDESQIQVLEGLEAVRKRPGMYIGSTSGRGLHHLV
FT                   WEIVDNSIDEAMAGYCDTITVTIEEDNSITVEDNGRGIPVGIHEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVEVHLDGKVHYQMFERGVPSADLKVIG
FT                   ETDKTGTIIKFKPDNEIFTETTEYDYDTLANRLRELAFLNRGLRILISDKRNDGKKAEY
FT                   FYEGGISSFVEHLNRTKEPIHEPPVFIESEKDGISVEIAMQYNDSFASNLYSFANNINT
FT                   HEGGTHESGFKTALTRVINDYARKNSLFKETDPNLIGDDVREGLTAIISVKIPDPQFEG
FT                   QTKTKLGNSEARTITDSLFSEHMAKYMAENPNVARKIVEKGIMASRARDAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDATISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILN
FT                   VEKSRLDKILSNNEVRAIITALGTGIGGDFDISKARYHKIIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRPLLEEGYVYIAQPPLFKIQQGKTVQYAYNEKEMERIIKELAETPKPGLQRYK
FT                   GLGEMNPTQLWETTMDPSTRTTLQVTLEDAMVADETFETLMGDKVEPRREFIQANAQYV
FT                   KNLDI"
FT   gene            7044..9575
FT                   /locus_tag="Bcell_0007"
FT   CDS_pept        7044..9575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: DNA gyrase, A
FT                   subunit; PFAM: DNA gyrase/topoisomerase IV subunit A; DNA
FT                   gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28299"
FT                   /db_xref="GOA:E6TRK5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK5"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADU28299.1"
FT                   /translation="MSEQDQSRVKEINISQEMKTSFMDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNELGMTSDKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSYRYMLV
FT                   DGHGNFGSVDGDAAAAMRYTEARMSKISMELVRDINKDTIDYQENYDGSETEPIVLPAR
FT                   FPNLLVNGTSGIAVGMATNIPPHNLGEVIDGVLALSENPTITSTELMEYIPGPDFPTGA
FT                   EIVGVSGIRRAYETGKGSITIRAKAEIEDNNGKPRIIVTEIPYQVNKARLIEKIAELVR
FT                   DKKLDGITDLRDESDRTGMRIVIELRRDVNANVLLNNLYKQTALQSSFGINMLALVDGR
FT                   PKVLSIKEVLYHYLEHQRVVIRRRTEFELKKAEARAHILEGLRIALDHIDEIIALIRGS
FT                   QTTEIARQGLMENFSLSHDQAQAILDMRLQRLTGLERDKIEAEYQELVEKIKELKAILA
FT                   DDEKVLAIIREELTDIRDRYNDERRTIITFGEDSMEDEDLIPRQNVVITLSHNGYIKRI
FT                   PLSTYRSQKRGGRGVQGMGTHDDDFVQHLFITNSHDHLLFFTNKGKVYRLKGYEIPSFN
FT                   RTAKGIPIINLLQIEKDEYVSTVIPVDEFDEERYLFFMTKDGIAKRTALKVFSNIRRGG
FT                   LFAINLREGDALHGVRLTDGTKEIIAGTRKGMSIRFHENDVRLMGRTATGVKGVTLQEN
FT                   DQVVGMDTIEEDQAVLIVTEKGFGKRTPVSEYRIQTRGGKGIKTCNITDKNGPLISLKV
FT                   VSDDHDLMIITNSGVIIRMHVEEISTTGRNTQGVRLIRVGDEEHVSTVARVNIDDDEEI
FT                   IDEQEESMEDSDLNNSEENEVAEADVNKEEE"
FT   gene            9819..11411
FT                   /locus_tag="Bcell_0008"
FT   CDS_pept        9819..11411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0008"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bha:BH1306 catalase; PFAM: Catalase related
FT                   subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28300"
FT                   /db_xref="GOA:E6TRK6"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK6"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADU28300.1"
FT                   /translation="MSKETNEHTSAQHDELTNRQGHPVTNNQNVRTVGNRGPTTLENYD
FT                   FLEKISHFDRERIPERVVHARGAGAHGYFEAYGTVGDEPISKYTRAKLFQEKGKQTPVF
FT                   VRFSSVVHGGHSPETLRDPRGFAVKFYTEDGNWDLVGNNLKIFFIRDPLKFPDLVHAFK
FT                   PDPVTNLQDGERIFDFISQTPEAMHMITFLFSPWGIPANYRLMQGSGVNTYKWVNEEGK
FT                   GHLVKYHWEPKQGIKNLTQDEAEKIQGKNFNHATQDLYEAIENGDYPEWELFVQIISDD
FT                   EHPELNYDPLDPTKLWYKDDIPWQPVGKMVLNKNPEDYFAEVEQAAFGTGVLVDGLDFS
FT                   DDKLLQGRTFSYSDTQRYRVGTNYLKLPINAPKKDVATNQRGGQMEYVVDKGKTQNPHV
FT                   NYEPSIIGGLKEANQKGKEHTPYVEGELKRETIDRQNNFEQAGETYRRLSDWERDDLIK
FT                   NLVTTLTPCRKEIKQTMIDMFMKCDKEYGQRVADGISKMEDENTSHRNPIGNAEADEAV
FT                   EQAEKLGHPSDPY"
FT   gene            11897..12973
FT                   /locus_tag="Bcell_0009"
FT   CDS_pept        11897..12973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0009"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28301"
FT                   /db_xref="GOA:E6TRK7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK7"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADU28301.1"
FT                   /translation="MKVKIEYLIPGTILAEDIYKKTNTPIMKKKTVLTNELINILKIFM
FT                   VPSVTIENKLENGSLFKANSVIVEDAKRKDTIEDPFIDRYLFAVQQFKKLFNHWQGGTK
FT                   VDAFAVRKVFLPLYNKTPKKEDLIQLHHYSNKNEYIYFHSVAVSVLSSLVGRKMGLSNG
FT                   EVIQLGLSGLLSDCGMAKLPFNVFEKKGALTIDEYEQVKTHPLFGYRMLEDVAGFTKEA
FT                   LLGVLQHHEREDGSGYQYKLKSNKIHLFAKIISICDIYHAMTSERHYRTKKSPYKVIES
FT                   LRKEHFGKIDHIVLHHFTQVILDLSIGTKVRLSSNDIGEIVFLDEKEPTRPTIKLENGN
FT                   LFELTSHHDVYVEEQLLE"
FT   gene            13276..14818
FT                   /locus_tag="Bcell_R0001"
FT   rRNA            13276..14818
FT                   /locus_tag="Bcell_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            15152..18082
FT                   /locus_tag="Bcell_R0002"
FT   rRNA            15152..18082
FT                   /locus_tag="Bcell_R0002"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            18152..18267
FT                   /locus_tag="Bcell_R0003"
FT   rRNA            18152..18267
FT                   /locus_tag="Bcell_R0003"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 97.23"
FT   gene            complement(19738..20679)
FT                   /locus_tag="Bcell_0010"
FT   CDS_pept        complement(19738..20679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B5307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28302"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK8"
FT                   /inference="similar to AA sequence:KEGG:BCG9842_B5307"
FT                   /protein_id="ADU28302.1"
FT                   /translation="MYNDISFITLFKSVEYVKKYLYERYKEAGFSSPKELAFQNSYSFV
FT                   YYIELGQSYFEQGKKAPLSIKPVLFFYGLSHWLKGALLTIDPNYPATTQVLAHGVSTRK
FT                   RKKQGYRFLTDEIKIQKEGFYPYVSKSLFNIKELTGEKYKMRHLIMSIPELAFLIEKFE
FT                   GESILIQVNKVQNKVYAPLSLLKKMKITPRRFELMIKEKTNTIVQCIEKEENLIISYSG
FT                   NNDKNNFPLYYNLNDKKYYLPSVPHLYLKIPEILSHFLLLYNLSMICRYETEWWGELLY
FT                   SFSSNDRPYIQSFLDCTERKTPYLMESLFKAK"
FT   gene            20817..22274
FT                   /locus_tag="Bcell_0011"
FT   CDS_pept        20817..22274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0011"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG: bha:BH0020
FT                   inosine 5'-monophosphate dehydrogenase; PFAM: IMP
FT                   dehydrogenase/GMP reductase; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28303"
FT                   /db_xref="GOA:E6TRK9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRK9"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADU28303.1"
FT                   /translation="MWENKFAKEGLTFDDVLLVPARSEVLPKDVSVKTKLSDTLQLNIP
FT                   IISAGMDTVTEAKMAIAIAREGGLGIIHKNMSIEEQAEQVDRVKRSESGVITNPFFLSE
FT                   NHQVFDAEHLMSKYRISGVPIADENQKLVGIITNRDLRFIEDYSIPIKDVMTKEGLVTA
FT                   PVGTTLAEAQKVLQKYKIEKLPLVDDNGVLKGLITIKDIEKAIEFPNSAKDTQGRLVVG
FT                   AAVGVGGDSDTRTDALVNAGIDVLVIDTAHGHSQGVLNKVREVRNKYPDLNIIAGNVAT
FT                   AEATRDLIEAGANIIKVGIGPGSICTTRIVAGIGVPQMTAVYDCATEARKHGIPIIADG
FT                   GIKYSGDIVKALAAGAHTVMLGSLLAGVSESPGETEIFQGRQFKVYRGMGSLGAMEKGS
FT                   KDRYFQEGNQKLVPEGIEGRTPFKGPLKDTIHQLVGGVRAGMGYCGTKDLVVLRDESKF
FT                   VRITNAGLKESHPHDVQITKEAPNYSL"
FT   gene            22438..23877
FT                   /locus_tag="Bcell_0012"
FT   CDS_pept        22438..23877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0012"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28304"
FT                   /db_xref="GOA:E6TRL0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL0"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADU28304.1"
FT                   /translation="MLLKRMGMIGLLIIFTFTSLLTGVTTTKADYESDLLETGILVDAD
FT                   TGKILYGRNIDQPLPPASMVKMMSIYLIHESIEKGDISWDDIVYINDYLVNDLSKQINL
FT                   SNVPLRKDEDYTVRELYESIAIYSANASMMAVAEHIAGSEGSFVEMMNEKGKELGMGNL
FT                   LREEGEKHGISNLNEIAEANLGDFQFVNSTGLPNSVLLENRPSGTEIDDDNFMSARATA
FT                   TLAYHLLNDYPEVLETASIPEMTFKEGTEDAIVMPNWNKMLEGRGHFYEYADGLKTGTT
FT                   TAAGACFTGTAVKNGRRLITVVMGLPRPLTSRPEDDLARYDETRKLMEYGFNNFSRVEL
FT                   YPENMTIEGFEEIPVVKGKEDVVSISTTDAVSAFVHRNDEESYQYSVVFNEDDELFDSE
FT                   GRLIAPIEANTVIGQLVVEYVGDGEEEYLLGNGASARTVDIVTNEAVEKAGWFSLTMRG
FT                   IGDFFSGLWNSIVNALGGGSE"
FT   gene            24156..25043
FT                   /locus_tag="Bcell_0013"
FT   CDS_pept        24156..25043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0013"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: bpf:BpOF4_08010 pyridoxal biosynthesis lyase
FT                   PdxS; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; Indole-3-glycerol
FT                   phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28305"
FT                   /db_xref="GOA:E6TRL1"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL1"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADU28305.1"
FT                   /translation="MEKQVGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMADPTIVEEVQNAVTIPVMAKARIGHIVEARVLEAMGVDYIDE
FT                   SEVLTPADEVYHLYKRDYTVPFVCGARDIGEASRRIAEGASMIRTKGEPGTGNIVEAVR
FT                   HMRMMQSQIKEVINMSVDEIMTYAKNTGSPFEVLLNIKENGKLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSDNPAKFARAIVEATTHYEDYALIAELSKNLGTAMKGIEI
FT                   STLEQKDRMQERGW"
FT   gene            25082..25666
FT                   /locus_tag="Bcell_0014"
FT   CDS_pept        25082..25666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0014"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="KEGG: SNO glutamine amidotransferase; TIGRFAM: SNO
FT                   glutamine amidotransferase; PFAM: SNO glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28306"
FT                   /db_xref="GOA:E6TRL2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL2"
FT                   /inference="protein motif:TFAM:TIGR03800"
FT                   /protein_id="ADU28306.1"
FT                   /translation="MINIGVLALQGAVREHVQAIEANDVNVVIVKKVEQLEDIDGLVFP
FT                   GGESTTMRRLINKYGFYEPLKDFGKNGKPIFGTCAGAILMAKELVGHAEPHIALMDMKV
FT                   ERNAFGRQRESFEALLKVKGIGDDVQGVFIRAPIIVEVGKDVEVLAEYEGEIVAARQGP
FT                   FLACSYHPELTDDVRMHQYFVNMVRNIVVPT"
FT   gene            25982..27259
FT                   /locus_tag="Bcell_0015"
FT   CDS_pept        25982..27259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0015"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG:
FT                   bpf:BpOF4_08020 seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Seryl-tRNA synthetase,
FT                   class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28307"
FT                   /db_xref="GOA:E6TRL3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL3"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADU28307.1"
FT                   /translation="MLDVKLLRSSFDEVKAKLEHRNEDISELDRFGELDETRRQLIQEV
FT                   EDLKNRRNTVSQEISQLKREKKNADDLIKEMKDVSTKVKELDDKLREVDSTLSQILLSI
FT                   PNIPHESAPIGATEDENEEVRKWGEVPAFDFEHQAHWDIATNLGILDFERAAKVTGSRF
FT                   VFYKGLGARLERALINFMMDLHQDEHGYEEILPPYMVNRDSMTGTGQLPKFEEDAFKIR
FT                   EEEYFLIPTAEVPVTNLHRDEIMQAEELPKAYTAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVKPEESYEQLEQLTSQAEKVLQLLKLPYRVLNMCTGDLGFTAAKKYDIEVW
FT                   IPSNNAYREISSCSNFEAFQARRANIRFKRDIKGKAEFVHTLNGSGLAIGRTVAAILEN
FT                   YQQPDGSVKIPDVLKPYMGGKEVISK"
FT   gene            27791..28807
FT                   /locus_tag="Bcell_0016"
FT   CDS_pept        27791..28807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0016"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: oih:OB2264 oligopeptide ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28308"
FT                   /db_xref="GOA:E6TRL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL4"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU28308.1"
FT                   /translation="MQEQDLKSEVKQKTNEQQLLEVKGLKTYFYMEGNKVAKAVDGVDF
FT                   SVKKGETLAIVGESGSGKSITSLSIMRLIPSPPGKIVEGSIELDGKDLLKLSDKEMRKV
FT                   RGNDIGMIFQEPMTSLNPVFTIGNQISETLMKHKKMKKKEALKKSIDLLKLVGFARAEE
FT                   IVHEYPHQLSGGMRQRVMIAIAMSCDPKLLIADEPTTALDVTIQAQILDLMVEMKEKFE
FT                   SSILLITHDLGVVAEVSDRVLVMYGGQVVEEATVQELFTNPKHPYTNGLLASIPNIDSD
FT                   VERLESIPGSVLPAHRFPKGCRFAQRCKHVMDKCNEANPDLLETEANHKVRCYLYED"
FT   gene            28821..29804
FT                   /locus_tag="Bcell_0017"
FT   CDS_pept        28821..29804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0017"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: bcl:ABC2415 oligopeptide ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28309"
FT                   /db_xref="GOA:E6TRL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL5"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU28309.1"
FT                   /translation="MAEREKLLEVQNLKKYFPIKGGVLQRTIGHVKAVDDVSFDLYKGE
FT                   TLGIVGESGSGKSTLGRTILRLLDPTEGNIIFEGDDISKLSNRKMRPYRKDMQMVFQDP
FT                   FASLNPRMSVGEIIEEPMIVQKILNSAERKEKVLDLLEKVGLPPEARNKYPHEFSGGQR
FT                   QRIGIARSLTLNPKLIIGDEPVSALDVSVQSQVLNLMEDLQDDFNLTYLFIAHDLSVVK
FT                   HISDRIAVMYLGKIAEISPKDDLFAKPLHPYTQALLSAVPIPDVQRKREKITLKGELPS
FT                   PSNPPSGCPFHTRCPEVHDRCKVELPELTEQGNGQYVACHLYTTEK"
FT   gene            29910..31655
FT                   /locus_tag="Bcell_0018"
FT   CDS_pept        29910..31655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0018"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: oih:OB2262 oligopeptide ABC transporter
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28310"
FT                   /db_xref="GOA:E6TRL6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU28310.1"
FT                   /translation="MKFSKFWLMLIVSLAFMLVIAACGSDDEAGGDVDDETEEVDENGD
FT                   DATEDSGERGSIVAGMYSAPGHQFNPLFYSDAYEANILDFTHEALARLDENLDWEPSLA
FT                   ESWEINDDYTEITFTLNDGVTWHDGEPFTSADVVFTYETLMDEDYVAAGGVRTNYVSDL
FT                   ESVEAIDPLTVKFTYTDTNINAVFDAAFIIVPEHVFGDVPVLEMPDYSASRNAGEIIGT
FT                   GPFQLTDMLEGEQYVLTAYDDYWKGEPGLASITWRVIEQSVMPGLLGNGDIDMIAAPNG
FT                   VPPADFGSVDALDHINTYVFQDFGYQYMGFKLHHRTSEDVENGVIDPDNWIENEKVADV
FT                   RVRQAVVYAIDREGIVEGLLHGMGTVLNANFPEASWAFDESAVNPYEYSPETAEALLDE
FT                   AGYVDVTGDGFREDPDGNEWVLNLDYPTGNQIRERSAPIIQEDLEAVGIKVNLRQPREA
FT                   GPHFDLVEEDDHDWDLYLAGWSLSAADPDPSALWLSTAPYNYTRWNDPVSDELIRAGIQ
FT                   APEAFDQDYRKQAYSDWAAHMSEQVPQVFLYSNDNIYAYNAALQNVKEYPAGIYTDSYL
FT                   WELAE"
FT   sig_peptide     29910..29978
FT                   /locus_tag="Bcell_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.360 at
FT                   residue 23"
FT   gene            31734..32699
FT                   /locus_tag="Bcell_0019"
FT   CDS_pept        31734..32699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC2413 oligopeptide
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28311"
FT                   /db_xref="GOA:E6TRL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28311.1"
FT                   /translation="MHKYIARRILQFIPMLFLVTVLVFALAMAAPGDPLSGERVDPNID
FT                   PAVYEERREALGLNDPIPVQYWRWLTSVAQGNFGDSLQYTGRSVMELIQARIWNTFYLS
FT                   IFALAVTLAIAIPIGIYSANRKYSLFDYGATTFAFLGLATPNFFAGLLAIYVFALTLGW
FT                   FPAQGTTSAIGLSGFELFIDKLRHLVLPGLTLGLASTAAYMRYMRTEVLEVKGSDFIRT
FT                   AKAKGLSNESVLYKHTLRNALIPIITLLGLEFGTLLSGAIITERIFNYPGLGTLFLNAI
FT                   TNRDYPVIMAINLILAVTILVGNLLADIFYAIVDPRIRYD"
FT   sig_peptide     31734..31823
FT                   /locus_tag="Bcell_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            32711..33625
FT                   /locus_tag="Bcell_0020"
FT   CDS_pept        32711..33625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC2412 oligopeptide
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28312"
FT                   /db_xref="GOA:E6TRL8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28312.1"
FT                   /translation="MQTQIQNKMDPTPEVNEQPEKSLSPFQLAMRRFLKNKLAIAGIFI
FT                   LLFFVIVAIFADQIATHDPRASERYNVEAKASSENWLGTDSSGRDNFSRLVHGSRVSLT
FT                   IGFFAMFFTVVIGVILGSIAGFYGGKIDGIIMRITDLMMIMPFMLLVLTVVAILERTTI
FT                   VIFIAVIALTAWPTLTRLIRATFLSLREKEYILGARSIGASDFRIIFKHFLPNAVGPII
FT                   VNATLMMATMIIIESGLSFIGFGIPQPTPTWGNMITEGNSLRMLENNWEAWLPAGLAIL
FT                   LTVLAINFIGDGLRDAFDPKSSN"
FT   gene            33728..34213
FT                   /locus_tag="Bcell_0021"
FT   CDS_pept        33728..34213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0021"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   bha:BH0033 Cu binding protein (Mn oxidation)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28313"
FT                   /db_xref="GOA:E6TRL9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRL9"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADU28313.1"
FT                   /translation="MSLKQSKEDIFFMEQALVEAEKAMEIGEVPIGAIIVRDNVIIARG
FT                   HNLREQQQMVTNHAELIAIQKACEEVGSWRLEDCTLYVTLEPCPMCAGAIVQSRMKRVV
FT                   YGAADPKAGCCGSLMNLLDEPRLNHQVYVTSGLYEEESSRLLKDFFKKLRQKKKGTD"
FT   gene            34242..34400
FT                   /locus_tag="Bcell_0022"
FT   CDS_pept        34242..34400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28314"
FT                   /db_xref="InterPro:IPR025550"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM0"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0022"
FT                   /protein_id="ADU28314.1"
FT                   /translation="MKPNQISLETAKMFSEKLKMPIEHVMHTPPHILVAKLKKVEEEAA
FT                   KTNEGKE"
FT   gene            34628..34730
FT                   /gene="ffs"
FT                   /locus_tag="Bcell_R0004"
FT   ncRNA           34628..34730
FT                   /gene="ffs"
FT                   /locus_tag="Bcell_R0004"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            35075..36799
FT                   /locus_tag="Bcell_0023"
FT   CDS_pept        35075..36799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0023"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase central domain protein; KEGG: DNA
FT                   polymerase III, subunits gamma and tau; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28315"
FT                   /db_xref="GOA:E6TRM1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM1"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADU28315.1"
FT                   /translation="MSYQALYRVWRPTCLSDVVGQEHITKTLKNALIEEKLSHAYLFTG
FT                   PRGTGKTSAAKIISKAINCEHAPVTEPCNECAACKGISDGTIVDVMEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVKYKVYIIDEVHMLSTGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   LTIISRCQRFDFKRISAQAMIDRMREIIEASHVHVEEAALSLIARASEGGMRDALSLLD
FT                   QAISYADESVTEDDVLSIIGAVSQQLLYDVALALNEGHVAGGLEAVDLIIKEGKDPNRF
FT                   LEDLIFFYRDVLMFKAAPQLEESKERLLTDERFKEIVEKLEAAWIYNVMEQLNHFQQEM
FT                   KWSNHPRVFLEMFIVKACQLKTPVNASSSTELDQNDTIKALLNRVTELESELKKIANGQ
FT                   VAAQADNTQTKEVARSRPKPLQSSGKSRAQISRAKGMLQKATKQHLQSIQGFWPQVMEQ
FT                   IKEQSVPASAWLNDCKPVACSEKEIVLSFKNEMHRDMIDNKFRDMVEKTLATFLNRSVT
FT                   LIALLSTHWEETKDAFLKEQNQLDADNGEAPASNKEESPLIDEALKLVGEDLVEIKE"
FT   gene            36830..37141
FT                   /locus_tag="Bcell_0024"
FT   CDS_pept        36830..37141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0024"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="PFAM: Uncharacterised protein family UPF0133; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28316"
FT                   /db_xref="GOA:E6TRM2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM2"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADU28316.1"
FT                   /translation="MKNMGNMMKQMQKMQKDMAKAQEQLKEETVEASAGGGMVTVIASG
FT                   EKKILDIQIKEEVVDPDDVEMLQDLVLAATNEALVKVDELVNEKMGKFTKGMNIPGLF"
FT   gene            37276..37872
FT                   /locus_tag="Bcell_0025"
FT   CDS_pept        37276..37872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0025"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain-containing protein; Zinc finger C4-type, RecR; KEGG:
FT                   recombination protein RecR; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28317"
FT                   /db_xref="GOA:E6TRM3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM3"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADU28317.1"
FT                   /translation="MQYPQPISKLIEGFMRLPGIGPKTAARLAFYVLDMREDDVLDFAK
FT                   ALVNAKRQLTYCSVCHHITDIDPCRICEDNGRDQTVLCVVQESKDVIAMEKMKEYTGLY
FT                   HVLHGCISPVDGIGPEDIYIPDLLKRLQDDTIQEVIIATNPNIEGEATAMYISRLIKPT
FT                   GLKVTRIAHGLPVGGDLEYADEVTLSKAIEGRREI"
FT   gene            37891..38112
FT                   /locus_tag="Bcell_0026"
FT   CDS_pept        37891..38112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0026"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508; KEGG:
FT                   bha:BH0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28318"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM4"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ADU28318.1"
FT                   /translation="MFFSKKGKVREKEDANLLWHLAKLKKSLNQREALINNSVDQNNQV
FT                   IYQALTEKAKYLFLLKEARIRKTKMRNK"
FT   gene            38227..38493
FT                   /locus_tag="Bcell_0027"
FT   CDS_pept        38227..38493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0027"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: bpf:BpOF4_08075 hypothetical protein; TIGRFAM:
FT                   pro-sigmaK processing inhibitor BofA; PFAM: sigmaK-factor
FT                   processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28319"
FT                   /db_xref="GOA:E6TRM5"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM5"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADU28319.1"
FT                   /translation="MEPVVIISLLGALIFLLLIVGAPMKPLRWLGQGAVKLLIGALLLF
FT                   FLNAFGSMFGYSLPINGFTAAVSGFLGIPGLVALVFADLLLIS"
FT   gene            38827..40369
FT                   /locus_tag="Bcell_R0005"
FT   rRNA            38827..40369
FT                   /locus_tag="Bcell_R0005"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            40703..43633
FT                   /locus_tag="Bcell_R0006"
FT   rRNA            40703..43633
FT                   /locus_tag="Bcell_R0006"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            43703..43818
FT                   /locus_tag="Bcell_R0007"
FT   rRNA            43703..43818
FT                   /locus_tag="Bcell_R0007"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 97.23"
FT   gene            45285..45509
FT                   /locus_tag="Bcell_0028"
FT   CDS_pept        45285..45509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0028"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: afl:Aflv_0023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28320"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM6"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ADU28320.1"
FT                   /translation="MKSLLEEKKYESLKECLICEEEKGKGIHLLNYFICTECEHDIVTS
FT                   DTDNSSYRYYLNRLKKVKEALMPSTEKNA"
FT   gene            46202..47656
FT                   /locus_tag="Bcell_0029"
FT   CDS_pept        46202..47656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0029"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bld:BLi00040 YaaO"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28321"
FT                   /db_xref="GOA:E6TRM7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM7"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADU28321.1"
FT                   /translation="MNQNRTPLFDKVIRHAKKKPTSFHVPGHKNGLFFYEKAVSTYKSI
FT                   LEIDLTEITNLDDLHHPTGVIKEAQQLTSALYGVKNSFFLVGGTTVGNIAMIMSSVSEG
FT                   DTILVQRNSHQSVFHAIELAKARPVYLEPEVDNETGLALGISEKVVEEAVTKYSDAKML
FT                   VLTSPTYEGYAQCLKKHVEHAHKKNMIVGVDEAHGAHFIIGDSNWPTSSIAAGADIIVH
FT                   SAHKMLPAMTMSSFVHVNSKLVDVNKFKYYLKIFQSSSPSYPLMASLDVARAYLANIIH
FT                   EGTNALLKQISTLREKLGEGPTWMLSPSLIGHYRQDPLKVAFISKNKVASSWQGELEKL
FT                   DIYPELVSPNHLLLVLPLASGALPIGDWAKKIVKGLKEVGKSDPISPIVMNEYDQSSSP
FT                   ALSIHEVDKYQKERVELEAAVGKISAETITPYPPGVPFIMKGEVITKNHVLKLMQLKDN
FT                   NSYFQTGNDWKGLGILIVRKEKENGM"
FT   gene            47653..48294
FT                   /locus_tag="Bcell_0030"
FT   CDS_pept        47653..48294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0030"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: tmk; thymidylate
FT                   kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28322"
FT                   /db_xref="GOA:E6TRM8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM8"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADU28322.1"
FT                   /translation="MSGVFITFEGGEGAGKTTVLKEIKDRLEASDEKVVMTREPGGSII
FT                   AEKIRDVILNPDHTEMDARTEALLYAAARRQHLVEKVFPYLDKGYIVLCDRFIDSSLVY
FT                   QGVARKIGIEEVLNINLFATGGFMPSKTLFFDIDPKIGLERIAKHGNREFNRLDREALD
FT                   FHYIVRKAYHELQGREPDRIEMVDASLSLTEVIEAAWTKVFDIVQAKEKK"
FT   gene            48363..48692
FT                   /locus_tag="Bcell_0031"
FT   CDS_pept        48363..48692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0031"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28323"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRM9"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADU28323.1"
FT                   /translation="MKLIMAVVQDKDSNRLSDALIEKDFRATKLASTGGFLKAGNTTFL
FT                   IGTDDENVEQVLSIIKENCKTREQLVAPISPMGGNADSYVPYPVEVQIGGATVFILPVD
FT                   RFEKF"
FT   gene            48726..49712
FT                   /locus_tag="Bcell_0032"
FT   CDS_pept        48726..49712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0032"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28324"
FT                   /db_xref="GOA:E6TRN0"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN0"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADU28324.1"
FT                   /translation="MIWEELKATQSIVVKMLTNSIKKNRLSHAYLFEGPRGTGKKEVAN
FT                   ALTKSFFCQQKQGFEPCDNCSDCKRIDSGNHPDVHTIKSEGQTIKVDQIRHLKKEFSFR
FT                   GMESTKKVYLVEDAEKMTIGAANSILKFLEEPDGEALAVLMTTQYQQIIKTIVSRSQVL
FT                   SFAPLSQQILVEKLIDKGINKPDALAVSQITFDLEEAIQFCHDNWIAQARSKVIQLVDE
FT                   IHLRPKFVFITLQDQWMSFFKEKEDMLLGLDLLMIWYRDVLRIQVDQKEQIVNIDQENK
FT                   LEEQALKLSQRKLGSNLQAVMDAKRRLGANAAPQLLMEQMLLRLQEG"
FT   gene            49714..50541
FT                   /locus_tag="Bcell_0033"
FT   CDS_pept        49714..50541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0033"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: PSP1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28325"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN1"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADU28325.1"
FT                   /translation="MHRVVGVRFKKAGKIYYFSPGDIDIQEDDYVIVETARGIEFGKVV
FT                   IGIKEVHENDVVLPLKNVLRLATDKDKLIVEENHSEAQKAFTVCIEKINEHDLDMKLVD
FT                   VEYTFDRNKVLFYFTADGRIDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDMYETAKKDLPDL
FT                   NEEIKTSYGKGKVVGLNMLERLVQIELFESSRVIEFTMAELMEEGAIATETTK"
FT   gene            50557..50937
FT                   /locus_tag="Bcell_0034"
FT   CDS_pept        50557..50937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0034"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28326"
FT                   /db_xref="GOA:E6TRN2"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN2"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ADU28326.1"
FT                   /translation="MKKHEIFARVSQLEESIGGLHSELKDLKEQLALLLEENHHLQIEN
FT                   DHLRDRIDQDMKEKENDSKNNTSPSPKGDQESAGRTHTDFREGYDNLARLYQEGFHICN
FT                   MHYGSIRKEGDCLFCLTFLNKV"
FT   gene            51055..51777
FT                   /locus_tag="Bcell_0035"
FT   CDS_pept        51055..51777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0035"
FT                   /product="methyltransferase small"
FT                   /note="KEGG: gwc:GWCH70_0030 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28327"
FT                   /db_xref="GOA:E6TRN3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN3"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0030"
FT                   /protein_id="ADU28327.1"
FT                   /translation="MERLDYMPGKQRYIYQRKDIFSFSMDAVLLGKFAKVPKEQGKVID
FT                   LCSGNGAIPLMLSVRTEAKIDAVEIQDILCSLAERSVSYNGLEEQINVINKNILHLQDE
FT                   VEWGTYDLVTCNPPYFPVIALDRINNNEKVSYARHEIACNLEDVIRISSRLVKQTGRLA
FT                   MVHRPERVVEIITLMTKYQLEPKRIQYVHPKKDREANMVLIEGSRAGKPGIKTLPPFIV
FT                   YGDGKEFTEEFNKYYHEK"
FT   gene            51804..52685
FT                   /locus_tag="Bcell_0036"
FT   CDS_pept        51804..52685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0036"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28328"
FT                   /db_xref="GOA:E6TRN4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN4"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADU28328.1"
FT                   /translation="MFIQQSFRSNDEAGCLYLVPTPIGNLQDMTYRAVDVLKGVNVIAA
FT                   EDTRHTKKLCHVFSIDTPLISYHEHNKKERENYLVERVKSGEKIALVSDAGMPAISDPG
FT                   SDLVARFTAEGLSVIALPGANAALTALIASGLSTDEFTFLGFLNRKKKERETTLKRWQA
FT                   SLSTLILYEAPHRLKETLEAVREVLGNRQIALCREITKQYETFVRGRIEEVLSHIEQEG
FT                   IKGECVIILSGATEEEIEQLQEAPWWESLSIKEHVQAYIDDEEMISKDAIKRTAEDRGL
FT                   KKRDVYQKYHIN"
FT   gene            complement(52992..53276)
FT                   /locus_tag="Bcell_0037"
FT   CDS_pept        complement(52992..53276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0037"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: transcriptional regulator, AbrB family;
FT                   TIGRFAM: transcriptional regulator, AbrB family; PFAM:
FT                   SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28329"
FT                   /db_xref="GOA:E6TRN5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN5"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADU28329.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDIAEKDALEIYVDDEKIVL
FT                   KKYKPNMTCQVTGEVSDDNLSIADGKIILSPQGAKEIIRELENYLTKQD"
FT   gene            54073..56043
FT                   /locus_tag="Bcell_0038"
FT   CDS_pept        54073..56043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0038"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: bpf:BpOF4_08155 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28330"
FT                   /db_xref="GOA:E6TRN6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN6"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADU28330.1"
FT                   /translation="MSEARKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYD
FT                   VMFLTGTDEHGQKIERKAEDKGVSPQQFVDDIVKTIKSLWSKLDISYDDFIRTTEERHK
FT                   KVVQKIFDQLLQQGDIYLDQYEGLYCTPCESFFTDYQAKDGKCPDCSRPVEKVQEESYF
FT                   FRMSKYADRLLKYYEENPDFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGINVKSNP
FT                   EHVVYVWIDALSNYITALGYGSDDETLYKKYWPADVHLVGKEIVRFHTIYWPIMLMALD
FT                   LPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVPLIERYGLDALRYYLLREVPFGSDGTFT
FT                   PEGFVDRVNYDLANDLGNLLNRTVAMINKYFDGEMPKYIKNATSYDESLVDHVNATVKK
FT                   VEDAMEDMEFSVALTAIWQLVSRTNKYIDETQPWIIARDETAKEQLGSVMYHLAESLRY
FT                   ISILIQPFLTEAPKKIWEQLGITEDQTVWSTLQDFGKTESGTKVVTKGEPLFPRLDVKE
FT                   EIKHIIVSMGGEVISEEEEKNKKQQDKAAPEVEEITIDDFTKVELRVAEVMKAEKVKKA
FT                   DKLLKIQLDLGYEQRQVVSGIAKYYTPENLVGKKVICVTNLKPVKLRGELSQGMILAAS
FT                   EGDQLTLATIGESLPNGAKVK"
FT   gene            56145..56912
FT                   /locus_tag="Bcell_0039"
FT   CDS_pept        56145..56912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0039"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: bpf:BpOF4_08160 TatD family hydrolase;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28331"
FT                   /db_xref="GOA:E6TRN7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN7"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADU28331.1"
FT                   /translation="MLFDTHVHLNADQYEEDVNEVIERALANEVTNMVVVGFDEKTIPK
FT                   AIQLAETYDFIYAAVGWHPVDAIDFEERHLQWLKELSSHEKVVAIGETGLDYHWDKSPK
FT                   SVQKEVFRKQIQLAKEVKLPLIIHDREAHQDIVNILKEEDAQEVGGIMHCFGGDLHIAK
FT                   QCLDLRFHISFGGPVTFKNAQLPKDVAKEIPMDRILVETDAPYLAPHPYRGKRNEPAYV
FT                   KLIAEKIAELKEINVVDFAKMTTENAKKLFGIK"
FT   gene            57131..58348
FT                   /locus_tag="Bcell_0040"
FT   CDS_pept        57131..58348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0040"
FT                   /product="G5 domain protein"
FT                   /note="PFAM: G5 domain protein; protein of unknown function
FT                   DUF348; 3D domain-containing protein; KEGG: 3D domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28332"
FT                   /db_xref="GOA:E6TRN8"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN8"
FT                   /inference="protein motif:PFAM:PF07501"
FT                   /protein_id="ADU28332.1"
FT                   /translation="MTQWMKQFFSRLSWRKFAISSVGLLTLMGILVFAIYEATKISVTV
FT                   EVDDEQETIYTHASTVGEVLKERGIEVGVHDYIEPSLDTVINDATEIVYIPAQQVIVTI
FT                   DGNEEEVWTIASNVKQLLDELDVEVNEHDVISPSLHEAITSNMTITYEEAFKVIVHSDG
FT                   EEKEFWTTSTTVADFLERENFTLGELDRVEPSLEEKLDEEVELNVVRVEKVTDVVEETV
FT                   DFATVRRNDSSLEQGSEEVVQNGQEGRIEKHYEVIFEDGEEVSRELVKEEKVRDSEDRI
FT                   VAVGTKAPQQTVSRSASSDSASGDWQTFTATAYSAYCNGCSGNTATGLNLRANPDKNVI
FT                   AVDPNVIPLGSRVEIKGMGTFLAADTGGAINGRIVDIFMPDPNGATTNNRALSFGRQTV
FT                   ELRILD"
FT   sig_peptide     57131..57235
FT                   /locus_tag="Bcell_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.399 at
FT                   residue 35"
FT   gene            58495..59067
FT                   /locus_tag="Bcell_0041"
FT   CDS_pept        58495..59067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0041"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain-containing protein; KEGG: bwe:BcerKBAB4_0035
FT                   primase/topoisomerase like protein; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28333"
FT                   /db_xref="GOA:E6TRN9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRN9"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADU28333.1"
FT                   /translation="MKPIIKEVIVVEGKSDTNVIKRFLECDTIETNGSAVEDHVIKRIK
FT                   LANDRRGVIIFTDPDYPGEKIRHIINEKVPGCKHAFISKESAIDYQKKKVGVEHANKES
FT                   ILSAIEKAKPSSSYEVVSEITKEDLLHAKLIGGSGSRERREALGTKLNIGYTNGKQLLK
FT                   RLQQFQISKNEFADALRHIERGEDDDR"
FT   gene            59057..59935
FT                   /locus_tag="Bcell_0042"
FT   CDS_pept        59057..59935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0042"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: ksgA; dimethyladenosine transferase; PFAM: ribosomal
FT                   RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28334"
FT                   /db_xref="GOA:E6TRP0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP0"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADU28334.1"
FT                   /translation="MIDKDIATPKKTKAILDKYGFSFKKSLGQNFLIDTNVLKRIVAAA
FT                   NVSQSTGVIEIGPGIGALTEQLAKEAKRVVAFEIDQRLLPILKETLSAYEHTKIIHQDV
FT                   LKADVQKVIKDEFEENEELAVVANLPYYVTTPILMKLLEEKLPVRTIVVMIQKEVAERI
FT                   AAKPNSKNYGSLSIAAQYYADAETVFTVPKTVFVPQPNVDSAILRLSIREKPPITVKDE
FT                   AFFFEIIRASFAQRRKTILNNLAHHFSTLSKQTIEEILQSINIDPRRRGEALSMEEFGV
FT                   LSDNLLKKFRT"
FT   gene            59987..60856
FT                   /locus_tag="Bcell_0043"
FT   CDS_pept        59987..60856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0043"
FT                   /product="sporulation peptidase YabG"
FT                   /note="KEGG: bpf:BpOF4_08180 hypothetical protein; TIGRFAM:
FT                   sporulation peptidase YabG; PFAM: peptidase U57 YabG"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28335"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP1"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ADU28335.1"
FT                   /translation="MSDIKVGHIVGRASYNCDILFRVVNIDGDLVELHGEDMRIVADAP
FT                   VSDLVAITEKDRKKRAKKLRQKEENCYQLFRQDRKLTRERNEYEITSGYTKRNTYFELP
FT                   GKVLHLDGDSLYLKKCTQVYDRLGVPVYGVHLEEKEMPLQVKSLIEMIRPDILVITGHD
FT                   AYSKSKGDEHEMKAYRNSRHFVDTVKEARKIVPYMDHLVIFAGACQSNFQSLLKAGANF
FT                   ASSPDRINIHALDPVYVVSKVSLTPFMERVGVWDVLKASLTGKQGLGGVETNGALRRGM
FT                   PNYQDEEE"
FT   gene            61327..61599
FT                   /locus_tag="Bcell_0044"
FT   CDS_pept        61327..61599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0044"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   bha:BH0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28336"
FT                   /db_xref="GOA:E6TRP2"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP2"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADU28336.1"
FT                   /translation="MAKTLIEIKRSLDENVGKRITILANGGRRKTIERSGLLEGTYPSV
FT                   FTIKLDQDEYAVERVSYSYTDILTETVKLSLADEVDVELEAAENA"
FT   gene            61859..62020
FT                   /locus_tag="Bcell_0045"
FT   CDS_pept        61859..62020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0045"
FT                   /product="SspF protein"
FT                   /note="KEGG: bwe:BcerKBAB4_0039 SspF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28337"
FT                   /db_xref="GOA:E6TRP3"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP3"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_0039"
FT                   /protein_id="ADU28337.1"
FT                   /translation="MSDQFKEELAKELGFYDTVQKEGWGGIRAKDAGNMVKRAIELAEQ
FT                   QLSNRSSQ"
FT   gene            62343..63212
FT                   /locus_tag="Bcell_0046"
FT   CDS_pept        62343..63212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0046"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="KEGG: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28338"
FT                   /db_xref="GOA:E6TRP4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP4"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADU28338.1"
FT                   /translation="MHTHKIIKAPAKINLTLDVIRKRDDGYHDVEMVMTTVDLADRIEL
FT                   TTLEENRIKVDVNHGFVPSDNKNLAYQAAKLLKDKMDVKKGVRIFIDKQIPISAGLAGG
FT                   STDAAAVLRGLNELWDLNLSIDELAELGLEIGSDVPFCVHGGTALATGRGETLQFLPTP
FT                   PPCWVILVKPPMGVSTKEIYQRLNLDQMEHPDTQGMIASINNGDFSGICSRLENVMEKV
FT                   TFELYKDVERVKNSMIQFGADGVVMSGSGPTVFALTQNETRADRLYNSLKGFMDQVFVV
FT                   RLLGTKHD"
FT   gene            63315..64151
FT                   /locus_tag="Bcell_0047"
FT   CDS_pept        63315..64151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0047"
FT                   /product="purine operon repressor, PurR"
FT                   /note="KEGG: purine operon repressor, PurR; TIGRFAM: pur
FT                   operon repressor; PFAM: purine repressor ;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28339"
FT                   /db_xref="GOA:E6TRP5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP5"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ADU28339.1"
FT                   /translation="MKYRRSGRLVDMTNYFLSHPHQQIPLTHFSEAYQSAKSSISEDIS
FT                   IIKEVFESKHIGTISTTAGASGGVTFVPTVARQQTEELIDRLCDRLEEPERLLPGGYLY
FT                   MMDIIGDPNLMQELGRVFASKFRDASVDAVMTMATKGIPLAYAVAGHLNVPVSIVRAQH
FT                   RITEGSIVSINYVSGSQKRIQTMSLARRSLKPNSNVLIIDDFMKAGGTIRGMMDLVSEF
FT                   QSSIAGIGVLTEAVHDEEKLVSDYVSLTKLSEVDLKAKQIKVEQGNIFSLDYSYED"
FT   gene            64304..64591
FT                   /locus_tag="Bcell_0048"
FT   CDS_pept        64304..64591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0048"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bpf:BpOF4_08215
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28340"
FT                   /db_xref="GOA:E6TRP6"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP6"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ADU28340.1"
FT                   /translation="MEVTDVRLRRVNTEGRMLAIASITIDDEFVVHDIRVIDGNNGMFV
FT                   AMPSKRTPDGEFRDIAHPISSKTREKIQSAVLAEYERAGDEVEFEEAGAS"
FT   gene            65193..66572
FT                   /locus_tag="Bcell_0049"
FT   CDS_pept        65193..66572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0049"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: bpf:BpOF4_08220 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28341"
FT                   /db_xref="GOA:E6TRP7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP7"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADU28341.1"
FT                   /translation="MSNEKNRYAVILAAGKGTRMKSDLYKVLHPVCDKPMVQHVVDEVE
FT                   KCNVKKTIAVVGHGAEKVKDQLGDRVTYVLQEDQLGTGHAVMQTEPLLMDKEGTTVVLC
FT                   GDTPLLTSETITALINEHESKGAKATILTAHAPDPTGYGRIIRNSSGVVNKIVEHKDAS
FT                   ESERLVKEINTGTYCFDNKFLFSALKSVGNDNVQGEYYLPDVIEILEKQGELIAAYQTP
FT                   DFNETVGVNDRVALSHAEMYMKQRVNEKLMRAGVTIIDPNNTYVSADVTIGRDTVLHPG
FT                   TIIKGSSTIGERCHIGPHTEIVNSSIGNETTIKQSVVHDSKLGNIVSVGPFSHIRPDTE
FT                   LGNHVRVGNFVELKKMSMGDGSKASHLSYLGDAKIGSDVNVGCGSITVNYDGKNKFKTI
FT                   INDGAFIGCNANLIAPVTVGENAFVAAGSTITDDVPGDSLAIARQRQTNKEGYVKKNDE
FT                   K"
FT   gene            66586..67536
FT                   /locus_tag="Bcell_0050"
FT   CDS_pept        66586..67536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0050"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   bpf:BpOF4_08225 ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28342"
FT                   /db_xref="GOA:E6TRP8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP8"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADU28342.1"
FT                   /translation="MAQYKDENLKVFTLNSNPSLAHEITSNIGIEMGKCSVSRFSDGEV
FT                   QINIEESIRGCDIFIIQSTCSPANEHIMELLIMIDALKRASAQTINVVIPYYGYARQDR
FT                   KARSREPITAKLVANLLETAGASRVITLDLHATQIQGFFDIPTDQLVGVPILSDYFEAQ
FT                   KLDDIVIVSPDHGGVVRARKMADRLKAPIAIVDKRRPKPNVAEVMNIVGNIEGKTAILI
FT                   DDIIDTAGTITLAANAMIENGAKEVYACCTHPVLSGPAIDRIQNSKIKELVVTNTIPLQ
FT                   EDKKIDKITQLSVGPLLAKAIIHVHEQRSVSRLFN"
FT   gene            67636..68274
FT                   /locus_tag="Bcell_0051"
FT   CDS_pept        67636..68274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0051"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; TIGRFAM: ribosomal 5S rRNA E-loop binding
FT                   protein Ctc/L25/TL5; PFAM: Ribosomal protein L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28343"
FT                   /db_xref="GOA:E6TRP9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRP9"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADU28343.1"
FT                   /translation="MATLQANTREDLRGSRLNKIRNDGNVPGVIYGKTIGNKPVTVEGS
FT                   SLLKMIRENGRNGVFKLDVDGQQTDVMIYDIQVDPLKNEVIHVDFYAADMKSELDADVP
FT                   VQAVGEAIGVKNGGVLQQSLHEVSVKALPNDLPDSIEIDVSQLDVNDSLQVKDLKTSGK
FT                   YEINNDPEESVLSILPPTEQPNEPEVGEEPEGEPELVGNEEGNKEGEEE"
FT   gene            68346..68960
FT                   /locus_tag="Bcell_0052"
FT   CDS_pept        68346..68960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0052"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   bpf:BpOF4_08235 peptidyl-tRNA hydrolase; PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28344"
FT                   /db_xref="GOA:E6TRQ0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ0"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADU28344.1"
FT                   /translation="MFFKKLFQRQGKTESEALPMKLVVGLGNPGSKYDGTRHNVGFEVI
FT                   DRCQQLFQLDLDQSKFKGIYGYKVIEGEKIFLLKPLTFMNLSGESVIPLMKYFKIPTED
FT                   LLVIYDDLDLAPGKIRLRQKGGAGGHNGMKSIISHLGTEEFNRIRIGIGRPPKGYAVPD
FT                   YVLGSFSNEERNAVDESIETAAKAVDAWTKDSFINVMNTFN"
FT   gene            69044..69274
FT                   /locus_tag="Bcell_0053"
FT   CDS_pept        69044..69274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi00067 YabK"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28345"
FT                   /db_xref="GOA:E6TRQ1"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ1"
FT                   /inference="similar to AA sequence:KEGG:BLi00067"
FT                   /protein_id="ADU28345.1"
FT                   /translation="MAIHYYCRHCSKNVGTLSDWQANDEQLGFNQLTNEEKQEMIECNS
FT                   QGHLQVKVICEDCEKTLQENPDYHAQESFIH"
FT   gene            69368..72925
FT                   /locus_tag="Bcell_0054"
FT   CDS_pept        69368..72925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0054"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; TRCF domain protein;
FT                   KEGG: transcription-repair coupling factor; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28346"
FT                   /db_xref="GOA:E6TRQ2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ2"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADU28346.1"
FT                   /translation="MRGFIETLYRGDDVKSIVEGVEANISEQMVSGLAGSARSLLLATI
FT                   FEKTKRSQLVITHNLFQAQKLYDDLTSLIGEDQVYLYPVNELIASEIAVASPEMKGQRM
FT                   EALNQWISNKDAIVIAPMAGVRRLLPPKSLWFEFQLSFQVGKDIELNTTLNQLVNMGFQ
FT                   RVDMVSTPGQFSVRGGIIDIYPLTEENPVRIELFDTEVDSIRFFNVESQLSETQLQVVN
FT                   IGPAKEVLLKEEHYQHGASSLEQALATSLKKVKNKAVKEKMAEQVGHEIRLLKEKTSFD
FT                   SMYKYMSLFYDTRYTLLDYMPNNGLIFIDEVSRVQEMAKSLEKEEADWHTTMISQGASV
FT                   SDIALALSWDELFHHCTIPRVYLSLFLRHVPSTNPKNLVSIQTKTMQNFHGQIHLLKNE
FT                   VDRWKGANYSITFVCADNERADRMKSVLEDYDIESVVTSHDSPPVLGQTQIITGHLMSG
FT                   FELPMQRLIIITEEEVFTKKTKRPKRRQKLSNAERIKSYSELQVGDWVVHINHGIGKYL
FT                   GIETLEVAGIHKDYMHITYAGNDKLYVPVDQIDQVQKYVGSEEKEPKLYALGGNDWKKV
FT                   TKKVKSSVQDIADDLIKLYAEREASKGFAFSKDGPEQREFESSFPYQETEDQIRAIEEI
FT                   KKDMELERPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETIRE
FT                   RFQDFAVNTSILNRFRSRKEQQETMKGLNKGTVDIVVGTHRLLSKDITFENLGLLIVDE
FT                   EQRFGVTHKEKIKKLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNEGLVKEAIERELARGGQVFYLYNRVDDIEVVNDKISMLVPEANVRFVHGRMTES
FT                   ELESVMLEFLDGNVDVLVTTTIIETGVDIPNVNTLIIDNADKMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTHQRDKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IASVGFDLYSQMLKDAIDERKDNMSTDEKKVEEKSMEFDLQVDAYIPETYIPDSKQKID
FT                   MYKKFKMISSYQDILDLESEMIDRFGDFPKEVEYLTQVSKIKQYGIQNGVESIIEKNKE
FT                   CKVILSQHTTDTIDGSKLFTLVNKLSSKFNLSMTGNQITIHLKRKNVSDGDYLNLLEEV
FT                   LSRLDEVSKEETKEKKATI"
FT   gene            73203..73742
FT                   /locus_tag="Bcell_0055"
FT   CDS_pept        73203..73742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0055"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: bha:BH0070 stage V sporulation protein T;
FT                   TIGRFAM: stage V sporulation protein T; transcriptional
FT                   regulator, AbrB family; PFAM: SpoVT/AbrB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28347"
FT                   /db_xref="GOA:E6TRQ3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ3"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ADU28347.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALYDSLNHIVLIADRDSYIAVAGGSKKEYHNKGIGELVES
FT                   AMSERKTMLEDQAGEYHLAGDSNEQVNGYCIAPIIANGDPIGAVTLISKEGNTMGDVEK
FT                   KLAETAAGFLARQMEQ"
FT   gene            73895..75490
FT                   /locus_tag="Bcell_0056"
FT   CDS_pept        73895..75490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0056"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28348"
FT                   /db_xref="GOA:E6TRQ4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ4"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADU28348.1"
FT                   /translation="MKENKAKVSLLKGALYLSLAAFVGKVLSALYKVPYQNMTGDVGYY
FT                   VYQQVYPLYGIAFVLATYGFPIVLSKTLAEMDISITNVEEKYNRIVVLFIAMFIFNGMI
FT                   GAALMIFANSIAILMGDPQLTIAIRYLGLPFFVIAFLSLARGYFQSQGNMVPSSISQVV
FT                   EQTVRIVVILSVATIAMAYNDPYKAGISAGVGAFVGGISGVLVMFVYVLREKKLKKLPR
FT                   VSKNGIKKVWRVDIRQFFYSSLLVSISAMALIIYQFIDSFTIIRLLHFGGWDDVAAMKG
FT                   IYDRGWPMIQLGAVVTTVFSYALIPSLTAAYVKKEYEHLRQLTMQSIKVCIVFGGAAAF
FT                   GLIVVLPHLNPMLFKDQSGVIALQILSTTVLFAALFMTIAALLHAINRARDAALLLAAG
FT                   VVIKIIGNNIAVPVLGIEGAALSSAISFLIIACCALYLLKRHRMVHRLEMTFMIKFVCA
FT                   IIVMIFAVKLFEKGLLTFYFHEGIVARWEHTLLAITLSLIGAIIFIVFIWIFKVFNRAE
FT                   WYSLPKISKILPYK"
FT   gene            75515..76999
FT                   /locus_tag="Bcell_0057"
FT   CDS_pept        75515..76999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0057"
FT                   /product="MazG family protein"
FT                   /note="KEGG: bha:BH0072 hypothetical protein; TIGRFAM: MazG
FT                   family protein; PFAM: MazG nucleotide pyrophosphohydrolase;
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28349"
FT                   /db_xref="GOA:E6TRQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ5"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADU28349.1"
FT                   /translation="MNKHITIVGLGAGDINQLPLGIYKSLVAYKKVYIRTMDHPVVEHL
FT                   QGEGIELISFDDTYEAHDNFESVYRDICSSLLHAAEKERIVYAVPGHPLVAEATVKRLV
FT                   EEENEGNVTLQLLGGQSFLDPMFSALRIDPIDGFQLLDGTDFRRETLQIRQHIIIAQVY
FT                   DSFVASEVKLTLMEKLPDDYEIKVVTAAGSEKEVVLTIPLYELDRVTTLSNLTAVYVPP
FT                   VSKRELLYRDFDMLRQVFAELRGPNGCPWDKEQTHESLKKYLIEEAYEVLDAIDKGNED
FT                   DLVEELGDVLLQVVLHSQIGEDNGIFSIDQVIETLTEKMIRRHPHVFGQAEVHDADNVV
FT                   TQWEEIKRLEKEKKGLKEEEQSILSNVPSSLPSLLRAFNIQKKVSKVGFDWGDEAPMWM
FT                   KLQEEIAEWFQELKEGTKQDASKELGDVLFAFVNIARFHGIDPEEALRQTNDKFTQRFQ
FT                   YIEQKLKSQGKNIKEQSLEALDAIWNEAKTREYKGE"
FT   gene            77002..77262
FT                   /locus_tag="Bcell_0058"
FT   CDS_pept        77002..77262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0058"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: gtn:GTNG_0052 heat shock protein 15; PFAM:
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28350"
FT                   /db_xref="GOA:E6TRQ6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ6"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADU28350.1"
FT                   /translation="MRLDKYLKVSRLIKRRTMAKEVAEQGRIQINGQVAKAGANIKIGD
FT                   EVVIQFGQKKVTIRVDRLEESTRKEEAATLYTLLKEEKVNE"
FT   gene            77343..77651
FT                   /locus_tag="Bcell_0059"
FT   CDS_pept        77343..77651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0059"
FT                   /product="sporulation protein YabP"
FT                   /note="KEGG: gwc:GWCH70_0055 sporulation protein YabP;
FT                   TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28351"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:E6TRQ7"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ADU28351.1"
FT                   /translation="MEHSYGYTQGGQGRKLEDHQIIMRGRKTLDITGVKQVESFDNEEF
FT                   LLETILGFLSIRGQHLQMKNLDVDQGKVSITGRVDDLVYLDEHHGEKSKGLFGKLFK"
FT   gene            77648..78238
FT                   /locus_tag="Bcell_0060"
FT   CDS_pept        77648..78238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0060"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="KEGG: bpf:BpOF4_08275 hypothetical protein; TIGRFAM:
FT                   spore cortex biosynthesis protein YabQ; PFAM: Spore cortex
FT                   biosynthesis protein, YabQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28352"
FT                   /db_xref="GOA:E6TSD7"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSD7"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ADU28352.1"
FT                   /translation="MTLEVQFLSMVASAATGLWFGASFDTYKRFVGSSKSFRWTLLIND
FT                   LLFWLLQSLIFFYVLLQVNQGEVRIYMFFALLLGYSMYRALLENMYRQLLEKLIRFFQK
FT                   LFRTIIRCINAFIINPLKWLLQVIISLSIIILTACWKIISFILKLLLSPFRWLIDKYVK
FT                   AFGNPFEKVIEAFKRIKHKLLKAWSNLFDKRDE"
FT   gene            78254..78637
FT                   /locus_tag="Bcell_0061"
FT   CDS_pept        78254..78637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0061"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   bpf:BpOF4_08280 cell-division initiation protein (septum
FT                   formation)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28353"
FT                   /db_xref="GOA:E6TSD8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSD8"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADU28353.1"
FT                   /translation="MRTSKRGNVRTLTSEYMEQQTLLHEHKLRRRKGLIRRLTFFGCLI
FT                   MGFFIFTGITLYNQHTLINEQELEKQQLEDKLLELENEEQNLKEEIELLHDPDYIAEIA
FT                   RRDFYLTKPGETLFQLPRSSSSD"
FT   gene            78710..79135
FT                   /locus_tag="Bcell_0062"
FT   CDS_pept        78710..79135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0062"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG: S1 RNA
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28354"
FT                   /db_xref="GOA:E6TSD9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSD9"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADU28354.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INEFLKVGDEVQVKVLNVESDGKIGLSIRKAKEAPPSPEQRRPQKRGPRKDDHGRPQRS
FT                   MSFEDKMNRFLKDSEERLASLKRNTESKRGGRSTKRG"
FT   gene            79743..82220
FT                   /locus_tag="Bcell_0063"
FT   CDS_pept        79743..82220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0063"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="SMART: protein phosphatase 2C domain protein;
FT                   TIGRFAM: stage II sporulation protein E; KEGG: bha:BH0078
FT                   stage II sporulation protein E; PFAM: Stage II sporulation
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28355"
FT                   /db_xref="GOA:E6TSE0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE0"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ADU28355.1"
FT                   /translation="MLHRVSLKAIGGQAATLVNDIATPKINHEKRSTAINSTKSTTSSI
FT                   RIPLIIVALGFLLGRAVILFELLPFVIPFVAVIYKWRRSSTLLASLAVLAGGTTVGFSF
FT                   AGHIAVALLLYFVLQRGITTVAKERQLVPVTVFFSVAIARYVSLLVIEGGTFYHLLTAV
FT                   IEGGLAMIVTMIFFQSVPLLLETRKKISLKHEEIVCLVILLASLMTGTVGWLVFGLSVE
FT                   QIVSRYIVLIFAFVGGAAIGSTVGVVTGLILSLANVANLFYMSLLAFSGLLGGLMKEGK
FT                   KVSVAVGLIIATLLMAMYGDNQVPMQVSVYESLVAVFLFMATPKRWTTELSKFIPGTME
FT                   HSQEQQQYLRKIRDVTAGKVEQFSNLFLSLSKSFSLLEVNGDKTNREREVDLFLSRVTE
FT                   QTCQTCMKKHHCWTKKFNETYGLMEQLMGECEKEGEVKNKQLIRSWKEHCVIDERVIDA
FT                   MKKELNQHYASKQLKQQLVESRRLVADQLKGVSKVMEDFAKDIQREKKAHEQQEAQIME
FT                   SIQHAGLEVDVVDVYSLDTGNIDIDITLPSNAYNEAEKIVAPILTEILDETIIVKHAET
FT                   ISLTGTESRITFGSTKAYIVEEGIAHAAKGGRLVSGDSYSTMEIGAGKHAIAISDGMGN
FT                   GTRAHIESQETIGLLKNILRSGIEETVAIKAINSILSLRSEDEVFSTLDLAMIDLQDGM
FT                   VKFLKVGSIPSYIKRGSTVKAVEAGNLPIGIIQDMDVDVVTEELKAGDILIMMSDGIYE
FT                   APMMVENQDVWMKRVIKEIETEDPQEIADVLMERVIRDSGNEIHDDMTVVVAKLDHHSP
FT                   KWATISIPYEQRA"
FT   gene            82820..83557
FT                   /locus_tag="Bcell_0064"
FT   CDS_pept        82820..83557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_08295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28356"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE1"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_08295"
FT                   /protein_id="ADU28356.1"
FT                   /translation="MSKGTLRQILLLTDGCSNSGDDPVAIAALAKEEGMTVNVIGIVGE
FT                   GEMSERGIDEIESIAEAGGGISQIVYAKQLSQTVQMVTRKAMTQTIHGVVNKEITQILG
FT                   EEKELEDLEPEKRGQLMEVVDELGETMDLDIFILVDTSASMKNKMPMVQEALIDLSVSL
FT                   RSRTGDNHFALYAFPGKRKDIDKLIQWTPHFDSLSGAFKKMSLSGITPTGPALQEAIRI
FT                   VRKRMKKRGIDDDERFDLEEVDM"
FT   gene            83520..84512
FT                   /locus_tag="Bcell_0065"
FT   CDS_pept        83520..84512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0065"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: bpf:BpOF4_08300 serine/threonine protein
FT                   kinase; PFAM: aminoglycoside phosphotransferase; SMART:
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28357"
FT                   /db_xref="GOA:E6TSE2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE2"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADU28357.1"
FT                   /translation="MMRDSISKKSTCKLLPNQRIVGRWQKNPYRIIKELGYGATGTVYL
FT                   AEGQSGLVALKIASDSMSITSEVNVMRQFSKVQGPSLGPSFYEADDYVCKEGVFPFYTM
FT                   EYIKGEPFLPFLRDKGAEWLGILVVQLLGDLHHLHKAGWVFGDLKPENLLVTKKPFRVR
FT                   WLDVGGMTKQGRGIKEYTEFFDRGYWGVGNRKAEPSYDLFSVCMLFLNRAYPSRFEKDN
FT                   DVGPAKLLMKFKEKKLIAPYESIFRKGIEGKYHHAQEMKKDLVDLLQHTSFSVKGNARG
FT                   NNSNNSLKKRGARNKKSRKEKRFIGFFETMFVASFLLIIYILYLFGQTM"
FT   gene            84523..85302
FT                   /locus_tag="Bcell_0066"
FT   CDS_pept        84523..85302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0066"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28358"
FT                   /db_xref="GOA:E6TSE3"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE3"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ADU28358.1"
FT                   /translation="MKIWGEIMGKADDVMDICLLAGQIMLTYGAETYRVEETLERMAKS
FT                   ASFSNIHCFATTTGIFLSFEEKKEKEDLMQMVRVDDRLQDLGKVTDVNQVSRQFVAGDI
FT                   TIEEAHEKLTAIAKAPMQYPLWLIHIAAGIAGGGFSYLFGGGWFDLIPAFIAAVVSSIV
FT                   VVEFERHLKVRFAAEFTAAFAGGTTAILLVLIGIGSNLDQIIIGSLMPLVPGVPLTNAV
FT                   RDLMSGDLLAGVSRGAEALLTSLSIASGIALTISVFL"
FT   gene            85318..85767
FT                   /locus_tag="Bcell_0067"
FT   CDS_pept        85318..85767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28359"
FT                   /db_xref="GOA:E6TSE4"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE4"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0063"
FT                   /protein_id="ADU28359.1"
FT                   /translation="MDLIAELIITFIATVAFGVIFSVPKRALLIGGAIGMVTWGVFQTG
FT                   LSLNTSHVFATAFASLTAATAAHFLAKKIRIPVTTLAIPGILPLVPGSRAYFTMLSFVE
FT                   GDYITGLEYGVETMLRAGAIAAGLVFALVIFSFGKGTGHRYEPNR"
FT   gene            85751..87166
FT                   /locus_tag="Bcell_0068"
FT   CDS_pept        85751..87166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0068"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: gwc:GWCH70_0062 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein; Protein of unkown function DUF1946 PP-loop
FT                   ATpase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28360"
FT                   /db_xref="GOA:E6TSE5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE5"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADU28360.1"
FT                   /translation="MNQIVNEFIKDHQLIYEKDRIIVAVSGGPDSMALLHYLQMVKRDY
FT                   HLQLIVAHVEHGLRGVESVNDCNFVKSYCEENKLDFFLYEPNVMAMKEELGLSTQEAAR
FT                   FSRYQWFEKLMEEHKATKLAFAHHGDDQVETVLMKQVRGSVVSLQGIPVKRQFGNGMII
FT                   RPFLCVEKSDILEYCQEHHIQYRIDQSNDSDNYKRNRFRKYILPFLKEENPSIHKTFQR
FT                   QSEISTEENEFLQSLAKMEVEKAIDYHQESEICISNQRLLQMPTTLQRRALHLILNYLS
FT                   LNSGREITVHHFDSIIELIKKASPSGMLHLPKGIFVEKVYDKCLFKVNIHKERPETIQF
FT                   TKIPIPGMVPLKLGKIHTTVLKNWKSFDAKSDTFIGDIGKLSLPLFVRSRKNGDRLSPY
FT                   GLDGTKKLKEVFIEKKVPKHLRDQWPVVTDSNDKIIWVPLLKRSNIALVGESTEQVIKI
FT                   VFDHENDLLLHSI"
FT   gene            87237..87776
FT                   /locus_tag="Bcell_0069"
FT   CDS_pept        87237..87776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0069"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: bpf:BpOF4_08320 hypoxanthine-guanine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28361"
FT                   /db_xref="GOA:E6TSE6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE6"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADU28361.1"
FT                   /translation="MREDIQEILISEEEIQQKVSELGKKLTEEYEGKFPLVVGVLKGSL
FT                   PFMGDLIQKIDTHMEMDLMDVSSYGNETVSSGEVKIVKDLNTSVEGRDVLILEDIIDSG
FT                   LTLSYLVKLFQYRKAKSVKVVTLLDKPDGRKVDLVPDLAGFIVPDEFVVGYGLDYAERY
FT                   RNLPYIGILKPEIYQG"
FT   gene            87847..89889
FT                   /locus_tag="Bcell_0070"
FT   CDS_pept        87847..89889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0070"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: ATP-dependent metalloprotease
FT                   FtsH; PFAM: peptidase M41; AAA ATPase central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28362"
FT                   /db_xref="GOA:E6TSE7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE7"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADU28362.1"
FT                   /translation="MNRIFRNTLFYLLIFLVIVGIVSMFQNPQQTVKHLDFNQFQQQME
FT                   DGNIKSMNIQPKLDVYVIEGEFEETVADGDNNYENFTVNVPDLASVLEGIIVASDTNED
FT                   FNFIPADEPSGWVNFFTAIIPFVIIFILFFFLLSQAQGGGSRVMNFGKSKAKLVSEDKK
FT                   KARFKDVAGADEEKQELVEVVDFLKDPRKFAEIGARIPKGVLLVGPPGTGKTLLARAVA
FT                   GEAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRRRGAGLG
FT                   GGHDEREQTLNQLLVEMDGFGVNEGIILVAATNRADILDPALLRPGRFDRQITVGRPDV
FT                   KGREEVLKVHAKNKPLSEDVDLKTIAQRTPGFSGAELENLLNEAALVAARTNKKKIDME
FT                   SVEEAIDRVIAGTSKKSRVISEKERNIVAHHEAGHTVVGVKLESADMVHKVTIVPRGQA
FT                   GGYAMMLPKEDRYFMTKPELLDKIIGLLGGRVAEEVIFNEVSTGAHNDFQRATGIARKM
FT                   VMEFGMSDKLGPVQFGNTQGEVFLGRDINNEQNYSDAIAHEIDLEVQRILKECYERCRQ
FT                   ILEENIDSLKLVAEMLLEHETLDAEQITSLIEEGKLPEDHHMSKKINGHDDEDNNENDV
FT                   KVNIQAKEEVSEIDSDTDTEDAEEKEENVSGENEVENDEKNKKDE"
FT   gene            90186..90952
FT                   /pseudo
FT                   /locus_tag="Bcell_0071"
FT   gene            90977..91864
FT                   /locus_tag="Bcell_0072"
FT   CDS_pept        90977..91864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0072"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: bha:BH0087 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28363"
FT                   /db_xref="GOA:E6TSE8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE8"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADU28363.1"
FT                   /translation="MKDYLVKALAYEGTVRAYAIQSTEMVREAARRHDTWRTVTAALGR
FT                   ALTAGTMMGAMLKGEEKLTVKIEGTGPASPIIIDANAKGEARGYVSNPHVDPDRKPSGK
FT                   LNVSAAVGEQGSLSVVKDLGMKENFTGSVPLISGELAEDFTYYFASSEQTPSSVALGVI
FT                   VGKDDLVLSAGGFILQMMPGVKEKTIDEIEARLKEVPPVSQLIEDGLSPEEILYFLLGE
FT                   KNVKILENIPVAFQCHCSKERIAQAILGLGEDEVKGMIAEDKGAVTECHFCNETYTFTE
FT                   EELQVILDEIIERK"
FT   gene            91947..92876
FT                   /locus_tag="Bcell_0073"
FT   CDS_pept        91947..92876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0073"
FT                   /product="cysteine synthase A"
FT                   /note="KEGG: bha:BH0088 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28364"
FT                   /db_xref="GOA:E6TSE9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSE9"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ADU28364.1"
FT                   /translation="MAKVVNSITELIGETPLVKLQRLVSENHADVYLKLEFMNPGSSVK
FT                   DRIALSMIEDAEDKGILKPGDTIVEPTSGNTGIGLAMVAAAKGYRTLIVMPETMSLERR
FT                   NLLRAYGAELVLTPGPDGMGGAIQKARELQREHGYFMPQQFENEANPKIHRETTGKELL
FT                   EQVGDQLDAFVSGIGTGGTITGAGQLLKEKFPELHVVAVEPSDSPVLSGGAKGPHKIQG
FT                   IGAGFVPDILNTEIYDEVVTVSTEQAFEYARRAAREEGILGGISSGAAIYSALQVAEKL
FT                   GKGKKVVAVIPSNGERYLSTPLYQFEEE"
FT   gene            93069..94493
FT                   /locus_tag="Bcell_0074"
FT   CDS_pept        93069..94493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0074"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: bpf:BpOF4_08345 para-aminobenzoate synthase
FT                   component I; PFAM: Chorismate binding-like; Anthranilate
FT                   synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28365"
FT                   /db_xref="GOA:E6TSF0"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF0"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ADU28365.1"
FT                   /translation="MCTKKIAIGNKLPLASVTNNWFITYTALVEKEENHVLLESGRGGR
FT                   YSIIGMKPWAIIKGKNKEMTIETKDGTEMKKGPLLESLREWLSFYEIETNDDLPDFQGG
FT                   IIGQFSYDLIREIERLPEDTEDDLGTYDVHFMAFDDIVVIDHMEEMIWFITLTDYKQTG
FT                   ECRLKHMEELWRNDSGSAKPWYHQFQSKPTVEERSFTEDKFIEAVEKTRNYIAAGDVFQ
FT                   VNLSVRETRQLETHPLHIYDCLRKINPSPYMGYFHTPELQLVGGSPELLVKVSGDEVST
FT                   RPIAGTRSRGKNEEEDQALANTLINNEKERAEHVMLVDLERNDIGRVCKYGTVEVNELM
FT                   VIEKYSHVMHIVSNVRGKKADQYDLMDVIAATFPGGTITGAPKIRTMEIIEELEPVRRG
FT                   VYTGSLGWIGFNGDMELNITIRTMVAKSGKVHVQAGAGIVIDSNPMAEYKESLKKAKAL
FT                   WKAKELSEEEQKQKLV"
FT   gene            94510..95106
FT                   /locus_tag="Bcell_0075"
FT   CDS_pept        94510..95106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0075"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: bpf:BpOF4_08350
FT                   para-aminobenzoate/anthranilate synthase glutamine
FT                   amidotransferase component II; TIGRFAM: glutamine
FT                   amidotransferase of anthranilate synthase; PFAM: glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28366"
FT                   /db_xref="GOA:E6TSF1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF1"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADU28366.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGEMGQELIVKRNDQITIEEIEELNPK
FT                   YIMVSPGPCTPNEAGISLKVIEHFAGKIPIFGVCLGHQSIAQVFGGDVIRAERLMHGKT
FT                   SEMYHNGETIFKNIPSPFTATRYHSLIVKKETLPDCFDITAETKEGEIMAIRHKELPIE
FT                   GVQFHPESIMTGEGKVLLNNFLDHHKEFEKQCTSI"
FT   gene            95091..95957
FT                   /locus_tag="Bcell_0076"
FT   CDS_pept        95091..95957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0076"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG:
FT                   gwc:GWCH70_0071 aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28367"
FT                   /db_xref="GOA:E6TSF2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF2"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ADU28367.1"
FT                   /translation="MYLYMNGSIINKEDASISPFDHGFLYGLGLFETFRTYDGHPFLLD
FT                   DHFHRLQESADEMGIILPTYKREKVEGVIRDLLEANQLKDGYFRWNISAGEEEIGLTTT
FT                   PYSAPNTIVFVKPLPAQQAAEKNGQLLSQRRNSPEGKYRLKSHHYLNNIYGKRETGNNP
FT                   HTEGIFLTEDGFVSEGVVSNVFWTKNKTVYTPDRECGALDGITKQFVAAIANKCGINVI
FT                   EGKFKKEALLEADEVFVTNSIQEIVPIKEIGDAVYKGMKGEVYHFLHNNYKKHTSTVFS
FT                   REEVKGG"
FT   gene            95961..96803
FT                   /locus_tag="Bcell_0077"
FT   CDS_pept        95961..96803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0077"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28368"
FT                   /db_xref="GOA:E6TSF3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF3"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADU28368.1"
FT                   /translation="MTFNKVMEWQGYRLDFNTKTYVMGILNVTPDSFSDGGKYGEESFA
FT                   VKHALSMIETGADIIDVGGESTRPGASKVAEEEELRRVLDPIKAVSEVVQVPISIDTYK
FT                   ASVAEKAIQAGASIINDVWGAKADDNMAAVAAHYDVPIILTHNREKADYNNFIEDVIRD
FT                   LEESISLCLNAGVSDSKIILDPGVGFAKTYEQNVLVMRHLEKISEMGYPVLLGTSRKSL
FT                   IAKTLDLPVNERVEGTGATVCLGITKGTNIVRVHDVLEMSRMVKMMDVMIGKAQLPNV"
FT   gene            96817..97176
FT                   /locus_tag="Bcell_0078"
FT   CDS_pept        96817..97176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0078"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   afl:Aflv_0070 dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28369"
FT                   /db_xref="GOA:E6TSF4"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF4"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADU28369.1"
FT                   /translation="MDKIYVNGMDFYGYHGVFAEENKLGQRFFVDVVMEVNTREAGITD
FT                   DLNKTVNYGEVYKITKNIMEGQAVNLVESLAERISHAVLLSFPMVHAVVVKVVKPNPPI
FT                   QGHYESVAVEIRRER"
FT   gene            97179..97715
FT                   /locus_tag="Bcell_0079"
FT   CDS_pept        97179..97715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0079"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; KEGG: afl:Aflv_0071
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28370"
FT                   /db_xref="GOA:E6TSF5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF5"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADU28370.1"
FT                   /translation="MKKDNEHVAYLSLGSNIESRYDYLTFALKKLRENPNITIVKQSSI
FT                   YETEPIGVINQAAFLNMAVKISTSYSPSSLLIALQKIEQQGNRTRDRRWGPRTIDLDIL
FT                   LFNKENINLEHLQIPHPRMYERAFVLVPLFEIEPSIVFNNGKTIASYIDQLTDKEGVRQ
FT                   WKISSGAGESEHSES"
FT   gene            97667..97873
FT                   /locus_tag="Bcell_0080"
FT   CDS_pept        97667..97873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0080"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: bpu:BPUM_0064 transcriptional regulator; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28371"
FT                   /db_xref="GOA:E6TSF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU28371.1"
FT                   /translation="MEDFIWGRRIRAFRKLKGFTQEEFARQLSISVSVLGEIERGSRVP
FT                   SDELLVSVTEVLNVTLEELKSIK"
FT   gene            97892..98887
FT                   /locus_tag="Bcell_0081"
FT   CDS_pept        97892..98887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0081"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: bpf:BpOF4_08380 nitrogen regulation
FT                   transcriptional regulator; TIGRFAM: TIM-barrel protein,
FT                   nifR3 family; PFAM: dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28372"
FT                   /db_xref="GOA:E6TSF7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF7"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADU28372.1"
FT                   /translation="MLKIGDIEMKNQVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVSD
FT                   KAILHKNQRSLKMLYVDDREKPLSLQIFGGDKDTLVEAAKVVDKQTNADIIDINMGCPV
FT                   PKITSCDAGARWLLNPDKIYEMVSYVVDAVDKPVTVKMRIGWDEEHIFAIENAEAVERA
FT                   GGKAVAVHGRTRVQMYEGEANWDIIRDVKNAVNIPVIGNGDIKTPEDAKRMIDTTGVDG
FT                   VMIGRAALGNPWMLYRTIHYLQTGENKPEPSDKEKMDVCILHMDRLVSLKGEVVAVREM
FT                   RKHAAWYIKGMKGSSTLRNAINSVTKRDDMAAVLNDFVENQQETPAVAGR"
FT   gene            99067..100566
FT                   /locus_tag="Bcell_0082"
FT   CDS_pept        99067..100566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0082"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: bha:BH0098
FT                   lysyl-tRNA synthetase; PFAM: tRNA synthetase class II (D K
FT                   and N); nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28373"
FT                   /db_xref="GOA:E6TSF8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF8"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADU28373.1"
FT                   /translation="MSQELELNDQLKVRREKLKDMLDLGIDPFGQRFERTHSAQDLKEL
FT                   YEEESKEELEEKAIEVTLAGRVMTKRGKGKAGFAHIQDLTGQIQLYVRKDQVGEDQYDI
FT                   FNRIDIGDLVGVTGEVFKTKVGELSIKVKDFQILTKALRPLPDKYHGLKDVEQRYRQRY
FT                   VDLIVNPEVRETFILRSKILQSMRRYLDNQGYLEVETPTMHAIAGGASARPFVTHHNAL
FT                   DMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYND
FT                   IMELTENLIAHIAEEVLGTTTVNYNGVDVDLKPRWKRVHMVDAIKEYTGVDFWEEMTDE
FT                   EARALAKEHNVPVKDTMKYGHVVNEFFETFVEEKLVQPTFIYGHPVDISPLAKKNADDE
FT                   RFTDRFELFIVAREHANAFTELNDPIDQRERFEAQLVEREQGDDEAHMMDEDFVEALEY
FT                   GMPPTGGLGIGIDRLVMLLTNSQSIRDVLLFPQMRHRDAED"
FT   gene            101441..102983
FT                   /locus_tag="Bcell_R0008"
FT   rRNA            101441..102983
FT                   /locus_tag="Bcell_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            103152..103228
FT                   /locus_tag="Bcell_R0009"
FT                   /note="tRNA-Ile1"
FT   tRNA            103152..103228
FT                   /locus_tag="Bcell_R0009"
FT                   /product="tRNA-Ile"
FT   gene            103242..103317
FT                   /locus_tag="Bcell_R0010"
FT                   /note="tRNA-Ala1"
FT   tRNA            103242..103317
FT                   /locus_tag="Bcell_R0010"
FT                   /product="tRNA-Ala"
FT   gene            103502..106432
FT                   /locus_tag="Bcell_R0011"
FT   rRNA            103502..106432
FT                   /locus_tag="Bcell_R0011"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            106502..106617
FT                   /locus_tag="Bcell_R0012"
FT   rRNA            106502..106617
FT                   /locus_tag="Bcell_R0012"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 97.23"
FT   gene            106626..106701
FT                   /locus_tag="Bcell_R0013"
FT                   /note="tRNA-Val1"
FT   tRNA            106626..106701
FT                   /locus_tag="Bcell_R0013"
FT                   /product="tRNA-Val"
FT   gene            106707..106782
FT                   /locus_tag="Bcell_R0014"
FT                   /note="tRNA-Thr1"
FT   tRNA            106707..106782
FT                   /locus_tag="Bcell_R0014"
FT                   /product="tRNA-Thr"
FT   gene            106801..106876
FT                   /locus_tag="Bcell_R0015"
FT                   /note="tRNA-Lys1"
FT   tRNA            106801..106876
FT                   /locus_tag="Bcell_R0015"
FT                   /product="tRNA-Lys"
FT   gene            106891..106975
FT                   /locus_tag="Bcell_R0016"
FT                   /note="tRNA-Leu1"
FT   tRNA            106891..106975
FT                   /locus_tag="Bcell_R0016"
FT                   /product="tRNA-Leu"
FT   gene            107024..107098
FT                   /locus_tag="Bcell_R0017"
FT                   /note="tRNA-Gly1"
FT   tRNA            107024..107098
FT                   /locus_tag="Bcell_R0017"
FT                   /product="tRNA-Gly"
FT   gene            107124..107212
FT                   /locus_tag="Bcell_R0018"
FT                   /note="tRNA-Leu2"
FT   tRNA            107124..107212
FT                   /locus_tag="Bcell_R0018"
FT                   /product="tRNA-Leu"
FT   gene            107216..107292
FT                   /locus_tag="Bcell_R0019"
FT                   /note="tRNA-Arg1"
FT   tRNA            107216..107292
FT                   /locus_tag="Bcell_R0019"
FT                   /product="tRNA-Arg"
FT   gene            107357..107433
FT                   /locus_tag="Bcell_R0020"
FT                   /note="tRNA-Pro1"
FT   tRNA            107357..107433
FT                   /locus_tag="Bcell_R0020"
FT                   /product="tRNA-Pro"
FT   gene            107441..107516
FT                   /locus_tag="Bcell_R0021"
FT                   /note="tRNA-Ala2"
FT   tRNA            107441..107516
FT                   /locus_tag="Bcell_R0021"
FT                   /product="tRNA-Ala"
FT   gene            107676..109218
FT                   /locus_tag="Bcell_R0022"
FT   rRNA            107676..109218
FT                   /locus_tag="Bcell_R0022"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            109552..112482
FT                   /locus_tag="Bcell_R0023"
FT   rRNA            109552..112482
FT                   /locus_tag="Bcell_R0023"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            112552..112667
FT                   /locus_tag="Bcell_R0024"
FT   rRNA            112552..112667
FT                   /locus_tag="Bcell_R0024"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 97.23"
FT   variation       112863
FT                   /replace="a"
FT                   /note="SNP"
FT   gene            114166..114873
FT                   /locus_tag="Bcell_0083"
FT   CDS_pept        114166..114873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0083"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: MgtC/SapB
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28374"
FT                   /db_xref="GOA:E6TSF9"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSF9"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ADU28374.1"
FT                   /translation="MLDILANDTFIMTVRLVLAAILGGLVGVEREYHQHPAGFRTHLLV
FT                   SVGSCLIMLLAFYGFQTYMSENENYINFDPSRLAAYVVSGIGFLGAGTILVQGYTVRGL
FT                   TTAASIWVVAGIGLTVGAGLYTPAIITTVIVILSLYLLGKIDFNFLSKAQKNNIYITVD
FT                   ENKSTLTSIISVCEQLDIQIKAISSERQEGYKESSVIEYRLYVATVEEKTYYALVEALQ
FT                   NYEFVRKINIDAK"
FT   gene            115138..115602
FT                   /locus_tag="Bcell_0084"
FT   CDS_pept        115138..115602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0084"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: transcriptional repressor, CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28375"
FT                   /db_xref="GOA:E6TSG0"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG0"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADU28375.1"
FT                   /translation="MRNISDIIEDYLKQIIEHSKNELIEIKRSELAERFECVPSQINYV
FT                   ISTRFTIEKGYMVESKRGGGGYIRISKVKLNDKNELIDKLVEITGSQISQHSAISIISR
FT                   LYEEEVITKREANLMLSVIDRSIISLTLPLRDEMRARILKAMISTLKYEE"
FT   gene            115615..116151
FT                   /locus_tag="Bcell_0085"
FT   CDS_pept        115615..116151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0085"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: bha:BH0101
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28376"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG1"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADU28376.1"
FT                   /translation="MLCQECQQRQATLHFTKIINGEKTEFHICDTCAKEKGDYFPGSNS
FT                   FSIHQLLSGLLDVEKPLSTTSGTQITPKKELKCEKCGMTYQQFADIGRFGCSACYDTFN
FT                   EKLDPILRRIHSGNSVHGGKIPRRKGKDLHVHKEIERLKQDMQKYINEEEFESAAEVRD
FT                   QIRSLEKSLQDEKEG"
FT   gene            116154..117224
FT                   /locus_tag="Bcell_0086"
FT   CDS_pept        116154..117224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0086"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   bpf:BpOF4_08400 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28377"
FT                   /db_xref="GOA:E6TSG2"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG2"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADU28377.1"
FT                   /translation="MSLQNFISKAISPWMKNEGPDSDIVLSSRVRLARNLSNVPFPITA
FT                   SKEKLEENILLVKDKFANKTHHKFGDLELLKMEDMKQNEKRVLVEKHLISPNLSDESKA
FT                   GAVLLSEDESLSIMINEEDHFRIQVLLSGFELSKGLTYANEIDDWMEDKVDFAFIEKRG
FT                   YLTSCPTNVGTGLRASVMMHLPALVITRQMNRILPAINQLGLVVRGIYGEGSEALGNLF
FT                   QISNQMTLGKSEEDIVDDLRSVVSQLIQQERAARETLLHQSKIQMEDRVYRSFGILSYS
FT                   RTMESKEATQRLSDVRLGIDLGFINDVSGNILNELMILTQPGFLQQYAGEILSPEQRDQ
FT                   RRATLIRERLKLEETD"
FT   gene            117251..119701
FT                   /locus_tag="Bcell_0087"
FT   CDS_pept        117251..119701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0087"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: bha:BH0103 class III stress response-related
FT                   ATPase; PFAM: ATPase AAA-2 domain protein; Clp domain
FT                   protein; AAA ATPase central domain protein; UvrB/UvrC
FT                   protein; Clp ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28378"
FT                   /db_xref="GOA:E6TSG3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG3"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADU28378.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAMRLGHNNIGTEHILLGLVREGEGI
FT                   AAKALVALGLSPEKIQTEVENLIGKGEEKTKQIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNVGVSLNKARQQVLQLLGSNESTNNQQQGASGAGSNVN
FT                   TPTLDSLARDLTAIAKEEQIDPVIGRAKEIERVIQVLSRRTKNNPVLIGEPGVGKTAIA
FT                   EGLAQQIVNNEVPETLRNKRVMTLDMGTVVAGTKYRGEFEDRLKKVMEEIRQAGNVILF
FT                   IDELHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQP
FT                   IQVDEPTNDESIQILKGLRDRYEAHHRVEITDDAIEAAVKLSDRYISDRFLPDKAIDLI
FT                   DEAASKVRLRSYTAPPNLKEMEQKLEETRKEKDAAVQSQEFEKAASLRDNEQRVREELE
FT                   TMKKEWKEKQGQENSEVTTEDIALVVSSWTGIPVSKLAEEETERLLKMEEILHNRVIGQ
FT                   EEAVTAVSKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAESLFGDEDAIIRI
FT                   DMSEYMEKHNTSRLVGSPPGYVGHEEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNILL
FT                   QVLEDGFLTDSKGRRVDFRNTAIIMTSNVGASTLRQSKSLGFTAQLDGQEYKDMKGKVM
FT                   SELKKAFRPEFLNRIDELIVFHSLEKEHIKKIVSLMANQLTKRLSEQGIEFELSEEAMA
FT                   KIADEGFDPEYGARPLRRALQKQVEDRLSEELLRGNIAKGQHVKMDVKDGEYTVTSTQE
FT                   ASKN"
FT   gene            119879..121282
FT                   /locus_tag="Bcell_0088"
FT   CDS_pept        119879..121282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0088"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: DNA repair protein RadA; TIGRFAM: DNA repair
FT                   protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28379"
FT                   /db_xref="GOA:E6TSG4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG4"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADU28379.1"
FT                   /translation="MAKRKTKFVCQDCGYESMKWMGKCPGCQSWNSMVEEFEATASPKK
FT                   RGFVTASTTLSKPQPITKIERREEQRYNTHINELNRVLGGGIVPGSLVLVGGDPGIGKS
FT                   TLLLQVSSEVAKHGERVLYISGEESIKQTKLRADRLHISSDELFVLAETDVEHIEKIIE
FT                   EMNPTLVIIDSIQTVYLDAVTSAPGSVSQVRECTAAFMRIAKTKGIAIFIVGHVTKQGS
FT                   IAGPRLLEHMVDSVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMKEIGLAEVLNPSE
FT                   IFLEERSAGAAGSAVVASMEGTRTVLVEIQALISPTSFGNPRRMSTGIDHNRISLIMAV
FT                   LEKRVGMLLQNQDAYVKVAGGVRLDEPSIDLATAIAIASSFRDAPTPTSDVIIGEVGLT
FT                   GEVRRVTRLEQRVLEASKLGFKRVIVPEKNLGGWNIPSGIDVIGVNTVNEAIEVTLGGA
FT                   TSGSPKFEL"
FT   gene            121257..122339
FT                   /locus_tag="Bcell_0089"
FT   CDS_pept        121257..122339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0089"
FT                   /product="DNA integrity scanning, DisA, linker region"
FT                   /note="PFAM: DNA integrity scanning, DisA, linker region;
FT                   protein of unknown function DUF147; helix-hairpin-helix
FT                   motif; KEGG: bpf:BpOF4_08415 DNA integrity scanning protein
FT                   DisA"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28380"
FT                   /db_xref="GOA:E6TSG5"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG5"
FT                   /inference="protein motif:PFAM:PF10635"
FT                   /protein_id="ADU28380.1"
FT                   /translation="MDHRSSSYDSNFINEVLQLVSPGTALREGIDNVLRAKTGGLIVLG
FT                   YTNSMMDIVDGGFFINCEFSPAYLYELAKMDGAIILNEDGSRILYANTQLVPNNAIEST
FT                   ETGIRHRTAQRVARQTGNLVVSISQRRNVITLYQGEYRYALKDIGVILTKANQAIQTLE
FT                   KYKSVLDQGITNLGALEFEELVTFQEVSQVMHRIEMVLRIKSEIKNYVNELGNEGRLIS
FT                   MQLEELVSNTENEAVLLIKDYMNDKDQDPVQLLRKLKRLSSEELLDDQVIVKLLGYTKS
FT                   TNLSEFAICPRGYRILNKIPRIPPLVVENLIDKFIELPEIMRANIEELDEVDGIGEARA
FT                   RKIKEGLTRIQEQLFIDRHI"
FT   gene            122553..123647
FT                   /locus_tag="Bcell_0090"
FT   CDS_pept        122553..123647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0090"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: bpf:BpOF4_08420 hypothetical protein; PFAM:
FT                   PilT protein domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28381"
FT                   /db_xref="GOA:E6TSG6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG6"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADU28381.1"
FT                   /translation="MLKRIVQLFILLIGGTLGFLYSQNVIEILNVGNVPSWIDNPYSGA
FT                   MLGAIILFLSTFWLVEDIVGLIRLVEETLVKAPVTDLLFGTMGLGIGLLLAYLFGLPIA
FT                   ELQLQIVSSILPLFITIILGYLGFQVGFKKRDELINLFSIGKSAKDKKVDGQGNKQLNG
FT                   SLKILDTSVIIDGRIADICQTGFLEGTLMIPEFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNKIQKELPVNVEIYEGDFEDIQEVDSKLVKLAKLLDGYVVTNDFNLNKVCDLQGVSVL
FT                   NINDLANAVKPVVLPGEEMGVQVIKDGKEQNQGIAYLDDGTMIVVEEGRNYIGQNIEVI
FT                   VTSVLQTSAGRMIFAKPKLLEKAL"
FT   gene            123696..124391
FT                   /locus_tag="Bcell_0091"
FT   CDS_pept        123696..124391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0091"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: afl:Aflv_0080 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28382"
FT                   /db_xref="GOA:E6TSG7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG7"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADU28382.1"
FT                   /translation="MKNYQVVIPAAGQGKRMNAGKNKQFLLINQIPLLIHTLRVFEEDL
FT                   LCDKIILVVNKEEIEQMKRLTSQYAIKKVEKIVVGGSERQESVYEGLKAVQGNPIVLVH
FT                   DGARPFIKQPIIDALVDSVMKRGASIVATPVKDTVKQVSKEYIHHTVDRTSLWAAQTPQ
FT                   AFRHEQILRAHEHAVKVGYTGTDDASLLEHNGEKVYIVPGDYENIKITTPEDLIFGEAI
FT                   IKSRKEGNK"
FT   gene            124388..124864
FT                   /locus_tag="Bcell_0092"
FT   CDS_pept        124388..124864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0092"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="KEGG: bpf:BpOF4_08430 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28383"
FT                   /db_xref="GOA:E6TSG8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG8"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADU28383.1"
FT                   /translation="MIRIGQGFDVHQLVEGRPLIIGGIIIPHDKGLLGHSDADVLLHTI
FT                   ADACLGAIGEGDIGKHFPDTDPLFKDADSAKLLVHVWNLVKEKGYALGNLDCTIMAQKP
FT                   KMAPHIQAMRGRIAALLEADVSQINVKATTTEKLGFTGREEGIASMAVVLLTKS"
FT   gene            124955..126412
FT                   /locus_tag="Bcell_0093"
FT   CDS_pept        124955..126412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0093"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28384"
FT                   /db_xref="GOA:E6TSG9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSG9"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADU28384.1"
FT                   /translation="MTQQVRVRFAPSPTGHLHIGGARSALFNYLFARNQNGKFIVRIED
FT                   TDQARNVDTATEKLLNSLKWLGIEWDESVDIGGPHAPYKSMERIDIYKKYIDQLIEEGK
FT                   AYYCYMTEEELEAEREEQRGRGETPKYSGRDRHLTAEQRNAYEQEGRKPVVRFLVPENK
FT                   TIVVDDIVRGNVTFDSDGIGDFVIARKDGIPTYNFAVVIDDYLMEISHVIRGEEHLSNS
FT                   PRQVLLYEALGWETPRFAHASLILNEDHKKMSKRDESIIQFVEQYRDLGYLPEAIVNFI
FT                   ALLGWSPGGEEEILTKDQLVNQFSLERVIKAPAVFDTKKLAWMNNQYMKEADIDKVVEV
FT                   SLPHLIHAGRLPEDLDGEERQWAYELIALHQEKMSYGAEIVELTELFFKEEIDYNEEAT
FT                   EVLEEEQVNEVLQAFKEKLTLLNEFSAEAIKKAMKEVQKETGHKGKKLFMPIRVATTGQ
FT                   THGPDLPKAIVLLGKEKVISRITSIIK"
FT   gene            127357..128004
FT                   /locus_tag="Bcell_0094"
FT   CDS_pept        127357..128004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0094"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   bha:BH0110 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28385"
FT                   /db_xref="GOA:E6TSH0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH0"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADU28385.1"
FT                   /translation="MFKTLKNDIDVVLERDPAARNRLEVFINYSGVHAIWNHRFAHWLW
FT                   KKRLYFIARFISQVSRFITGIEIHPGAKIGQRLFIDHGMGVVIGETCEIGDNVTIFQGV
FT                   TLGGTGKEKGKRHPTLEDDVLIATGAKVLGSMRIGKGARIGAGAVVLKEVPPNSTVVGI
FT                   PGRVVIQDGVKVSHDLDHINLPDPISDKFKELEVEILELKKELTELKREKVN"
FT   gene            128031..129431
FT                   /locus_tag="Bcell_0095"
FT   CDS_pept        128031..129431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0095"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia ; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28386"
FT                   /db_xref="GOA:E6TSH1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH1"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADU28386.1"
FT                   /translation="MTIQVYNTLSRKVEPFQPIEEGKVSMYVCGPTVYNYIHIGNARPA
FT                   VVFDMVRRYLQYRGYEVQYISNFTDVDDKIIKAAEEMGEDVPTIAERFIEAYFEDTAAL
FT                   GVQKADKHPRVTETMPEIIDFIARLIEKGYAYESQGDVYFRTRKFDGYGKLSHQSIDDL
FT                   KLGSRIEVGDKKEDPLDFVLWKSAKEGEIYWDSPWGNGRPGWHIECSAMVKKYLGDTID
FT                   IHAGGQDLSFPHHENEIAQSESLNGKKMANYWIHNGYINIDNEKMSKSLGNFILVHDII
FT                   KKYDPEVVRFFIVNAHYRSPINFSDEQLTSAKSGLERIKTTYLNVKHRLSETANLGEDV
FT                   EKWTKDMGVIHTRFLEAMDDDFNSANAVAAMFDLIKLGNLYLREDHTNKRVLEYFIKQL
FT                   DDMSYVLGLTLNKKEEILDEEIEVLIQERIDARKNRNFARADEIRDLLKEQNIILEDTP
FT                   QGTRWKRA"
FT   gene            129438..129857
FT                   /locus_tag="Bcell_0096"
FT   CDS_pept        129438..129857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0096"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: ribonuclease III; PFAM: ribonuclease III;
FT                   SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28387"
FT                   /db_xref="GOA:E6TSH2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH2"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADU28387.1"
FT                   /translation="MKLNDIVTEPEQINALALAYMGDAVLETYVRYRLIAKGQVRPNKL
FT                   HREGTKYVSAKAQAKVLHTFFEKNLLTDEEKSVALRGRNAKSGTVPKNTDHATYRYSTA
FT                   FEALIGFLYLTNKLARLDELIGQAFHIVEGKEGEG"
FT   gene            129854..130612
FT                   /locus_tag="Bcell_0097"
FT   CDS_pept        129854..130612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0097"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: bha:BH0113 tRNA/rRNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28388"
FT                   /db_xref="GOA:E6TSH3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH3"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADU28388.1"
FT                   /translation="MSQELEYIFGKNPVLEALRGKRPINKIWIAEGSLRGPMIQVLELS
FT                   KEKKINTQIVPKKKLDQMVPKDQQHQGVIAQVAAYEFQEIDVLFERARQKNEQPFFLLL
FT                   DELEDPHNLGSILRTADAVGAHGIIVPKRRSVGLTYTVAKASAGAIEHVPVTRVTNLAR
FT                   TMDELKKEGLWFVGTDAKGEQDYREVDLDMPVVLVIGSEGRGISRLVKEKCDFLVQIPL
FT                   AGKVTSLNASVAASLLMYEVYRRRFPQGLK"
FT   gene            130614..131126
FT                   /locus_tag="Bcell_0098"
FT   CDS_pept        130614..131126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0098"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28389"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH4"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADU28389.1"
FT                   /translation="MRRVLLVDGYNMIGDWPELKDLQLTDLEGARDKLIEHMAEYQAYT
FT                   GIEVTVIFDAHMVPGLGKKYQNYRINIIYTREKETADERIEKLVKELKRVDTQIYVATS
FT                   DFVEQRVIFASGAFRKSARELRTEVLSIEKGIEKEVEKRKQKRAKTKLPITDEMAELFE
FT                   KWRRGEK"
FT   gene            131259..131912
FT                   /locus_tag="Bcell_0099"
FT   CDS_pept        131259..131912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0099"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: bpf:BpOF4_08465 RNA polymerase factor
FT                   sigma-70; TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28390"
FT                   /db_xref="GOA:E6TSH5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH5"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ADU28390.1"
FT                   /translation="MALNIIENGLQANYDEIEDESLVEYVREGDSSALEYLINKYKNFV
FT                   RAKARSYFLIGADHEDIVQEGMIGLYKAIRDFKGDKLSSFKAFAELCITRQIITAIKTA
FT                   TRQKHIPLNSYVSLDKPIYDEESDRTLLDVIVGSKISDPEELLINREEFDDIELKMSEI
FT                   LSDLERKVLMQYLDGRSYQEISVDLKRHVKSIDNALQRVKRKLERYVELKGVKL"
FT   gene            132193..132342
FT                   /locus_tag="Bcell_0100"
FT   CDS_pept        132193..132342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0100"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: oih:OB0104 50S ribosomal protein L33; TIGRFAM:
FT                   ribosomal protein L33; PFAM: ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28391"
FT                   /db_xref="GOA:E6TSH6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH6"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADU28391.1"
FT                   /translation="MSQKIVLACDICKSRNYTTNKTEQERTNRLQINKYCKTCGIHTMH
FT                   VETK"
FT   gene            132373..132552
FT                   /locus_tag="Bcell_0101"
FT   CDS_pept        132373..132552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0101"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="KEGG: bpf:BpOF4_08475 preprotein translocase
FT                   subunit; TIGRFAM: preprotein translocase, SecE subunit;
FT                   PFAM: protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28392"
FT                   /db_xref="GOA:E6TSH7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH7"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADU28392.1"
FT                   /translation="MGATKFLKDVSTEMKRVSWPKRKELVRYTGVVIATVAFVAVYFAI
FT                   TDFGISELIRAILN"
FT   gene            132611..133144
FT                   /locus_tag="Bcell_0102"
FT   CDS_pept        132611..133144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0102"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain-containing protein; KOW
FT                   domain protein; KEGG: bpf:BpOF4_08480 transcription
FT                   antitermination protein NusG; SMART: NGN domain-containing
FT                   protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28393"
FT                   /db_xref="GOA:E6TSH8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH8"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADU28393.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKTNLEKRLESMDMSDKIFRVLVPVEEE
FT                   TEVKNGKSKQVTKKVFPGYVIVEMIMTDDSWYVVRNTPGVTGFVGSAGAGSKPTPLLPE
FT                   EVEGILRQMGVEEPKADIDFELKESVKVKEGPFANFIGTVEDIHADKQKLKVHVNMFGR
FT                   ETPVELDFTQVEKL"
FT   gene            133305..133730
FT                   /locus_tag="Bcell_0103"
FT   CDS_pept        133305..133730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0103"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: Ribosomal
FT                   protein L11-like; KEGG: ribosomal protein L11; SMART:
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28394"
FT                   /db_xref="GOA:E6TSH9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSH9"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADU28394.1"
FT                   /translation="MAKKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TQEQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIETASGEPNTKKVATLKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   gene            133855..134550
FT                   /locus_tag="Bcell_0104"
FT   CDS_pept        133855..134550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0104"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: bpf:BpOF4_08490 50S ribosomal protein L1;
FT                   TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28395"
FT                   /db_xref="GOA:E6TSI0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI0"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADU28395.1"
FT                   /translation="MAKKGKKYEDAIKLVDRERVYEIQEAVELVKKTATAKFDETVELA
FT                   ARLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGDKAKEAEAAGADFVGEDDLINKV
FT                   NQGWFDFDVVVATPDMMAQVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKTGNIHVPIGKVSFSDEKLAENLTTIIETLLKAKPASSKGTYMRNVAIASTMGPGV
FT                   KVNVSAVKL"
FT   gene            134791..135291
FT                   /locus_tag="Bcell_0105"
FT   CDS_pept        134791..135291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0105"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: ribosomal protein
FT                   L10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28396"
FT                   /db_xref="GOA:E6TSI1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI1"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADU28396.1"
FT                   /translation="MGAVIEKKKQVVDEIAEKLQASQSTIVVDYRGLNVSEVTELRKQL
FT                   REAGVDFKVYKNTLARRATEKAGLTELDENLVGPTAIAFSNDDVIAPAKVLAGFAKKHD
FT                   ALEIKAGVIEGKVVSLDEVRAIAELPSREGLLSMLLSVMQAPIRNFALATKAVAEQKEE
FT                   QGA"
FT   gene            135355..135717
FT                   /locus_tag="Bcell_0106"
FT   CDS_pept        135355..135717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0106"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: bha:BH0122 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28397"
FT                   /db_xref="GOA:E6TSI2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI2"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADU28397.1"
FT                   /translation="MTKEQMIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGGGAA
FT                   EAAEEKTEFDVILESPGGSKINVIKVVREITGLGLKDAKALVDGAPAPVKEGVSKEDAE
FT                   EMKAKLEEAGASVEVK"
FT   gene            135933..136535
FT                   /locus_tag="Bcell_0107"
FT   CDS_pept        135933..136535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0107"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: btk:BT9727_0097
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28398"
FT                   /db_xref="GOA:E6TSI3"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI3"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADU28398.1"
FT                   /translation="MSDHYYSEKPTVKSERKKITETITNDQYTFYVDRGIFSKTGLDFG
FT                   SRLLIESFELPNVVGTIVDVGCGWGPISISLAKRNPNIDFIALDINERAVKLTEENVKL
FT                   NGVTNLHVMQSNLLEGHEGKYYSAIITNPPIRAGKNTVFKLYEQAANALVKNGEIWIVI
FT                   QKKQGAPSTIAKLEDLGFDVEVIKKSKGYYIIRGKKC"
FT   gene            136826..140365
FT                   /locus_tag="Bcell_0108"
FT   CDS_pept        136826..140365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0108"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: bha:BH0126 DNA-directed RNA polymerase subunit
FT                   beta; TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 2; RNA polymerase Rpb2
FT                   domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28399"
FT                   /db_xref="GOA:E6TSI4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI4"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADU28399.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLDLPNLIEIQTASYQWFLDEGI
FT                   REMFQDISPIEDFTGNLVLEFIDYSLGEPKYSVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKEQEVFMGDFPLMTDTGTFVINGAERVIVSQLVRSPSVYYNKKVDKNGKKGFTATVI
FT                   PNRGAWLELETDAKDIVYVRIDRTRKIPVTVLLRALGFGTDQEIIELLGEDEYLRNTLE
FT                   KDNTDNSEKALLEIYERLRPGEPPTVENAKSLLESRFFDPKRYDLANVGRYKMNKKLHI
FT                   KDRLFNQRLAETLVDPDTGEVLAEEGAVIDRRLLDKLIPYLENNVGFKHYTLRGGVIEE
FT                   DEVELQSILITNPESVDEQPIRVLGNGVVEKAVKNITVADIIASINYFFNLLHGVGNTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDANVITPQALINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSFAKVNEFGFMETPYRKVDHETGRVTSQFDYLTADEEDNYVVAQ
FT                   ANAKLDENGAFMDENIICRFRGENIIVSRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLKPEAPLVGTGMEYVSAKDSGAAVVSKVRGRVERVSAKYVEIRR
FT                   VETVDGNEVEGDIVRYNLQKFERSNQGTCYNQRPIVSEGNFVEIGEILADGPSMELGEM
FT                   ALGRNVMVGFMTWDGYNYEDAIILSERLVKDDVYTSVHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIIRVGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRAPHGGDGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRHG
FT                   NKGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARNLGIHVAS
FT                   PVFDGAREEDVWGTLEEAGMARDGKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMLSSNEEEIEMLELDDEEEQGND
FT                   KLNLNLESSESNG"
FT   variation       138393
FT                   /locus_tag="Bcell_0108"
FT                   /replace="t"
FT                   /note="SNP"
FT   gene            140402..144016
FT                   /locus_tag="Bcell_0109"
FT   CDS_pept        140402..144016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0109"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; RNA polymerase Rpb1 domain 5; KEGG: DNA-directed
FT                   RNA polymerase, beta' subunit; SMART: RNA polymerase I
FT                   subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28400"
FT                   /db_xref="GOA:E6TSI5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI5"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADU28400.1"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSRGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRSLEEVIYFASYVVTDTGDTPLELKQLLSEKEYRTYREKYG
FT                   RGFKAQMGAEAIRKLLQDIDLDKEVNMLKEELLTAQGQRRTRAIKRLEVLEAFRHSGNH
FT                   PDWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVSNGLAHNIKSAKRKVERVQPEVWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIKLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAESRLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGNVYK
FT                   DANEVLTAYQNGYVHLHSRIAIPVSSLSKTNFKEDHYGKLLLTSVGKIIFNEILPETFP
FT                   YLNEPTTENLVIETPDKYIVPMTTDVKEEFKQRDVVLPFKKGFLGDIIAEVFKKFKISE
FT                   TSVMLDKMKDLGFHYSTKAGITVGVADIVVLKEKKEILEEAEIKVERILKQYRRGLITE
FT                   EERYDKVIEVWSSSKDLIQEKLMGTLDKLNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLEVAAIKEGNEVIEPLYDRLVGRVVHQTVYHPETNEVLIARNEEINED
FT                   MAKTIEDLGIEIVVIRSAFTCDTKHGVCKACYGRNLATGSEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEVFEARNPKGQAVISEIEGTVSDIKEVNDKKE
FT                   IVVQGAIETRSYTPPYGARLKVEVGQEVRPGQELTEGSIDPKELLTVSGVQGVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVVDAGDTDVLPGSLVEVHQFIEANRDILL
FT                   RGGMPASGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKKDELVGLKENVII
FT                   GKLVPAGTGMQRYRQIAPKNPAQEESTEDVLEEVIVQD"
FT   gene            144131..144379
FT                   /locus_tag="Bcell_0110"
FT   CDS_pept        144131..144379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0110"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28401"
FT                   /db_xref="GOA:E6TSI6"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI6"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ADU28401.1"
FT                   /translation="MSYEKVVQATERVVGTKQTIKALEDKQVKEVIVAEDADAKVLQKV
FT                   TLLAEKQGVPLTKVDSMKKLGKSCGIDVSAATVAIKK"
FT   gene            144491..144904
FT                   /locus_tag="Bcell_0111"
FT   CDS_pept        144491..144904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0111"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: bha:BH0129 30S ribosomal protein S12; TIGRFAM:
FT                   ribosomal protein S12; PFAM: ribosomal protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28402"
FT                   /db_xref="GOA:E6TSI7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI7"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADU28402.1"
FT                   /translation="MPTINQLVRKGRESKTQKSDSPALNKGYNSFKKVQTDLSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRMQGRSKYGTKRPKK"
FT   gene            144966..145436
FT                   /locus_tag="Bcell_0112"
FT   CDS_pept        144966..145436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0112"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: bcl:ABC0146 30S ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28403"
FT                   /db_xref="GOA:E6TSI8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI8"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADU28403.1"
FT                   /translation="MPRKGPVPRRDVLPDPIYNSKLVTRLINRIMIDGKRGVAQTILYK
FT                   AFELVQERSGNDPQEVFEQALKNIMPVLEVKARRVGGANYQVPIEVKPERRTTLGLRWL
FT                   VSYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHRMAEANKAFAHYRW"
FT   gene            145579..147657
FT                   /locus_tag="Bcell_0113"
FT   CDS_pept        145579..147657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0113"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: bha:BH0131 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28404"
FT                   /db_xref="GOA:E6TSI9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSI9"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADU28404.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERVLFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKEHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKIGADFIYSLGTLHDRLGANAHAIQ
FT                   LPIGAEDDFEGIIDLVEMKAYFYEDDLGTRTEAKEIPEEYKAQAEEYHDKLVEAVSELD
FT                   EELMMKYLEGEEVTVDELKAAIRKGTINVEFYPVICGSAFKNKGVQLMLDAVIDYLPAP
FT                   TDVPDIKGILPDSEEEVTRKSSDDQPFSALAFKVMTDPFVGKLTFFRVYSGTVDAGSYV
FT                   RNSTKGKRERMGRILQMHANHREEIATVYAGDIAAGVGLKETSTGDTLCDEKNLVILES
FT                   MEFPEPVISLSVEPKSKADQDKMGMALAKLAEEDPTFRTHTDEETGQTIIAGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVSYRETIRQAAKCEGKFVRQSGGRGQYGHVWVEFSPNEE
FT                   GAGFEFEDAIVGGVVPREYIPSVKAGLEDAVDNGLLAGFPLIDIKAKLFDGSYHDVDSN
FT                   EMAFKVAASMALKDAKNKCNPVILEPVMKVEVVIPEEYMGDIMGDITSRRGRVEGMDAR
FT                   GNAQIVKAMVPLAEMFGYATSLRSNTQGRGQYTMHFDHYEEVPKSVGEEIIKKNAGQ"
FT   gene            147784..148974
FT                   /locus_tag="Bcell_0114"
FT   CDS_pept        147784..148974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0114"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: translation elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor Tu
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28405"
FT                   /db_xref="GOA:E6TSJ0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ0"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADU28405.1"
FT                   /translation="MGKEKFDRSKTHANIGTIGHVDHGKTTLTAAITHVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSRQVGVPYIVVFLNKVDMVDDEELLELVEMEVRDLLSEYD
FT                   FPGDDIPVIAGSALKALEGDAQYEEKIHELMAAVDDYIPTPERDKDKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQLNVGDEVSIIGLTEEPGKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGTARDEINRGQVLAKPGTITPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDV
FT                   TGICQLPEGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGVVASIQE"
FT   gene            149154..149258
FT                   /pseudo
FT                   /locus_tag="Bcell_0115"
FT   gene            150105..151166
FT                   /locus_tag="Bcell_0116"
FT   CDS_pept        150105..151166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0116"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: bha:BH3640 oligopeptide ABC transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28406"
FT                   /db_xref="GOA:E6TSJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU28406.1"
FT                   /translation="MGLVISILKSRVIRVINVSEHLVELKNLKTSFRILDDYYAAVDDV
FT                   SLNINKNEVLAIVGESGSGKSALAFSIMGLHNRAKIEGTIDYKGNNIANISSSKLNKLR
FT                   GKEMAMIFQDSLSALNPLMVIGDQIDEAILLHNSKLSKKDRKVRVLDLLDKVGIPRPDK
FT                   TYSQYPHELSGGMRQRVVIAMAIANQPELLIADEPTTALDVTIQSQILDLLKELKNDMR
FT                   AGIVLITHDLGVVAEMADRVAVMYAGQIVEIADVYSLLENPQHPYTRSLLNSVPSDDKE
FT                   KLHVIEGVVPALQYLPRQGCRFKSRIPWIDDSAHEENPQLHEIKPGHFVRCTCYKHFDF
FT                   PDNSKEESSNGTS"
FT   gene            151153..152088
FT                   /locus_tag="Bcell_0117"
FT   CDS_pept        151153..152088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0117"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bha:BH3639 oligopeptide ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28407"
FT                   /db_xref="GOA:E6TSJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28407.1"
FT                   /translation="MALLEVKDLKVHFPIRGGLFRRVVDQIKAVDGVSLNIEEGQTYGL
FT                   VGESGSGKSTTGRAIIGLNQITSGEVIFNGHDLSKSTRKSHLNVRRDIQMIFQDPYSSL
FT                   NPKKRVVDIVAEPLRNFEKLSATEERRRVQELMDMVGLSPEAIYKYPHEFSGGQRQRIG
FT                   IARAIALKPKLIIADEPVSALDVSVQAQVLNFMQDIQKELNLTYLFVSHDLGIIRHMCD
FT                   HIAIMYKGRYVEQGTADDIFENGQHIYTKRLLAAIPDIDPRQREIQLENRQKVKEDFDN
FT                   LQKDYFDEEGLPYSLKPISKTHYVALPERG"
FT   gene            152094..153056
FT                   /locus_tag="Bcell_0118"
FT   CDS_pept        152094..153056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB2613 oligopeptide ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28408"
FT                   /db_xref="GOA:E6TSJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28408.1"
FT                   /translation="MWKLVVRRIMIMIPQIFVLSILVFLMAKAMPGDALTGLIDPSIDA
FT                   EAREAMRERLGLNNPWYVQYWDWITNAMQGNFGQSFRYKMDVSELIGQRMVNTFWLSLM
FT                   TLIFTYLIAIPLGITSGRYNDTWGDRLITGYTYVGFAAPLFIFALLMVFIFGFQLGWFP
FT                   TSGSVTPGLQPGTFEYVLSKINHLLLPSLSMALITTVSTVQYLRSEIIDTKQKEFIITA
FT                   RAKGASEQRVYNRHILRNSLLPIAAFFGFELTGLIGGTVFIENIFNYPGMGQLFLQSIQ
FT                   MRDFSVVTALVLLFGIASILGALLSDIILSLVDPRIRIK"
FT   gene            153079..153984
FT                   /locus_tag="Bcell_0119"
FT   CDS_pept        153079..153984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0119"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3637 oligopeptide ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28409"
FT                   /db_xref="GOA:E6TSJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28409.1"
FT                   /translation="MSSTNTNTSSPKVLEKSPSGLRILWREIVRDKLALFSLIFLILLI
FT                   TSVFTVSLILDQDQIVTVDLFSLYQPPSADFWLGTDYGGRDIFGQLIIGTRNSLLIGLI
FT                   VTAMTGIIGILVGLMAGYFGGTIDNILMRILDFFLILPTLMVVIAFVTTVPNYNIVHFS
FT                   LIMTAFLWMGIARLIRSKALQEKEQEYVAASKTLGSSDFKIMFTQVLPNLSSLIIVTMT
FT                   LNLAANIGLESGLSFLGFGFPESTPSLGTLVSYATNPQTLEFRWWIWLPASIMILVLML
FT                   SINNVGQALKRATDARQRRG"
FT   gene            154004..155806
FT                   /locus_tag="Bcell_0120"
FT   CDS_pept        154004..155806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0120"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH3636 oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28410"
FT                   /db_xref="GOA:E6TSJ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ5"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU28410.1"
FT                   /translation="MKSTMKYLFALMLVLMLALAACGSPDETEEGGSDADENAAEDNGD
FT                   ELYSIDDFSNIKTNEGEAIEGGTVTFGLVSDTAFEGTLNWNFYSGNPDAQVLNWFDEPL
FT                   LTWDENYVYTQDGAATYEVSEDGHTFTFTIRDNVNWHDGEPVTAEDWLFAHEVIAHPDY
FT                   DGPRYGSDIRNVEGIEEFRAGEADTISGIEVIDEKTLAITYKEVSPSLVTGSIWTYPLA
FT                   KHIFEDIPVEDMSSSPEVRQNPIGFGPFIVDTITPGESVTYVKNEDYWRGEPNLDGVTL
FT                   RVINPNTVVQELQTGAVDMVSSFPVDQFPANADMSNVEFLGDIDRAYTYIGFKLGHWDE
FT                   EAGENVVDPDMKMGDVNLRRAMAHAIDDTTVGERFYHGLRWNGTTLIPPSHPEFHDDAN
FT                   EGLVFDVELANQILDEAGYEDVTGDGFRETPEGEELVINFASMTGGDTAEPLAQYYVQS
FT                   WREIGLNVDLEMLEFNTFYDRVEEDHPDIDVYQGAWGVGIDVDPTGLWGPVSPMNYTRW
FT                   TNEENTRLLREGVSSEAFDLDYRAEVYNEWQQLMVEEVPAFPTVYRAVLSPVNNRVHNY
FT                   AIGDGTGVYRYQIAVTQEDRLAAE"
FT   sig_peptide     154004..154075
FT                   /locus_tag="Bcell_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.767 at
FT                   residue 24"
FT   gene            156487..156795
FT                   /locus_tag="Bcell_0121"
FT   CDS_pept        156487..156795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0121"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: bpu:BPUM_0101 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28411"
FT                   /db_xref="GOA:E6TSJ6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ6"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADU28411.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVAGPIPLPTE
FT                   KSIYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            156833..157468
FT                   /locus_tag="Bcell_0122"
FT   CDS_pept        156833..157468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0122"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: 50S ribosomal protein L3; TIGRFAM: 50S
FT                   ribosomal protein L3; PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28412"
FT                   /db_xref="GOA:E6TSJ7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSJ7"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADU28412.1"
FT                   /translation="MAKGILGKKIGMTQIFAENGEVVPVTVIEATPNVVLQKKTTEGEG
FT                   YEAIQLGFDDKKQIQQTKPAKGHAEKAKTNPKRFVKEFRLSNVAEYEIGQEVKVDTFAV
FT                   GDIVDVTGTSKGKGFQGAIKRHNQSRGPMSHGSRYHRRPGSMGPVDPNHVRKGKLLPGR
FT                   MGGEQVTIQNLEIVRVDTERNLLLVKGNVPGARKSYVTVQSAVKATAE"
FT   gene            157495..158118
FT                   /locus_tag="Bcell_0123"
FT   CDS_pept        157495..158118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0123"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: ribosomal
FT                   protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28413"
FT                   /db_xref="GOA:E6TT73"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT73"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADU28413.1"
FT                   /translation="MPKVTLYNQTGSQVGDIELSEAIFGIEPNESVLFDAVVMQQASQR
FT                   QGTHATKGRSDVRGGGRKPWRQKGTGRARQGSIRSPQWVGGGVVFGPQPRSYAYKIPKK
FT                   QRRLALKSALSSKVNADEILVLEGLNFDSPKTKEMKAVLSGLSVGRKALVVTADYNDAV
FT                   ALSARNIPGVKFITAEGVNVLDLLNYDQLIITQDAVKKVEEVLA"
FT   gene            158118..158408
FT                   /locus_tag="Bcell_0124"
FT   CDS_pept        158118..158408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0124"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG:
FT                   bpf:BpOF4_08560 50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28414"
FT                   /db_xref="GOA:E6TT74"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT74"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADU28414.1"
FT                   /translation="MADARDIIKRPVITERSTDLMAEQKYTFEVEPTANKTQIKMAIEE
FT                   IFGVKVANVNTMNYKGKFKRFGRHTGYTSKRKKAIVQLTPDSKELEFFEGV"
FT   gene            158437..159267
FT                   /locus_tag="Bcell_0125"
FT   CDS_pept        158437..159267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0125"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: ribosomal protein L2; TIGRFAM: ribosomal
FT                   protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28415"
FT                   /db_xref="GOA:E6TT75"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT75"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADU28415.1"
FT                   /translation="MPIKKYKPTTNGRRGMSVLDFQEITTDKPEKSLLAPTKRKGGRNN
FT                   QGKLTVRHQGGGHKRQYRIVDFKRDKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKNLKVGMEIMSGKDADIKVGNALQLKDIPVGTVIHNIELRPGKGGQLVRSAGAEAQ
FT                   LLGKEGDYVLVRLRSGETRLILATCRASIGQVGNVEHELVNIGKAGRSRWMGKRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKNKDTDKYIVRRRKK"
FT   gene            159331..159603
FT                   /locus_tag="Bcell_0126"
FT   CDS_pept        159331..159603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0126"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: bpf:BpOF4_08570 30S ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28416"
FT                   /db_xref="GOA:E6TT76"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT76"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADU28416.1"
FT                   /translation="MGRSLKKGPFVDDHLMKKVEAMGEDRRVIKTWSRRSTIFPEFIGH
FT                   TIAVYDGRKHVPVYISEDMVGHKLGEFAPSRTYKGHAADDKKTRR"
FT   gene            159625..159966
FT                   /locus_tag="Bcell_0127"
FT   CDS_pept        159625..159966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0127"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: ribosomal protein L22; TIGRFAM: ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28417"
FT                   /db_xref="GOA:E6TT77"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT77"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADU28417.1"
FT                   /translation="MEAKAVVKQVRIAPRKVRLVVDLIRGKGVGEAISILRHTPKKASP
FT                   VVEKLLNSAIANAEHNYELDPNSLVVSKVFVDEGVTLKRFRPRAMGRASRINKRTSHIT
FT                   LVLTEKKEG"
FT   gene            159969..160628
FT                   /locus_tag="Bcell_0128"
FT   CDS_pept        159969..160628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0128"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: ribosomal protein S3; SMART:
FT                   KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28418"
FT                   /db_xref="GOA:E6TT78"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT78"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADU28418.1"
FT                   /translation="MGQKVNPTGLRVGIIKDWESKWYADKDYADLLHEDIKIREYLEKR
FT                   LKEASLSTVEIERAANRVNVTIYTAKPGMVIGKGGSEVEALRKALNQLTGKRVHININE
FT                   VKYPDMDARLVADNVARQLENRISFRRAMKQVIQRTMRSGAKGIKTEVSGRLGGADIAR
FT                   SESYSEGTVPLHTLRADIDYGTAEADTTYGKLGVKVWIYRGEVLPTKGTKQEEGGK"
FT   gene            160631..161065
FT                   /locus_tag="Bcell_0129"
FT   CDS_pept        160631..161065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0129"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: ribosomal protein L16; TIGRFAM: ribosomal
FT                   protein L16; PFAM: Ribosomal protein L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28419"
FT                   /db_xref="GOA:E6TT79"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT79"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADU28419.1"
FT                   /translation="MLMPKRVKFRREHRGKMKGRAKGGTEVSFGEYGLQALEASWITNR
FT                   QIESARIAMTRYMKRGGKVWIKIFPDKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLASHKLPIKTKFVKREEVGGDANES"
FT   gene            161055..161258
FT                   /locus_tag="Bcell_0130"
FT   CDS_pept        161055..161258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0130"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: ribosomal protein L29; TIGRFAM: ribosomal
FT                   protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28420"
FT                   /db_xref="GOA:E6TT80"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT80"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADU28420.1"
FT                   /translation="MKANEIRNLTTAEIEQKSKSLKEELFNLRFQLATGQLDNPARIRE
FT                   VKKAIARAKTVLRERELGIINE"
FT   gene            161280..161543
FT                   /locus_tag="Bcell_0131"
FT   CDS_pept        161280..161543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0131"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: 30S ribosomal protein S17; TIGRFAM: 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28421"
FT                   /db_xref="GOA:E6TT81"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT81"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADU28421.1"
FT                   /translation="MTERNNRKSYTGRVVSDKMDKTITVLVETYKMHSLYGKRVKYSKK
FT                   LKAHDENNTAKQGDIVRVMETRPLSKDKRFRLVEVVEKAVII"
FT   gene            161587..161955
FT                   /locus_tag="Bcell_0132"
FT   CDS_pept        161587..161955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0132"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: bpf:BpOF4_08600 50S ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28422"
FT                   /db_xref="GOA:E6TT82"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT82"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADU28422.1"
FT                   /translation="MIQQESRLKVADNSGAREVLCIKVLGGTGRKTANVGDVIVCTVKQ
FT                   ATPGGVVKKGEVVRAVIVRSKSGVRRPDGSYIKFDENAAVIVRDDKSPRGTRIFGPVAR
FT                   ELRDNQFMKIVSLAPEVL"
FT   gene            161999..162325
FT                   /locus_tag="Bcell_0133"
FT   CDS_pept        161999..162325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0133"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: ribosomal protein L24; SMART: KOW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28423"
FT                   /db_xref="GOA:E6TT83"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT83"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADU28423.1"
FT                   /translation="MSQTKLHVKKGDTVKVISGKDKGKEGTILEAYPSQSRVLVEGVNV
FT                   VKKHAKPSQTNPQGGIISKEAPIHVSNVMPLDPKTSEPTRVGYKVENGKKVRIAKKSGE
FT                   ALDK"
FT   gene            162355..162894
FT                   /locus_tag="Bcell_0134"
FT   CDS_pept        162355..162894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0134"
FT                   /product="50S ribosomal protein L5"
FT                   /note="KEGG: bpf:BpOF4_08610 50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28424"
FT                   /db_xref="GOA:E6TT84"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT84"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_08610"
FT                   /protein_id="ADU28424.1"
FT                   /translation="MNRLQERYRSDIIPTMTEKFNYSSVMEVPKVEKIVINMGVGDAVQ
FT                   NSKVLDKAVEELTDISGQKPLITKAKKSIAGFKLREGMPIGAKVTLRGERMYQFLDKLV
FT                   TVSLPRVRDFRGVSKKAFDGRGNYTLGVKEQLIFPEIEYDKVDKVRGMDIVIVTTANTD
FT                   EEARELLTQMGMPFQK"
FT   gene            162923..163108
FT                   /locus_tag="Bcell_0135"
FT   CDS_pept        162923..163108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0135"
FT                   /product="ribosomal protein S14"
FT                   /note="KEGG: oih:OB0132 30S ribosomal protein S14; manually
FT                   curated; PFAM: ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28425"
FT                   /db_xref="GOA:E6TT85"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT85"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADU28425.1"
FT                   /translation="MAKKSMIAKNKRPKKFQVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            163136..163534
FT                   /locus_tag="Bcell_0136"
FT   CDS_pept        163136..163534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0136"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bpf:BpOF4_08620
FT                   30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28426"
FT                   /db_xref="GOA:E6TT86"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT86"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADU28426.1"
FT                   /translation="MVMTDPIADMLTRIRNANTVRHNSLELPASKIKREVADILKREGF
FT                   IRDYEYIEDNKQGILRIFLKYSGTNERVITGLKRISKPGLRVYAKADQLPRVLGGLGIA
FT                   IISSSNGVITDKEARQQQVGGEVLAYVW"
FT   gene            163565..164101
FT                   /locus_tag="Bcell_0137"
FT   CDS_pept        163565..164101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0137"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: ribosomal protein L6; TIGRFAM: ribosomal
FT                   protein L6; PFAM: Ribosomal protein L6, alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28427"
FT                   /db_xref="GOA:E6TT87"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT87"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADU28427.1"
FT                   /translation="MSRIGLKPVEIPSGVEVKLNGNNITVKGPKGELNRDLHQDMVIKH
FT                   EDNQVIVERPSDHKSHRSLHGTTRSVINNMVEGVTKGYEKTLELVGVGYRATKSGNKLV
FT                   LNVGLSHQVEFEPENGLEIEVPANTKIIVKGIDKERVGALASNIRATRKPEPYKGKGIR
FT                   YEGEYVRRKEGKTGK"
FT   gene            164135..164497
FT                   /locus_tag="Bcell_0138"
FT   CDS_pept        164135..164497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0138"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: ribosomal protein L18; TIGRFAM: ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28428"
FT                   /db_xref="GOA:E6TT88"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT88"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADU28428.1"
FT                   /translation="MITKTNKNAVRKKRHAHVRRTVTGTAERPRLNVFRSNKQIYAQLI
FT                   DDVAGVTIASASSLDKELKLENGGNKEAARQVGDLVAKRALEKGHESVVFDRGGYLYHG
FT                   RVQELADAAREAGLKF"
FT   gene            164526..165023
FT                   /locus_tag="Bcell_0139"
FT   CDS_pept        164526..165023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0139"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: ribosomal protein S5; TIGRFAM: ribosomal
FT                   protein S5; PFAM: Ribosomal protein S5 ; ribosomal protein
FT                   S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28429"
FT                   /db_xref="GOA:E6TT89"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT89"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADU28429.1"
FT                   /translation="MRIDPNKLELEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHV
FT                   GFGMGKALEVPEAIRKAIEDAKKNLIAVPIQGTTIPHQITGRFGAGSVFLKPASEGTGV
FT                   IAGGPVRAVLELAGVGDILSKSLGSNNPINMVRATIEGLRDVKSPEDVAKLRGKTVEEL
FT                   LG"
FT   gene            165037..165225
FT                   /locus_tag="Bcell_0140"
FT   CDS_pept        165037..165225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0140"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: bpu:BPUM_0120 50S ribosomal protein L30;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28430"
FT                   /db_xref="GOA:E6TT90"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT90"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADU28430.1"
FT                   /translation="MANKLEITLKRSLIGRPEDQRVTVKTLGLRKVNHTVVQEDNPAIR
FT                   GMITKVSHLVSVKEVQA"
FT   gene            165255..165695
FT                   /locus_tag="Bcell_0141"
FT   CDS_pept        165255..165695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0141"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; KEGG: bha:BH0153 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28431"
FT                   /db_xref="GOA:E6TT91"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT91"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADU28431.1"
FT                   /translation="MKLHELKPAEGSRKTRNRVGRGIGSGNGKTAGRGHKGQNSRSGGG
FT                   VRPGFEGGQMPIFRRLPKRGFTNPTRKEYAIVNLETLNRFEDGAEVSPELLIESGIVSN
FT                   EKDGIKILGEGKLERKLTVKAHKFSASAKEAIEAAGGSTEVV"
FT   gene            165695..166990
FT                   /locus_tag="Bcell_0142"
FT   CDS_pept        165695..166990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0142"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: bpf:BpOF4_08650 preprotein translocase subunit
FT                   SecY; TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28432"
FT                   /db_xref="GOA:E6TT92"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT92"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADU28432.1"
FT                   /translation="MFQTISNMMRVGDIRNKILFTLAMLIVFRIGAHIPAPGVDAARLD
FT                   FAGEMNAFGFLNTFGGGALERFSIFATGIMPYITASIIVQLLRMDVVPKFAEWAKQGEA
FT                   GRKKLAQVTRYGTIVIAFLQALAMSIGFNNIFQGLVPNPTLPTYLMIALTLTAGTAFLM
FT                   WLGEQITAKGVGNGISIIIFGGIAAGIPNGINQIYATHIQDAGDALFINIVIIMLLLLA
FT                   VLAITVGVIFVQQALRKIPVQYAKRLVAGKPQGGQSTHLPLKVNSAGVIPVIFAMALFI
FT                   FPPTIASFIGGDNEIAGWVTQNFDYTRPFGLAIYAALIIGFTYFYTFIQVNPEQMADNL
FT                   KKQGGYIPGIRPGKTTQEYITRILYRLTFVGALFLAAVSVIPVFFTALAGLPPAVQIGG
FT                   TGLLIVVGVALDTMKQIESQLIQRSYKGFMKK"
FT   gene            167053..167706
FT                   /locus_tag="Bcell_0143"
FT   CDS_pept        167053..167706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0143"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: adenylate kinase; TIGRFAM: adenylate kinase;
FT                   PFAM: adenylate kinase; adenylate kinase lid
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28433"
FT                   /db_xref="GOA:E6TT93"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT93"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADU28433.1"
FT                   /translation="MNLILMGLPGAGKGTQAEKIVAKYGIPHISTGDMFRAAIKNGTEL
FT                   GLKAKAFMDEGNLVPDEVTVGIVRERLSKDDCKDGFLLDGFPRTVAQASALDDMLKDLG
FT                   KQIDHVLYIEVPKEDLFKRLTGRWICSTCGATYHELYNPPKVAGKCDKDGSDLIQREDD
FT                   KAETVGKRLEVNLQQAQPLVDFYGEKGSLRSLDGNKEIDEVFNDIDEILKGSNQ"
FT   gene            167703..168455
FT                   /locus_tag="Bcell_0144"
FT   CDS_pept        167703..168455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0144"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: methionine aminopeptidase, type I; TIGRFAM:
FT                   methionine aminopeptidase, type I; PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28434"
FT                   /db_xref="GOA:E6TT94"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT94"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADU28434.1"
FT                   /translation="MIICKTPRELDIMRVAGNIVALTHKELQKFIKPGITTKELDNIAD
FT                   KFIRQHDAIPSFKGYNGFTGSICASVNDELVHGIPGERVLHDGDIISIDIGANYKGYHG
FT                   DSAWTYPVGTISESNQKLLDVTEESLYRGLAEAKPGERLTNISHAIQSYVEDHGFSVVR
FT                   EYVGHGVGQDLHEEPQIPHFGPPGKGPRLKPGMVLAVEPMINAGSRHVRVLKDNWTVVT
FT                   TDGKMCAHFEHTIAIVDTGYEILTKTVE"
FT   gene            168470..168772
FT                   /locus_tag="Bcell_0145"
FT   CDS_pept        168470..168772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28435"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT95"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0137"
FT                   /protein_id="ADU28435.1"
FT                   /translation="MKDPDSVPQVGELVRILSGRDKDQFACIIEVLDNRFVLIADGDKR
FT                   KVDKAKRKNLQHIELLGTIAPEVKNSIVETGRVTNAKLRFAISTYIDDNLLKEGE"
FT   gene            168777..168995
FT                   /locus_tag="Bcell_0146"
FT   CDS_pept        168777..168995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0146"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: bpf:BpOF4_08670 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28436"
FT                   /db_xref="GOA:E6TT96"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT96"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADU28436.1"
FT                   /translation="MAKEDVIEVEGTVIEPLPNAMFRVELENGHKILAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            169041..169154
FT                   /locus_tag="Bcell_0147"
FT   CDS_pept        169041..169154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0147"
FT                   /product="ribosomal protein L36"
FT                   /note="manually curated; TIGRFAM: ribosomal protein L36;
FT                   KEGG: ribosomal protein L36; PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28437"
FT                   /db_xref="GOA:E6TT97"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT97"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADU28437.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG"
FT   gene            169174..169539
FT                   /locus_tag="Bcell_0148"
FT   CDS_pept        169174..169539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0148"
FT                   /product="30S ribosomal protein S13"
FT                   /note="KEGG: bpu:BPUM_0128 30S ribosomal protein S13;
FT                   TIGRFAM: 30S ribosomal protein S13; PFAM: ribosomal protein
FT                   S13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28438"
FT                   /db_xref="GOA:E6TT98"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT98"
FT                   /inference="protein motif:TFAM:TIGR03631"
FT                   /protein_id="ADU28438.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVYGIGTSSAKAILSEAGVSEETRV
FT                   RDLTEDELGKIREVLDKYKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQKTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            169558..169950
FT                   /locus_tag="Bcell_0149"
FT   CDS_pept        169558..169950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0149"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: 30S ribosomal protein S11; TIGRFAM: 30S
FT                   ribosomal protein S11; PFAM: ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28439"
FT                   /db_xref="GOA:E6TT99"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E6TT99"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADU28439.1"
FT                   /translation="MAKPKTTRSKRRQRKNIESGVAHIRSTFNNTIVTITDTSGNAISW
FT                   ASAGALGFKGSRKSTPFAAQTAAETAAKAAMEHGMKVVEVSVKGPGAGREAAIRSLQAT
FT                   GLEVNMIKDVTPVPHNGCRPPKRRRV"
FT   gene            170113..171057
FT                   /locus_tag="Bcell_0150"
FT   CDS_pept        170113..171057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0150"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase dimerisation;
FT                   RNA polymerase alpha subunit domain protein; KEGG:
FT                   DNA-directed RNA polymerase, alpha subunit; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28440"
FT                   /db_xref="GOA:E6TTA0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA0"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADU28440.1"
FT                   /translation="MIEIEKPKIEAVEVSEDGSYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGSAVTSVQFDGVLHEFSTIEGVVEDITSIILNLKKLALKIYSDEEKTLEIEATGE
FT                   GVVTAADFMHDSDVEVLNPDLHIATLSKGAQFHMKVAANRGRGYVPAEGNKSEELPIGV
FT                   IPVDSIYTPVARVNYQVENTRVGQITNYDKLTLDVWTDGSTRPEEAVSLGAKILTEHLN
FT                   IFVGLTDQAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTHKS
FT                   EEDMMKVRNLGRKSLEEVQEKLAELGLGLRKEE"
FT   gene            171127..171489
FT                   /locus_tag="Bcell_0151"
FT   CDS_pept        171127..171489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0151"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: ribosomal protein L17; TIGRFAM: ribosomal
FT                   protein L17; PFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28441"
FT                   /db_xref="GOA:E6TTA1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA1"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADU28441.1"
FT                   /translation="MGYRKLGRDSSARKALFRDLATDLIINERIETTVPKAKELRSVVE
FT                   QMITLGKRGDLHARRQVAAFVRNEVADTETGQDAIQKLFDDIAPRYEERQGGYTRVLKL
FT                   GPRRGDGAEMAIIELV"
FT   gene            171723..172562
FT                   /locus_tag="Bcell_0152"
FT   CDS_pept        171723..172562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0152"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28442"
FT                   /db_xref="GOA:E6TTA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28442.1"
FT                   /translation="MSELLDIDHVCLRYNTEHDLALRNITLRIFEGENIAIVGHNGSGK
FT                   STLAKVICGVLQPTSGKMDVNGLNICDENYRSQISRYVSIVFQNPDNQIVAPTVEDDVA
FT                   FSLENIGTPREEMIKRVQESISKLGLSGLEKTDPHHLSGGQKQRVALAGALAMRPKILV
FT                   LDEATSMLDPKGRAEVQYYLNKINVEDRVTIISITHDLSVAMKADRIIVMKEGAIVADE
FT                   KPSMILTNDHILKETSLKKPFMYEIIGELQARGVNFPETIHSEEELVSQLCKLKQRH"
FT   gene            172538..173413
FT                   /locus_tag="Bcell_0153"
FT   CDS_pept        172538..173413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0153"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bcq:BCQ_0153 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28443"
FT                   /db_xref="GOA:E6TTA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28443.1"
FT                   /translation="MQIKTEALNYTYKKNTPFEKKAIRDINVTIPANSFNVMIGKTGSG
FT                   KSTLLQLLNGMLVPTSGNVVIGEYTINSKIKKKSLHPIRKVVGTVFQNPENQLFSDTVL
FT                   QDVMYGPLNFGFTKRQSEAQAREAMELVGIAESLFSRSPFQLSGGQMRRVAIAGVLACQ
FT                   PKVLFLDEPTAGLDPQGHDDIMTLFQKWYKEREDRSIILITHEMEDAAKYGDNIYILHE
FT                   GEIVLEGHRTEIFQQVELLDKLGLDIPVASRLLSKLKEASGENIAVAQYDVQGVVKELL
FT                   SFIGRNKKDV"
FT   gene            173406..174206
FT                   /locus_tag="Bcell_0154"
FT   CDS_pept        173406..174206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0154"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: cobalt
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28444"
FT                   /db_xref="GOA:E6TTA4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA4"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADU28444.1"
FT                   /translation="MFDHVIIGQYVSSNSFIHRLDARAKLLCLIVFIAILFVYRHPFVM
FT                   ASASILLVIAFILARIPIIYYLKGLRFVVLMITFTFLFHALFQGGDILLLETPIANVYL
FT                   EGLIEGGYFALRLLMIFIFASLLSLTTTPVELTDGLEKLLSPLKKLKLPIHELAFMMGI
FT                   SMRFIPILSDEAEKIIKAQTARGAHFSSGSLWKRLTAFIPIFIPLFVRALNRAEEVAIA
FT                   MEARGYTGGEGRTKLRDMRWRQMDTASLSIFCCFLIVAIILRFS"
FT   gene            174225..175007
FT                   /locus_tag="Bcell_0155"
FT   CDS_pept        174225..175007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0155"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="KEGG: tRNA pseudouridine synthase A; TIGRFAM: tRNA
FT                   pseudouridine synthase A; PFAM: Pseudouridine synthase I,
FT                   TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28445"
FT                   /db_xref="GOA:E6TTA5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA5"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADU28445.1"
FT                   /translation="MKRVKGIVTYDGTKYSGYQVQVDKKTIQAELEKALAKIHKADSWN
FT                   VVSSGRTDTGVHSLGQTIHFDTSLSIPEERWPQAFNRLLPDDIQVRDLQYVHHDFHARF
FT                   DSVGKKYVYKVNTAREKDIFKRNFVYHHPYVLSYEKMLEAAMHLEGTHDFTSFSSPRTD
FT                   VIDKVRTIYAIELEKNGDEWTFTYIGNGFLYQMVRVLTGTLLHVGKGKIRPEEIPEIFE
FT                   GKDRSLAGPSIPGTGLYLTNVYYDQEALEVAVKNLKHS"
FT   gene            175204..175641
FT                   /locus_tag="Bcell_0156"
FT   CDS_pept        175204..175641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0156"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: bha:BH0168 50S ribosomal protein L13; TIGRFAM:
FT                   ribosomal protein L13; PFAM: ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28446"
FT                   /db_xref="GOA:E6TTA6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA6"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADU28446.1"
FT                   /translation="MRTTYMAKPSEVNRKWYVVDAEGQTLGRLASEVASILRGKHKPTF
FT                   TPHIDTGDHVILINAEKIHLTGNKLADKKYYRHSQYPGSLKTTTAQEMLDKKPERVLEL
FT                   AIKGMLPKNSLGRKQGMKLHVYAGSEHPHQAQQPEVYELRG"
FT   gene            175662..176054
FT                   /locus_tag="Bcell_0157"
FT   CDS_pept        175662..176054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0157"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: ribosomal protein
FT                   S9"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28447"
FT                   /db_xref="GOA:E6TTA7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA7"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADU28447.1"
FT                   /translation="MAQVQYYGTGRRKNSVARVRLVPGDGRIVINNRDINDYFDLETLK
FT                   LIVKQPLVETQTEGTYDVLVNVKGGGYTGQAGAIRHGVARALLGADPEYRGSLKKAGFL
FT                   TRDARMKERKKYGLKAARRAPQFSKR"
FT   gene            complement(176148..176564)
FT                   /pseudo
FT                   /locus_tag="Bcell_0158"
FT   gene            177144..177929
FT                   /locus_tag="Bcell_0159"
FT   CDS_pept        177144..177929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC0828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28448"
FT                   /db_xref="GOA:E6TTA8"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA8"
FT                   /inference="similar to AA sequence:KEGG:ABC0828"
FT                   /protein_id="ADU28448.1"
FT                   /translation="MTSTQLKIIALIAMFIDHYGLFISGTPEWMGWIGRIAAPVFIYCV
FT                   VIGFQNTSNRTKYLVRLGVAAIGMSFINLFINLRLFYTDLSGPYLELNFFATLFLIAFL
FT                   IMLLENKRIKLLLLFFAWQIISFILFGLLEVFGLQPQPFAIFTAQISGNVLVVEGGPLI
FT                   ILLGVSFYFANDNRWTVTAGYSFYCLAIFYSVRRWGWRLEGLYQHLFGFADYQWMMIFA
FT                   LPLFLLYNGKKGIGLKYLFYIFYPLHIVILWYIGTHILS"
FT   gene            178234..178671
FT                   /locus_tag="Bcell_0160"
FT   CDS_pept        178234..178671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0160"
FT                   /product="Protein of unknown function DUF2521"
FT                   /note="PFAM: Protein of unknown function DUF2521; KEGG:
FT                   bha:BH0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28449"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTA9"
FT                   /inference="protein motif:PFAM:PF10730"
FT                   /protein_id="ADU28449.1"
FT                   /translation="MNVVTDLGERRRRKQWKFERSMLRALSIEDMRKDVQEQFFDQLVG
FT                   QSVGKLYLVDYCLDIGIDAYLLGSEFGRFGYYGETAEQAQHRCIEEINAYIEQTTGQFK
FT                   SWFTLDEVETTIQHEKSRAFILRWWNKGFAEGEKKYRLRLH"
FT   gene            178742..179461
FT                   /locus_tag="Bcell_0161"
FT   CDS_pept        178742..179461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0161"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: bha:BH0239
FT                   germination specific N-acetylmuramoyl-L-alanine amidase;
FT                   SMART: cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28450"
FT                   /db_xref="GOA:E6TTB0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB0"
FT                   /inference="protein motif:TFAM:TIGR02883"
FT                   /protein_id="ADU28450.1"
FT                   /translation="MRRSKLIKIVAIALALGLLIVVIQIQLSSKNSTGWHLPLSGQVIV
FT                   IDPGHGGIDGGASSKAGDLEKDITLQISFKLRDYLQESGALVLMTREGDHDLASDSTSR
FT                   VRSRKAEDLRKRVSLINDSNADLFVSIHLNSIPSPKWRGAQTFYNRAVEGNEELSKHIQ
FT                   GELRRNLENTTREAKPINSVYILQQANVTGSLVEVGFLSNPSEAELLSTKDYQQKVAAS
FT                   IYEGILRHASGDPLPSS"
FT   sig_peptide     178742..178831
FT                   /locus_tag="Bcell_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.418 at
FT                   residue 30"
FT   gene            179647..180696
FT                   /locus_tag="Bcell_0162"
FT   CDS_pept        179647..180696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0162"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: ATPase-like, ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28451"
FT                   /db_xref="GOA:E6TTB1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB1"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADU28451.1"
FT                   /translation="MLTEEQVLQALKDVQEPFLKKSLVELNAIKEIKIKKGMVSLKLAL
FT                   SQTGTGEQMQLQQQVVSAVKGAGAESVGLRFEKMADEEIGEHGGQAGEEKKSLLDRTDK
FT                   TTFIAVTSGKGGVGKSTVSVNLATSLARKGKKVGIIDADIYGFSVPDMMGIEERPKVVN
FT                   QRIYPVQRFDVQVISMGFFVEDNSPIIWRGPMLGKMLNNFFSEVEWDDLDYLILDLPPG
FT                   TGDVALDVHSMLPSSKEIIVTTPHATAAFVAARAGAMAIKTEHEILGVVENMAYFESKV
FT                   TGEKEYVFGKGGGEKLAKELNSEVLAQIPLGQPDIDEDNFAPSVYAEEHPIGKIYLNMA
FT                   QQIIDKIEQ"
FT   gene            complement(180753..181439)
FT                   /locus_tag="Bcell_0163"
FT   CDS_pept        complement(180753..181439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0163"
FT                   /product="spore germination protein GerD"
FT                   /note="KEGG: bpf:BpOF4_08770 spore germination protein
FT                   GerD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28452"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB2"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_08770"
FT                   /protein_id="ADU28452.1"
FT                   /translation="MWYYHNKYKRVPQWHRYFEKVINNISLKKAVVYIPLLFILLLNGC
FT                   AAMEDNSSQQPDYESTKKMMVDMLKTDEGKQAIQDVLQDEEVRQNLVMEEDYVKQTIQT
FT                   TLTSDEGKEYWQRVMQDPEFAKSFAESIQSQNEKMMKSLMKDPEYQGMMMDVLKDPEME
FT                   EKYLELMQSKEYRQQVMTVMQDAFESPYFVAKLNDIFSNVAEEQMNKQDQEQQEEGQDS
FT                   GESEEE"
FT   gene            181619..182236
FT                   /locus_tag="Bcell_0164"
FT   CDS_pept        181619..182236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28453"
FT                   /db_xref="GOA:E6TTB3"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB3"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0369"
FT                   /protein_id="ADU28453.1"
FT                   /translation="MNTRKVVYLFYTTLLLGTFSGALVGFLLDWRTHINDLANLQFGGI
FT                   IMVIITASIWAVIAQMGFFAYLTIHRFGLGIFKSVQLWNRVQVIIIAFVLFDLVIFRYW
FT                   AFAEGEGIWGYLIMPGLLLGYGLIVASIKSKETNRLAFIPALFFIVVVTTIEWIPALQQ
FT                   NDFTFLTTSIVPLLVANTWQLLVLHRLQEPASKSDGKNNKTK"
FT   gene            complement(182377..183135)
FT                   /locus_tag="Bcell_0165"
FT   CDS_pept        complement(182377..183135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0165"
FT                   /product="polysaccharide deacetylase family sporulation
FT                   protein PdaB"
FT                   /note="KEGG: bpf:BpOF4_08780 hypothetical protein; TIGRFAM:
FT                   polysaccharide deacetylase family sporulation protein PdaB;
FT                   PFAM: polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28454"
FT                   /db_xref="GOA:E6TTB4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB4"
FT                   /inference="protein motif:TFAM:TIGR02764"
FT                   /protein_id="ADU28454.1"
FT                   /translation="MNFIWVWNAKTLKRYAIIAVAALFTAGILFVERSQIPVFSTDDQP
FT                   VAIYKVDAEEKEVALTFNVSWGEERALPILDTLKEHDVTSTFFVSADWAERHPEIVERI
FT                   VEDGHELGSHGYVHEHYTKKDDEQIKKDIQTAHRIIQEVSQEVPNLLRPPNGSFDERVL
FT                   SIAENQNYDVIHWSVDSNDWQNPGVDTIVENVTRNISNGDIVLMHASDSAKQTNEALAE
FT                   IISYIESEGYHFNTVSELVSGAEVVTKEVQ"
FT   gene            183261..183503
FT                   /locus_tag="Bcell_0166"
FT   CDS_pept        183261..183503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_02620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28455"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB5"
FT                   /inference="similar to AA sequence:KEGG:BBR47_02620"
FT                   /protein_id="ADU28455.1"
FT                   /translation="MLGMMLTGKESQEIEYLLKRELEELLLDFSDSRIDGVVKRAMEER
FT                   YQMIFQLYKRFTTKQEYLKYVRNRQYTEYKTSQSD"
FT   gene            183737..183812
FT                   /locus_tag="Bcell_R0025"
FT                   /note="tRNA-Asn1"
FT   tRNA            183737..183812
FT                   /locus_tag="Bcell_R0025"
FT                   /product="tRNA-Asn"
FT   gene            183899..183974
FT                   /locus_tag="Bcell_R0026"
FT                   /note="tRNA-Asn2"
FT   tRNA            183899..183974
FT                   /locus_tag="Bcell_R0026"
FT                   /product="tRNA-Asn"
FT   gene            184072..184147
FT                   /locus_tag="Bcell_R0027"
FT                   /note="tRNA-Asn3"
FT   tRNA            184072..184147
FT                   /locus_tag="Bcell_R0027"
FT                   /product="tRNA-Asn"
FT   gene            184149..184224
FT                   /locus_tag="Bcell_R0028"
FT                   /note="tRNA-Thr2"
FT   tRNA            184149..184224
FT                   /locus_tag="Bcell_R0028"
FT                   /product="tRNA-Thr"
FT   gene            184230..184304
FT                   /locus_tag="Bcell_R0029"
FT                   /note="tRNA-Glu1"
FT   tRNA            184230..184304
FT                   /locus_tag="Bcell_R0029"
FT                   /product="tRNA-Glu"
FT   gene            184372..184446
FT                   /locus_tag="Bcell_R0030"
FT                   /note="tRNA-Gln1"
FT   tRNA            184372..184446
FT                   /locus_tag="Bcell_R0030"
FT                   /product="tRNA-Gln"
FT   gene            185168..185243
FT                   /locus_tag="Bcell_R0031"
FT                   /note="tRNA-Lys2"
FT   tRNA            185168..185243
FT                   /locus_tag="Bcell_R0031"
FT                   /product="tRNA-Lys"
FT   gene            185473..185548
FT                   /locus_tag="Bcell_R0032"
FT                   /note="tRNA-Ala3"
FT   tRNA            185473..185548
FT                   /locus_tag="Bcell_R0032"
FT                   /product="tRNA-Ala"
FT   gene            complement(185832..186008)
FT                   /locus_tag="Bcell_0167"
FT   CDS_pept        complement(185832..186008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0167"
FT                   /product="Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase"
FT                   /note="PFAM: Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase; KEGG: bpf:BpOF4_08795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28456"
FT                   /db_xref="GOA:E6TTB6"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB6"
FT                   /inference="protein motif:PFAM:PF09388"
FT                   /protein_id="ADU28456.1"
FT                   /translation="MNSTVSKKELLNQIETARDKMNKLSEKMNRTSHEVVEISTHLDDL
FT                   LIKYQYLSIREKK"
FT   gene            186205..186768
FT                   /locus_tag="Bcell_0168"
FT   CDS_pept        186205..186768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0168"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily; TIGRFAM: RNA polymerase sigma-W factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28457"
FT                   /db_xref="GOA:E6TTB7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB7"
FT                   /inference="protein motif:TFAM:TIGR02948"
FT                   /protein_id="ADU28457.1"
FT                   /translation="MDAVVKKIVIEVKKGNQQAFSELVELYKDKVYQIAYRMLGNVHEA
FT                   QDVAQEAFLRAYVNIESYDTNRKFSTWLFRIATNLAIDRIRKKKPDFHLEDKVAGTEDL
FT                   DYYSQFATEDKLPEEKVVQYETQDWVQKEIMALPPKYRSAIILKYIEDLSLKEISNILN
FT                   LPVATVKTRIHRGREALRKRLRET"
FT   gene            186790..187422
FT                   /locus_tag="Bcell_0169"
FT   CDS_pept        186790..187422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0169"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: putative transmembrane anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28458"
FT                   /db_xref="GOA:E6TTB8"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB8"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0371"
FT                   /protein_id="ADU28458.1"
FT                   /translation="MACKKDYAEQIHHYLDEELTLLERKRFESHIQKCSACHAHVRELR
FT                   KTEAIVQSASHIKAPANFTDNVMSQLPKQSQKARYKNWMRKHPYIITAATFFLVFIVSL
FT                   TSIWNDGGKEISVKGDGHFIVDEERGVVIIPEGETISGDITVRNGNIEINGEVLGNITV
FT                   INGEQYLASAGSVAGEIQEINQVLEWMWFHTKSFFSEVLNVMNGDKQ"
FT   gene            187566..188396
FT                   /locus_tag="Bcell_0170"
FT   CDS_pept        187566..188396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0170"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28459"
FT                   /db_xref="GOA:E6TTB9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTB9"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADU28459.1"
FT                   /translation="MLGSIFENISLLDLLVVVIDILLVAYVIYKLINVIRGTRAVQLLK
FT                   GITVILVVWFLSRQFGFITLEWIMQQAVVYGLLAIIIIFQPELRRALEQIGRGRFFSKG
FT                   STAEEEDVKKNIEHIVKAANYMGKRRIGALISIEKETGMNDYVETGITMNAHLTSELLI
FT                   NVFIPNTPLHDGAVIIKNNEIMAAGCYLPLSENPFISKELGTRHRAALGVSEVTDSVTL
FT                   VVSEETGGISVTKNGELHRNLDEDALRTLLENDLLNVDQTKSTSRWQWGGKKNG"
FT   gene            188389..189708
FT                   /locus_tag="Bcell_0171"
FT   CDS_pept        188389..189708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0171"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: YbbR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28460"
FT                   /db_xref="GOA:E6TTC0"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC0"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADU28460.1"
FT                   /translation="MDKWFNNSWVLKGVSLLIAMMLFLVVNMDRQPTQTGGLPGITNGQ
FT                   RVIEELDLTVYYDEDTHVVTEAPEHVQVTLRGPQNILTLLALERQSYEVFVDVRGKEPG
FT                   VHYERVQHRDFHKDLNVSINPPTVRITIQEKQTVSLPVEVDIINEGEVGEGYSIGTPTV
FT                   SPSNVDITAAQGVIEQIASVRAVVDVAGRDATFQSATSVIVLDQNGNEMNVNTDPPAVE
FT                   VTVPITAPNKEVPVRIEREGELPEGIAVESITAEPSTITVFGPVSIINDISFIDGVKVD
FT                   LSNITESTSFEVDVQAPNGVERIAPETITITIEVTQEEEREFSNFEIDVVGVPEGNNYA
FT                   FIEPEEGMLDISILGSRNVLDRVSRTDIQLYVDLNDLSDGEHDVPLQFNGPQGVRIDPN
FT                   IMNSVRLVIYDEDEEPFVEEPVQGENTSEEIEGEQEENTT"
FT   gene            189774..191135
FT                   /locus_tag="Bcell_0172"
FT   CDS_pept        189774..191135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0172"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: phosphoglucosamine mutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28461"
FT                   /db_xref="GOA:E6TTC1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC1"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADU28461.1"
FT                   /translation="MGKFFGTDGVRGVANKELTPELAFKLGRYGGYVLTKERNKPKILI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAFLTKALSADAGVMISASHNPV
FT                   EDNGIKFFGSDGFKLLDSQEEEIEKLLQTEDNLEDDLPRPVGGDIGQVNDYFEGGQKYL
FT                   QFLKQTVQEDFSGLKIALDCAHGSASPLATHLFADLEAEQICTIGSSPNGVNINDQVGS
FT                   THPEALVSLVLEKGADIGLAFDGDADRLIAVDEKGNVIDGDQIMYICAKYYKEQGRLSH
FT                   NTVVTTVMSNIGFYKALENIGVQTKQTAVGDRYVMEEMRKGGYNIGGEQSGHIIFLDYA
FT                   TTGDGLLSAIQLCSILKASGKPLSELASEMPKYPQKLVNVRVADKHALTTNEVIAAEID
FT                   IVEAEMNGEGRILVRPSGTEPLVRVMAEAPTEELCDKYVDKIVAVVQRELGTAE"
FT   gene            191623..193425
FT                   /locus_tag="Bcell_0173"
FT   CDS_pept        191623..193425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0173"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: bha:BH0268 glucosamine--fructose-6-phosphate
FT                   aminotransferase; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28462"
FT                   /db_xref="GOA:E6TTC2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC2"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADU28462.1"
FT                   /translation="MCGIVGYVGTEDAKEILLRGLEKLEYRGYDSAGLAIVNEEGVHVY
FT                   KEKGRIATLREVVDSSEDGQIGIGHTRWATHGVPSQLNAHPHQSANRRYTIVHNGVIEN
FT                   YAQLQKEYLQDVALASDTDTEIIVQLVERFANEGLNTEAAFRKTLSLLKGSYATALLDN
FT                   EDAETIYVGKNKSPLLVGLADGVNVVASDAMAMLQVTNEFVELMDKEIVVVTRESVTIK
FT                   DLDGTVTSRDSYIAELDASDIEKGTYPHYMLKEIDEQPYVIRNIISKYKTEDETIKLDE
FT                   DIRQAMLGADRIYIIAAGTSNHAGLVGKQLIERIANKPVEVHIASEFLYNMPIVSEKPL
FT                   FIFISQSGETADSRGVLVNVKEMGHKALTITNVPGSTLSREADYTLHTYAGPEIAVAST
FT                   KAYTAQMAVLAILAVDTARAAGIDMNFDPLQELAIVANAMEVLTDQKEKMEQIARDYLS
FT                   VTRNCFFIGRAADYFVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEEGTPVIGLAT
FT                   QEHVNLSIRGNMKEVVARGASPCMISMEGLNDEDDQLVIPKVHEYLTPLVTVIPLQLLS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            194040..194165
FT                   /locus_tag="Bcell_0174"
FT   CDS_pept        194040..194165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28463"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU28463.1"
FT                   /translation="MKERLLKRFGLIIISNDLHTRVVIIDAGRTLSQEVKAKALK"
FT   gene            194256..195377
FT                   /locus_tag="Bcell_0175"
FT   CDS_pept        194256..195377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lme:LEUM_A12 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28464"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC4"
FT                   /inference="similar to AA sequence:KEGG:LEUM_A12"
FT                   /protein_id="ADU28464.1"
FT                   /translation="MDYSHIYHFIASEGGVTNIEKKYILYYDETNNPRTFRLTDDGFNV
FT                   NEHEFFILGGIGFEPDKTASDDDIDELFSEFQLQGNTSEVKFKHIRHNAQDFLSLLSKP
FT                   RVTTLIEWLYEKQYPIHYSYVDNFYYTIVDIVDSMNESWFGGPDLNREVKNRLYSLIKD
FT                   NHDWFVSLLIELDYPNIKNHKMFVEKLVDWIWSVNIGDDFYLEYLRQSLKSYRDKQLVF
FT                   LEDNDDRIAITDYSTFYANLIVTYPNADHIFDHELSVEELLNANPIELSGHKGINYKFV
FT                   DSKDERLVQVSDLIVGVLRYWMAFLESVVNIQNLSEILNGLSEIQKVKMKKFQEVLLHS
FT                   LDISTGFKHGIGSNEFELKVSFFLEFDFTFQSQ"
FT   gene            195571..196092
FT                   /locus_tag="Bcell_0176"
FT   CDS_pept        195571..196092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_1551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28465"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC5"
FT                   /inference="similar to AA sequence:KEGG:Nther_1551"
FT                   /protein_id="ADU28465.1"
FT                   /translation="MDKNIFAVGQQVPDLLASRFQQDGAQFAIDLNRNFYLCISFTNPT
FT                   KKEIKKIKNDIIRFRFYEKKDVIYPLVCFGKDLSCEIPYNPVNTSLVTYEGLSNGLHIV
FT                   LADTQTKIIRAQKTIGLGTEFMYYLIHHWNKAIRNKEWEQTFFEMYQNALKSHVHKLFL
FT                   NAPISLDWDK"
FT   gene            196602..197045
FT                   /locus_tag="Bcell_0177"
FT   CDS_pept        196602..197045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dau:Daud_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28466"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC6"
FT                   /inference="similar to AA sequence:KEGG:Daud_0709"
FT                   /protein_id="ADU28466.1"
FT                   /translation="MSLKKGYSYNNKIEGGVKTLDELINYVQYRKEINEFNGICLLDRE
FT                   GNPIILSIVKGVGEDLNSHVKQTGRYFSYVNSIRIAILTNMDEMYFYSDFNKTGVMDEI
FT                   PFYKIHLDSFTEQDADFLLQFRRTYFLDHCNELYAKWKEQYSN"
FT   gene            complement(197197..197742)
FT                   /locus_tag="Bcell_0178"
FT   CDS_pept        complement(197197..197742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0178"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="KEGG: cce:Ccel_0191 Appr-1-p processing domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28467"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC7"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0191"
FT                   /protein_id="ADU28467.1"
FT                   /translation="MNNNLDPTITTELNHFIENNMIAKVIKSLYLNESSESNLAPSPSF
FT                   GNAFSNNNISAELDKRVKNVYSAQTLGEYIETLYQEKHKEDPLVLRRAGIDRAYKYKVV
FT                   NNLIKPTKSKLLCFAIAFELDLEGTEKLLQKAGYTLVEENSVFDTIVCYFIRKGYYSGA
FT                   DIDIWLEEYDQPTIFSVA"
FT   gene            198668..200032
FT                   /locus_tag="Bcell_0179"
FT   CDS_pept        198668..200032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0179"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bha:BH3985 transposase (13)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28468"
FT                   /db_xref="GOA:E6TSP7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:E6TSP7"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADU28468.1"
FT                   /translation="MSIVRQESLFSMQILFDLEPTQRYDEIFSAIDIHPILTIVVKRSN
FT                   LGRPVELNYPAMIQALVVRLVERIPEMQLLVERLNTDLKFKLDCGFLISDPVPSEASFS
FT                   RMITKIKDTDILEEVNSQIITDAINEEYITDPNIAIDSGHFEARDQAPSKKEEKPKSEP
FT                   KKRGRKSKAEHEQWLKEKEAKEASLSIFEKKIEDQLDVSYDELHDQMPLHPTWGVKKNS
FT                   EGKNVFWFGYKGHLAVDTKTQFILHSMISSGRLNDGKAAIPLLKGIERNFSELRMIYAL
FT                   MDAGYDYDAIYEQVHRMKGYSIIAYNKKNESEPIGFDENFAPTCVREHSYRYDSFDKKY
FT                   QTLKYTRPKECRDCPLAEDTLCQKVYKIKIESDLRRYSAPARGSVAWKDRFKERSSVER
FT                   VIGYLKEFFQLNNVRYRTGKRAKVHFDLVTMVYNGMKLASMRLAQKQYSMNSVAA"
FT   gene            200322..200951
FT                   /locus_tag="Bcell_0180"
FT   CDS_pept        200322..200951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: edi:EDI_005870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28469"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTC9"
FT                   /inference="similar to AA sequence:KEGG:EDI_005870"
FT                   /protein_id="ADU28469.1"
FT                   /translation="MIIKGLFRDINEFIQSYDMQDMEINDAGGEEHGDFFVIIDFQSLE
FT                   AFKANREKLFNYLRNDITELYGSFIDGTFSVDFAMLDGNVVNPSHIREVIETQIPIQTS
FT                   PCHGNKPMISGDIHIFFEEVCNGTFQINDDEYGEGYINLHIQVDSYDDFLLHENVFYTF
FT                   LTNSLNKYNYKIAEISLSVGVLLVKGESVNETSYAMAINKNVYGIE"
FT   gene            complement(201283..201660)
FT                   /locus_tag="Bcell_0181"
FT   CDS_pept        complement(201283..201660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: thrS; threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28470"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD0"
FT                   /inference="similar to AA sequence:KEGG:Hsero_1977"
FT                   /protein_id="ADU28470.1"
FT                   /translation="MIKMYKTTERDDVTMAYQVNVFEDEFKSEVVARVKYNEDLDFWDG
FT                   RNRTNGGVGRHLGITKLKDGRYVLIYGTQWQGEKDYGLIVSPEEALNEILKSNNDELLD
FT                   QKRFADLKILAEEMNSEYETE"
FT   gene            202023..202925
FT                   /locus_tag="Bcell_0182"
FT   CDS_pept        202023..202925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0182"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: lsp:Bsph_p130
FT                   putative DNA ligase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28471"
FT                   /db_xref="GOA:E6TTD1"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD1"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ADU28471.1"
FT                   /translation="MLFTPVKPMLLTMGKEPTNHPEHLYDIKWDGWRILIHKQGNRIEA
FT                   YTRHGNQVTNQFPELQEALSHINKHTAILDCEGVVLRNGNSVFEDFAYRGRLKSTEKIR
FT                   KAMITHPVTFVAFDILATDKPLLKETLIKRKQYLKDIITPSNVLLATPYVIEDGQTLHT
FT                   LTKEKGMEGIVEKPLNSLYHLDTRSPNWLKHKHFKRLDTVIMGYKENPFTMIVGSTFSN
FT                   GKLKPVAQVEFGFNPEDKQAFRGIANRLITKEENGVFWLEPLLCCSTQYLEKTSKNMLR
FT                   ITSFKGFLPEKKVEECVFT"
FT   gene            204625..205002
FT                   /locus_tag="Bcell_0183"
FT   CDS_pept        204625..205002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_01093630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28472"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD2"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_01093630"
FT                   /protein_id="ADU28472.1"
FT                   /translation="MENNQSISNTQKMCVAYGLLYEVETTLVEIIEKTLRKKYGLEWPI
FT                   VLKVRRPLETSRYYEIVGCYVKYEPLKSVFTKEEQQLLFSLDVTRNKIAHMKVITDSEM
FT                   SKLEEAHLVIGSRKINTTIAY"
FT   gene            205313..205606
FT                   /locus_tag="Bcell_0184"
FT   CDS_pept        205313..205606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28473"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD3"
FT                   /inference="similar to AA sequence:KEGG:GC56T3_3286"
FT                   /protein_id="ADU28473.1"
FT                   /translation="MREEEFERYLVSDSMIASKDKAVRSRLSKARKIEVEFRVNLDEIV
FT                   REDERMYETLKRIKREFTDSNGSIQNALRKYYIFVNKTKFPSLNQYEKIHAR"
FT   gene            205824..206777
FT                   /locus_tag="Bcell_0185"
FT   CDS_pept        205824..206777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0185"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   bpf:BpOF4_18100 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28474"
FT                   /db_xref="GOA:E6TTD4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD4"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADU28474.1"
FT                   /translation="MSLFEKLYTLIILLAVVIGIGIGQMDLIRVNAESFIVPLLVAMLY
FT                   ITFLQIPIEEIKKAFKNIKFTYTSVTINFVWTPILAWVLAMIFLGDNPALYIGFIMLMV
FT                   TPCTDWYLIFTGIAKGNVALSTAILPLNLILQVILLPIYLLIFGGTTGVIELGFLVESI
FT                   LIVLFIPLVLALITKLLLRNKQQLRESFISKLSVYPTIFLSLAIIAMFASQGQLLLDNL
FT                   DLIWQITLPLLLFFVINFIFSQKVGRVMKYSYSDRTSLSLNTLARNSPIALAIAMTAFP
FT                   DQPLIALVLVIGPLLELPVLAVITQLLLFFNKNKSQ"
FT   gene            complement(206806..207273)
FT                   /locus_tag="Bcell_0186"
FT   CDS_pept        complement(206806..207273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_0858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28475"
FT                   /db_xref="InterPro:IPR040890"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD5"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_0858"
FT                   /protein_id="ADU28475.1"
FT                   /translation="MSDCCSTNVQEVSEKSGSELCPACKEKGKKVKVITLKSMLKPTIL
FT                   STLNAGLTHYFCSTSKCDVVYFDTDEKKYLTSEVKVSVHQKNSSSDVPICYCFGWTKER
FT                   IKQSVEEEYVPNPVEHIRENIKEHRCGCEVNNPQGSCCLANVTSYIKSLPK"
FT   gene            complement(207444..209576)
FT                   /locus_tag="Bcell_0187"
FT   CDS_pept        complement(207444..209576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0187"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: ttr:Tter_1138 heavy metal translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28476"
FT                   /db_xref="GOA:E6TTD6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD6"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADU28476.1"
FT                   /translation="MSEQKVNELETKTYRVQGFTCADCAKKFETNVKHLDGVLDAKVNF
FT                   GASKITVTGKTTIESLESAGAFENLKVRDDKEQRVERVAFWRQKENFKVYIATFLLISS
FT                   FFLRLQLGEEHIIPIIGYAASIVIGGYSLFIKGLKNLVRLNFDMATLMTVAILGAAAIG
FT                   EWGEGAVVVILFAISEALERYSMDKARQSIESLMDIAPKEALIRRGNKEMMVHVDDIQV
FT                   GDDMIVKPGQKLAMDGVVIKGTSTLNQAAITGESVPVTKTIDDEVFAGTLNEEGLLEVK
FT                   VTKRVEDSTLSKIIHLVEEAQAERAPSQQFVDRFAKYYTPGIIVFALLLVIVPPLFMGA
FT                   DWSEWIYRGLAVLVVGCPCALVISTPVSIVTAIGNAAKNGVLIKGGIHLEETGGLKVIA
FT                   FDKTGTLTKGVPAVTDIVTFNNNEEELLTITAAIENGSQHPLASAIMRKAEEQGLNYNE
FT                   VLIEEFQSITGKGVKAIVNNQMYYVGSPNLFEEVLPKGVKAEIKESILNFQTQGKTVMV
FT                   LGTDKEVLSLIAVADEIRESSKEVIRKLHQAGIEKTVMLTGDNKRTAEAIGKQVGVSDI
FT                   EADLLPEDKLNFIKELKSKHYKVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETADI
FT                   ALMSDDLSKLPYTIKLSRRALTIIKQNITFSLAIKAIALLLVVPGWLTLWLAIFADMGA
FT                   TLLVTLNSLRLLRIKE"
FT   gene            complement(209569..209937)
FT                   /locus_tag="Bcell_0188"
FT   CDS_pept        complement(209569..209937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0188"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: sag:SAG1258 cadmium efflux system accessory
FT                   protein; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28477"
FT                   /db_xref="GOA:E6TTD7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU28477.1"
FT                   /translation="MNKKDTCEIYIYDEEKVNRIQDDLQTVDISSVAHMLKAIADENRA
FT                   KITYALCQDEELCVCDIANIVGITVANASHHLRTLHKQGVVKFRKEGKLAFYSLDDEHI
FT                   KQIMIIALTHSREGKNNV"
FT   gene            210724..211437
FT                   /locus_tag="Bcell_0189"
FT   CDS_pept        210724..211437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sez:Sez_0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28478"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD8"
FT                   /inference="similar to AA sequence:KEGG:Sez_0306"
FT                   /protein_id="ADU28478.1"
FT                   /translation="MINLHNDIVKAIVNILVMDDPEARLLYLQSINNVSGEGTQNSSPK
FT                   QKWDYRYNSLIEMAKKYELRYFKLDRGKLWEAVLIAGPQNELYVFFSHKNMKNVIKKGK
FT                   NNHYLKLLNLFNHELDELKPIYSQMTLPISFEDDDDSSEDLIEQAREMLSMMEEEPSKV
FT                   YVFAFDHSFVTTVKAFAYNTRQEVVWERDLTELIEPNYRLVLTDDEIYPDTRISNNTPE
FT                   TKKEKKQIVSLKNIK"
FT   gene            211453..212616
FT                   /locus_tag="Bcell_0190"
FT   CDS_pept        211453..212616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0190"
FT                   /product="protein of unknown function DUF955"
FT                   /note="KEGG: sez:Sez_0307 transcriptional regulator; PFAM:
FT                   protein of unknown function DUF955; helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28479"
FT                   /db_xref="GOA:E6TTD9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTD9"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADU28479.1"
FT                   /translation="MKKIFNGSRLKESRLYNKLTITELAEKLNVTKQMISKYESGKSEP
FT                   SFEKSLILIDILGYPREFFYTTDKYVIENEGTFFRSRLTATQKSKEPASIALKYSVVVR
FT                   DFLEQYIDFPVLQNREMYEGKDNPEEVALSIRKSMNLGLEPIHDIIEVAELMGFTVINM
FT                   DYQEDKVDAFSSMNTVNGNSYFVITTGDSGSFYRQQFSIAHEIGHWVLHQSINPQELDK
FT                   DEYKTMEDEANKLASIFLLPKESFGEELKSQIVDEIDTYYNLKRKWNVSMAAMIKRARD
FT                   LNIISVDQEVKLYKQMHYRKWRNPEPFDLETKVTSPVAFKQSLELLIDEKILQGHEIPL
FT                   KIAEEYNLYLTPKMLAMICGVEPALFLDNSQSKVVLKLKDFKGMKSG"
FT   gene            212766..213446
FT                   /locus_tag="Bcell_0191"
FT   CDS_pept        212766..213446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gka:GK0883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28480"
FT                   /db_xref="InterPro:IPR041304"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTE0"
FT                   /inference="similar to AA sequence:KEGG:GK0883"
FT                   /protein_id="ADU28480.1"
FT                   /translation="MARSQLLKDAVGGKESIENILLRLKVILADMENENIMNWVNGELE
FT                   GYKDKDNLPPFRILKGHITGTYLVNFQFQYTDAPVPLENLLSKEQIDEIETVKIYDGVA
FT                   TIQNILQGANAESYGTVVPTAFCYAISKDELQIAGMKVKIASNQLNGIVSRVKSKLVEV
FT                   IMELEKEFENLDELDIRDQIRESESAKQVIYNIESIVYDESIRVGDKNKINKSIIGHLL
FT                   GKRG"
FT   gene            213450..213668
FT                   /locus_tag="Bcell_0192"
FT   CDS_pept        213450..213668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B2408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28481"
FT                   /db_xref="GOA:E6TTE1"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTE1"
FT                   /inference="similar to AA sequence:KEGG:BCG9842_B2408"
FT                   /protein_id="ADU28481.1"
FT                   /translation="MNIRIGDKNKIKNSSIGHQYRSSNESNESEGTKKFHEKHPILFSL
FT                   FISIVAGVILLFSFWETFIIWIESLLK"
FT   gene            213783..214574
FT                   /locus_tag="Bcell_0193"
FT   CDS_pept        213783..214574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0193"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: mpe:MYPE4170 excinuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28482"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTE2"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADU28482.1"
FT                   /translation="MIDMLTEDELRWIEMILEDHDPLEISPSYYHKRKIELEWLNNKGR
FT                   VRKELDELRKKLKVTPQQLLELKNDSARREQEIENFPGIYIIHNCVKDIYYIGQSKRVL
FT                   DRAYKHFVTNPEDMKGRYELSVKCNLPEIYIDFNSGDKFIVSLIPLDNTSFSSLNELEG
FT                   YAIVAYDSVVPNGYNRVIGNIMDKHVFKNDDYEKAANFIFERIIEVKGEDFFLTLSNER
FT                   KRVVYTHKLFAELRLPRNLHFSKGFRMMIKEYIKENKKRKN"
FT   gene            214947..215690
FT                   /locus_tag="Bcell_0194"
FT   CDS_pept        214947..215690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0194"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   tnp:Tnap_1258 protein of unknown function DUF1385"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28483"
FT                   /db_xref="GOA:E6TTE3"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:E6TTE3"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ADU28483.1"
FT                   /translation="MEVYGGRAGYNSVCFKSERYKVISRWENGGIKTKTTRKKGKRKLF
FT                   FVLSKVPFVRAFSFIFELLMEYWGYVLSVFMIVLLLQIKLFESFKSYSIPISPLVLLLV
FT                   LLLISGLFIKVTPIGKYHAAEHMVARAYEIDGGDLSIEKVRQHSRIHKNCGTNLVTSIL
FT                   IFYICCFFIIGDGIWVLLVSWGIGYELWKSEPKGIWNIMLVIGGILQYYLFTSKPDDRH
FT                   LLVAIEAMRVMEEQESNSGKNKGRQ"
FT   gene            215693..215794
FT                   /locus_tag="Bcell_0195"
FT   CDS_pept        215693..215794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28484"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU28484.1"
FT                   /translation="MEQTGILQDFAQEIFDKSKFQRPQLQCLETVLS"
FT   gene            215954..216403
FT                   /locus_tag="Bcell_0196"
FT   CDS_pept        215954..216403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_154410 viral A-type inclusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28485"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU25"
FT                   /inference="similar to AA sequence:KEGG:TVAG_154410"
FT                   /protein_id="ADU28485.1"
FT                   /translation="MREKREGNQLPLLHVYPHYVPSEEVVLVGNRLALNRLKKAIEQAL
FT                   ARGEAESEQLSTALLEPYSIRVIVNEEKCDDPFWLNLKLPFAELEDANPKALDQYDLLS
FT                   YNIIDSESLKRMEPEIEKDRTESEEMTELVMENCRRNSNKDKNTF"
FT   gene            complement(216663..217247)
FT                   /locus_tag="Bcell_0197"
FT   CDS_pept        complement(216663..217247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vcj:VCD_002300 RNA polymerase sigma factor for
FT                   flagellar operon"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28486"
FT                   /db_xref="GOA:E6TU26"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU26"
FT                   /inference="similar to AA sequence:KEGG:VCD_002300"
FT                   /protein_id="ADU28486.1"
FT                   /translation="MIENQVSKVDMELYLDLIKAPYGQRKKYIQLLKAPESDQYRSFKR
FT                   AYLFFKDNLIDREQNILDLVYRNNGELSLKEIGERIGISSSRVAAIRNLAERRLSLVML
FT                   RHLRGDDSPQKKSMYTIVYNLSDQKLIALLQITRPWEKNISYYQERGTLTTERRKTVRH
FT                   KLYNVWTLDMNDHRDKMIKLLAINKGDIEWD"
FT   gene            217729..218010
FT                   /locus_tag="Bcell_0198"
FT   CDS_pept        217729..218010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RCIX449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28487"
FT                   /db_xref="GOA:E6TU27"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU27"
FT                   /inference="similar to AA sequence:KEGG:RCIX449"
FT                   /protein_id="ADU28487.1"
FT                   /translation="MEKVNQEIVDMIDQNFGELLEQLKKSRGYSLYKISEKTNLSPSFI
FT                   HRIIKGFRGCELSTKLNILINGFEMEKEVEEFLKRVVANKEALKKIND"
FT   gene            218659..218853
FT                   /locus_tag="Bcell_0199"
FT   CDS_pept        218659..218853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28488"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU28488.1"
FT                   /translation="MLCDCGGVLVVIAIEDIPKHLSSKEKIMYNRVCDVQCQKCDKIQY
FT                   SQPYDDGNLLNLVKETKKI"
FT   gene            219026..219421
FT                   /locus_tag="Bcell_0200"
FT   CDS_pept        219026..219421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28489"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU29"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3574"
FT                   /protein_id="ADU28489.1"
FT                   /translation="MDKIDGLISESKLTHRELSNRAGNSNNWFNDAYNNNEDINISSFI
FT                   MILSVIYQKQDLSDHKLLAIFDNKILSISTLISRLSDEDENYIDEFIVSEKLLFLDILG
FT                   DWASMAYKNKLSEKEREIMDEVKILIS"
FT   gene            219441..221036
FT                   /locus_tag="Bcell_0201"
FT   CDS_pept        219441..221036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0201"
FT                   /product="Restriction endonuclease, type II, AlwI"
FT                   /note="PFAM: Restriction endonuclease, type II, AlwI; KEGG:
FT                   gyc:GYMC61_3573 restriction endonuclease, type II, AlwI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28490"
FT                   /db_xref="GOA:E6TU30"
FT                   /db_xref="InterPro:IPR018573"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU30"
FT                   /inference="protein motif:PFAM:PF09491"
FT                   /protein_id="ADU28490.1"
FT                   /translation="MRKVWFITRPERDPKFHVDALRALQIATDNFTVIWLGNRDAHKHY
FT                   EAVLGSEELKRDNISNDGSGGRTWAAMLRTFGYVYLNSDGYLVLTKVGQKVLNSEKVRE
FT                   NISKQILTLQIPNAYFLDSGFRPKYEEDFQIRPARFLVRLVNQSILDYYVTKEEITFFA
FT                   LTAKRDDEIFNVTKRILDFRKASDTEKSQIKKSVATHFDHRQRADSDARDFASAHGDVA
FT                   HTFMMLCDYTGFVDYVRGDALRLPTDKQNTTSEMLNYMENRYPFNKRYLISLERFAENA
FT                   GLDIDSYKASAFGSLPPATNRGKSVKKVQRLLAAYPLVQGLTVEQIVEILEQELSTNEA
FT                   KKFANELHNQNYESLNDDFVEAYLYEENDRVFEDKTGEILRSIGFNVEMRPKPLGNDVR
FT                   TEIEILIHVDEETVCILDAKNYREKFTLSANLASHMASEYIPNYHGYEGKSVAYFGYVT
FT                   ANRFGGERHLEKICEKAKLINSEIQVSGVILSAKALLGFLDYCLEHELTKEERKERFIS
FT                   LFNNTGYENVGEMF"
FT   gene            221200..222348
FT                   /locus_tag="Bcell_0202"
FT   CDS_pept        221200..222348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0202"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="KEGG: gyc:GYMC61_3572 DNA-cytosine
FT                   methyltransferase; TIGRFAM: DNA-cytosine methyltransferase;
FT                   PFAM: C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28491"
FT                   /db_xref="GOA:E6TU31"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU31"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADU28491.1"
FT                   /translation="MIFRKGELFNGPGGLALGAKNAGFIHPETGEEWKIQHVWSNDYDS
FT                   NACKTYGYNICGDENDESVHIGPVENLPIGNKDVIGDIDCFAFGFPCNDYSQVGEKKGL
FT                   NGTFGPLYSYGIKVLRLYQPKFFIAENVGGLQSANEGQAFVKILSELEEVGYKLTPHLY
FT                   RFEEYGVPQARHRIIIVGIRNDLAKEGIEFKVPAPTTLASTEYKTSRQAILEPPIPEDA
FT                   PNHEMPRHTKKVQEMLSYIPAGENAWYLGIPEELRLNVKGARLSSIYKRLDPNRPAYTV
FT                   TGSGGGGTHMYHWSENRALTNRERARLQTFPDDFMFFGSKEAIRKQIGMAVPPEGAKIV
FT                   FNAVLKTFAGIEYDSIPPIEKLQLENLRGTKKESVKELVTSL"
FT   gene            complement(222423..222707)
FT                   /locus_tag="Bcell_0203"
FT   CDS_pept        complement(222423..222707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_2786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28492"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU32"
FT                   /inference="similar to AA sequence:KEGG:AGR_C_2786"
FT                   /protein_id="ADU28492.1"
FT                   /translation="MPNIRYTISFPSKDLDLSQFMEEKLMRGGMSVSAYIRDLIRKDME
FT                   NKGAESLEEIYQYVEKRLKESGLAMEETRGRDMKDIVDEVDKELILNLF"
FT   gene            complement(222694..223671)
FT                   /locus_tag="Bcell_0204"
FT   CDS_pept        complement(222694..223671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:pE88_13 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28493"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU33"
FT                   /inference="similar to AA sequence:KEGG:pE88_13"
FT                   /protein_id="ADU28493.1"
FT                   /translation="MKEQILIAVDCGKYQTKGIARYRGKTFMVSFRTKMMPVSRLGVDI
FT                   QPNSFLVEYLGNEYLIGNMVSEDFVDYSLTKNSTIHQISIYTAISQLLQKANAPANVDI
FT                   RLAVNVPISTYKDSVQKDSFKQMVENRRGSIHLLVNGRTHSFELSDVTLAFEGMGEVYS
FT                   KPDVYKDKNTIVVDLGGLNTTLCTFSGIQPLVNTMIVSDLGINVLKGRIGKAINERYGL
FT                   SVSADDLEQVLRSGYFASKGEVFEESKVFIEELKYDHVQQIIRFARSRGYTFNMSDIHF
FT                   VGGGAIILKRYIKQEFPHAVILDNPQYSNCLSFLKILEVKYAKH"
FT   gene            223817..224014
FT                   /pseudo
FT                   /locus_tag="Bcell_0205"
FT   gene            224382..224591
FT                   /locus_tag="Bcell_0206"
FT   CDS_pept        224382..224591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_01092480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28494"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU34"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_01092480"
FT                   /protein_id="ADU28494.1"
FT                   /translation="MKSTNKEYRDSFFERKASELDVESLKEAKQIYEGLKHYNRIIERY
FT                   GVERVQQWTNISKEEKKSLIGGER"
FT   gene            224588..227767
FT                   /locus_tag="Bcell_0207"
FT   CDS_pept        224588..227767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0557 exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28495"
FT                   /db_xref="GOA:E6TU35"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU35"
FT                   /inference="similar to AA sequence:KEGG:CLI_0557"
FT                   /protein_id="ADU28495.1"
FT                   /translation="MMQTTPQASNSLPNPQTSQYLQNKLLVTPYIQSYETKPTKYEAAK
FT                   MQNFYKTVNIGNKSRYSYMGEYEFAHNVLETGTPHIVGSWVDSPNKRDEVKGYLTNMFE
FT                   FDLDNMNHLSYQRKKELEKKLFENFYMVQRSFSSSDNYNDPRYHVYERVMEIEGCSYEQ
FT                   WAYAYKRRMEHWEQELGLSFDHSQHLLKLIYASGKKVHINRQQKATNLQPYMDEFLEEK
FT                   KRLKVRKGKSSVKDKEVTRKLADDHFNNHYLPIGVNFDAIVKALEEMPLIDDYDEWFSF
FT                   LQTFYSMMFEGLIDRNQAYKLCEIIDDDNGRYQEEFKKIERYGYVNRTIGSFIYDLNKY
FT                   GIDTNGIFQLSEKHELKIDKEWEIEGYLSDDVQVCKEFKELVLNNPGKRILFIGDTGIG
FT                   KSKFTLDVLDEFNERLQSFKRMYRSIGSLSYSIMAIPRRNLINNLKEDFSTNKSAVLTG
FT                   SDELIKGQRESIIASNDKFLTTPDHAHIILDMKLTEGERVRRSDYDLETLEVLRHHRIM
FT                   VLDECHMLANDSTFKSETIERYLVVEEEHMKSGGIVLHMTATPESLTTEGVYDLVIKVT
FT                   QKDRKNPFHKAGFKVLSGKNTNEVDSMMLKLIREAIKKNPSRKLLVFVENKSLIEDFKK
FT                   DLIEKGIKAVGVYAKREKDRSEEEKSIIGPGIIPEDVQVILGTTAMSAGISIVSGFDKQ
FT                   AETWVYCSSSSMNHEFTRLVQMSNRFRISREIPTYAAFNVFFQESSSEKQDNVFRYHAY
FT                   VEEQIRKAKNSKIYIELIRGGSVPVIGKLDEIERNCGLFADKEGRLQVNIPAIESEGIL
FT                   KKVYNNYNNYRSLLKELEEKFTCQITDLDRSVTISKKELLRSKKTKGDAKAIIKQIALE
FT                   QGYFEQLKEEYLSIRKDGELEFVRNTLSSGSKKDLQHFLITEPDIELVRKVFETHLRKR
FT                   KLENYCYIEDLKAIEKIRDIRGREELTLEVQLIEMLDSVFERKKKGLEFKSSGEVSEFL
FT                   KECLSKKLKEKKLELDASRFNPNTFKKLLNIRVRPSDGKKFYRVIGLKDEAYLSQTYGI
FT                   QVPQICLKGVA"
FT   gene            227976..228458
FT                   /locus_tag="Bcell_0208"
FT   CDS_pept        227976..228458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ath:AT1G13520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28496"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU36"
FT                   /inference="similar to AA sequence:KEGG:AT1G13520"
FT                   /protein_id="ADU28496.1"
FT                   /translation="MMTLKERFKEMKEKKQIVWNGKSGQEIVEKAIGIVGFEPIAKIAK
FT                   GDDWVFESVEYYIGKNRKYQMGHLVYERQEYRCEGIDGDIEVRKQIFVCPDGSILVCFV
FT                   TREENNCGSCEMIHCNLNRIISNNQELTQEEKEDILTYLAIEINQFLVSRGETIRN"
FT   gene            228581..229123
FT                   /locus_tag="Bcell_0209"
FT   CDS_pept        228581..229123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF0691 tRNA
FT                   (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28497"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU37"
FT                   /inference="similar to AA sequence:KEGG:EF0691"
FT                   /protein_id="ADU28497.1"
FT                   /translation="MQSTRVMAAELLREKIELAKTTLKFVEIVESGSGEGFEPEYNKSR
FT                   HPFHNEDGTPLLGIRVYKEPITYEELNVGKGSIVALTEIYLTDRGDLVRFCTFEETFYS
FT                   SKNEKPRIQMKSFISGDQLIADDELHFILFHTTWLISHHYVIQGNHEKAAIAIEENRRI
FT                   YDIVYEWLERTVRDKKD"
FT   gene            229224..230306
FT                   /locus_tag="Bcell_0210"
FT   CDS_pept        229224..230306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: S23 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28498"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU38"
FT                   /inference="similar to AA sequence:KEGG:Tmath_1866"
FT                   /protein_id="ADU28498.1"
FT                   /translation="MTNNIVNQIQREYRRNRELSNYSIFDIEASLKNLAEKGIIWVLKD
FT                   LRDICEAEEILIEKYLHDYRANQIYDNLEEFLNIQSSKNLTEAISSKPSQSTKPSKEKQ
FT                   TKKRQHLEVRDVTHFIGYKKAMELEKKVIELCQNFPSYEVDYIVNQIERSASSIKERIE
FT                   MGEQIYVGEKFNQYSIAIGSAKETTAWLQISMGQEYITRDQFDELDNLTTQVVRILTKS
FT                   LSNIKEKEGKGMDLPCPYTPDVKNFGAYNNALLLVEKIYEITNRKEFWKEKIIVKKLRR
FT                   RATSCAANIAEAHQLYILKKFRFFNDSLKALDGLDSLLETCLFKGIISEKELKEIGVLR
FT                   ISIRNILSTKMSNLSKEKAG"
FT   gene            complement(230647..231321)
FT                   /locus_tag="Bcell_0211"
FT   CDS_pept        complement(230647..231321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28499"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU39"
FT                   /inference="similar to AA sequence:KEGG:Trad_0394"
FT                   /protein_id="ADU28499.1"
FT                   /translation="MEKEILINTGVSLSKSALGAVPFVGTLLNEVFFDYRGRLKQQRIN
FT                   TFIEDLKKYLDSHVNERNIDMKYVRSEQFGDLFESIINRVSQNNQKDKIDRFKSVLVNQ
FT                   MIAPYETDYTETFLDIVSKISEKQIEILSVYRKVHEGIIKNEDDLMNRNLLDANHELKT
FT                   SDFRTPQYYNLDKNIYMFYVQDLVSKSLLLDDSINRFSTRPYEILEITAFGLEFLRFIE
FT                   RK"
FT   gene            231734..232366
FT                   /locus_tag="Bcell_0212"
FT   CDS_pept        231734..232366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28500"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU40"
FT                   /inference="similar to AA sequence:KEGG:Glov_2582"
FT                   /protein_id="ADU28500.1"
FT                   /translation="MFREDIKRAAEDNGIRFLLHFTRAENLNSIFRYGILSVSKQKSLS
FT                   LEVSRNDPNRYDEFLNATSVSIHLPNNILLYKYKNKFNCEWVVLGIKPDIIWEKRCGFC
FT                   NENAASSNVSKIPLNKRMSVESLNGLFNNISGKPSRSKLNIDKSLTTSPQAEVLVFEDI
FT                   EPSYIWGVAFESNYAKNKYKENIPSSIKIEIVPELFRFAIRPDYLHW"
FT   gene            232663..233604
FT                   /locus_tag="Bcell_0213"
FT   CDS_pept        232663..233604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28501"
FT                   /db_xref="InterPro:IPR025935"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU41"
FT                   /inference="similar to AA sequence:KEGG:lin2940"
FT                   /protein_id="ADU28501.1"
FT                   /translation="MANLFVIGNGFDLDHGLETSYNHFREYLLLNYPEIKMDELIVPDE
FT                   IHLPDGGIEYDDAEVLSMLFYLINTAEQNEEKWSDIETALGYLDFSEAFDWFDDILDKD
FT                   GDIDMWKTVYRNEDLSSQLVIPTTKIQNFFWEWVNSISLHSASPKSDFIKLLKDKEQFL
FT                   SFNYTETLEIVYNISPENICHIHGKQTEEIYFGHGSKEDYYERYMQSHIGSQDGLSNID
FT                   EQLRKKTEKALEENLDFFESLRDANITNIYSYGFSFNEVDAIYFVEICKRINTKKVTWS
FT                   FNDYDKANIEKYMEFLRSCGFKGDFKTFHIRE"
FT   gene            233767..234336
FT                   /locus_tag="Bcell_0214"
FT   CDS_pept        233767..234336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0214"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: cbf:CLI_A0009
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28502"
FT                   /db_xref="GOA:E6TU42"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU42"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADU28502.1"
FT                   /translation="MKVVQPIRDLKQLEAVKAYLRGKNKRDFLLFMVGISSALRISDIL
FT                   KLRVNHVWDGKKPLGFIEMNEKKTGKYKRFPITPNLTKAIKEYMKEFPEKQREDYLFTS
FT                   RKGINQPISRQYAASMLNEACDMVGIKERFGTHGLRKTWALFAFKKGISLDYICMALNH
FT                   NSIAETKRYIGLLQEDLDNLYLQVNL"
FT   gene            234333..234449
FT                   /locus_tag="Bcell_0215"
FT   CDS_pept        234333..234449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28503"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU28503.1"
FT                   /translation="MNQLNKFFEIKAFVADFVTWIKKTIHFDNSQSTSVFYF"
FT   gene            234466..235479
FT                   /locus_tag="Bcell_0216"
FT   CDS_pept        234466..235479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: str:Sterm_0086 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28504"
FT                   /db_xref="GOA:E6TU44"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU44"
FT                   /inference="similar to AA sequence:KEGG:Sterm_0086"
FT                   /protein_id="ADU28504.1"
FT                   /translation="MNAISLVLDYIEEHYHDEINEKTVEYVTGCTFEEFAKKFKEKTGV
FT                   TFSTYLVRRQLTRINDELCNITCEKDLNCSPFQSWEELSTLFKSEFKIPIDTATKNEHF
FT                   ILQEKIGSKEWNMCDLVIRDLLNRFECPSKALRYLLSLQPYYFEVDSEVIQPSRSNLIS
FT                   SIVKKVHGELSLSEFRKIVTILENYYMLESDYYSKHSIDVSKRYILVFRGLINKLVWEY
FT                   GAGFDYEVNELKTLWSVSHDKELISHKWHSNLSQSVMEAIKQQDLGNISFANIDELFGW
FT                   VDVYFSKQKKRINNQNFNKFTRYKLIEEGCKNLEEEDLTTMINTLLVQGLLFLQLR"
FT   gene            235516..236361
FT                   /locus_tag="Bcell_0217"
FT   CDS_pept        235516..236361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0217"
FT                   /product="TnsA endonuclease"
FT                   /note="PFAM: TnsA endonuclease; KEGG: cth:Cthe_1876
FT                   Tn7-like transposition protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28505"
FT                   /db_xref="GOA:E6TU45"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU45"
FT                   /inference="protein motif:PFAM:PF08722"
FT                   /protein_id="ADU28505.1"
FT                   /translation="MIREWNETTINRFLKEKRGQGMGKDYKPWLQVQDIASKGRSTRIF
FT                   GHTTQRVHHLLSDLQLYYFYFLEFDNDVADIREQYPLLDFHDMNIQVDEELTKKLFDKK
FT                   TQVPHIFTVSFLVTRKGENGEPYYQARIIKQSHELEKSATLQRIELQRRYFEKKGIDFG
FT                   IVTEKEINKQLARNIGWVLNSYDIQDYPILTSNLVHLKRDMVQCLSNKYDTFQGVFSRL
FT                   ERGYSLDEGLGLILFKHLIANKEISMDLTKKIYLTSSIENYQVEVVGKNGGDNRYAVGH
FT                   "
FT   gene            236345..238471
FT                   /locus_tag="Bcell_0218"
FT   CDS_pept        236345..238471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0218"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   cth:Cthe_1116 HMG-I and HMG-Y, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28506"
FT                   /db_xref="GOA:E6TU46"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU46"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADU28506.1"
FT                   /translation="MQLVINDLLQSTENPDHIQRIVWVDNKNQLCFLVNIRKLSFPYSE
FT                   GIHNIEASFNRGEIIKVKTDPWAISVDEEDLSESEIEIRDKAWRLINQICLTPEIFDPK
FT                   QRSALIKIASKDFALSTKTVRKYLIRYWTRGMIKNALLPDFNNCGKQYGMDRKYNKKAG
FT                   RKFAYSSSIQRGAITDEWKEIIRISLEKYYFIRSKPSLKYAYQQMVKEYFSKEDEKSGY
FT                   KVLDVEKPIISYDQFYYWYRKWYKPEDAIHKREGRREFLQNYRAITGSATEDSMGIGTY
FT                   AIDATIGDIYLVSSLDRNIVIGRSIVYLCVDIFSRTIVGLGVGIENMSGQSLRVALANT
FT                   FENKKDFCKRTLDMEIGNDDWPIHYVPHTLLADRGSELISNELTQIVENLNIKIQNTGS
FT                   YRPELKSVCEKYFHIVQQHISPFLPGSIQKDYMKRGGQDYRKKAVLNLSEYTQILVRCV
FT                   LYYNNHNFLSDYPLTQNMIDEKIRPIPIEIFKWGLHKGNGQLRTMLLDAIRSNIYPKSQ
FT                   ATVTPKGIHFGNLYYTCSKAVKERWFSNARIQGNWKMEVYYNPQSVATIYIRIDRQNYE
FT                   VCSLIEQYEMYRDAKEEELVSLKENLRLQKAEYVEAQMNGAMQLAQDIESIVKQAKEKT
FT                   KDQSLNGEVPKDIKNIRENREKEREVLKREQQAVIDQQNIGKQLNKVNHDLESVNVLDI
FT                   FRKKQKEVLRDEDK"
FT   gene            238458..240068
FT                   /locus_tag="Bcell_0219"
FT   CDS_pept        238458..240068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0219"
FT                   /product="RuvA domain protein"
FT                   /note="PFAM: RuvA domain protein; KEGG: cth:Cthe_1115
FT                   Tn7-like transposition protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28507"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU47"
FT                   /inference="protein motif:PFAM:PF07499"
FT                   /protein_id="ADU28507.1"
FT                   /translation="MKINELVNGTKAQVAEYREQEILEYQGNPLIEALPPIYSQEEVID
FT                   RLSMYPPYNVEERYMNDHQRVHLISRLLQYFQAIPIHLKIESSISRLIRTGYTYRNPVS
FT                   STYAQSFVDNWNNIQNKSFDKSIIQTGQTLSILGVSGVGKTRTLQRILQTIPQVISHVS
FT                   YKGKALNHYQITYLKIETPFDGSVKTIIYDFMYQVDLLLGSNYFNRYVNSHLSTSQLMP
FT                   IMAQIAKSINLGMLFLDELQHLKGIKSSRSSQILNFFTALINTINIPLIMVGTPKAMDV
FT                   LQSQFRQARRSTNMGNIMWDRFEKNDIWDLFVSGMWKYQWIKEDVLFTEEISSTLYDES
FT                   QGIADIAIKLYMMVQLRAISSCKERITTALIKQVAQEELKMVQPMLNMLKSKDYSKLAK
FT                   YDDLMLPKIEDFMEQERITVDQKQVMNSLQEGAKRKNEQLQLIDDATFRLGMLGFNNDV
FT                   AVKAVQKAISENNQLEEVSQIVKDAFLLLNNNDKSTEKVISNDLRTIIKKGKEQQVTAY
FT                   QALLDAGVIKQDYPERVVS"
FT   gene            240065..241894
FT                   /locus_tag="Bcell_0220"
FT   CDS_pept        240065..241894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0220"
FT                   /product="Tn7-like transposition protein D"
FT                   /note="KEGG: tit:Thit_1874 Tn7-like transposition protein
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28508"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU48"
FT                   /inference="similar to AA sequence:KEGG:Thit_1874"
FT                   /protein_id="ADU28508.1"
FT                   /translation="MIIQFPTPYPDELLFSVIARYHIRSGNVFWKHTLEDLFGKRTISA
FT                   TVLLPSGIGSLVQRLPKNTTLNEQILIEKHTMYPFYTVFIPTEKAQSIYESMISNDGKK
FT                   IYMQSGIMASSIPQNKYLKYCSACAREDIATFGEMYWHRTHQLPGNLICTKHELCLEDS
FT                   DVLITHSNKHAFILPTTSNCDLNRKSMITETSLIQLKNIVLQAEDLLNRKYQNQTFSHF
FT                   TQFYRYHLIEKGYASLKGQVKQKALYDAFYNLYSEELLNTLCIEPRATQWIANFSRKHR
FT                   KSFHPYYHLLMLNFFDLKVNAAFEETSFENTPFGHPNWPCLNATCPDYKKNAIPEITIR
FT                   RCEKTKKLIGRFTCHTCDFSYTRKGMDPNKDDCYKFSRIMDFGFLWKRELQLLLNKGLS
FT                   YREVARILGVDTNTVIKYEKKNIENKQKAKVRIDSDLVKEHRYEWIHLQRDFPGLSKTE
FT                   LRKKRPEVYAYLYRHDRDWLKVNSPKRKKVDPTNNRVNWLERDKEILEKVQKVVSELRG
FT                   IDKKPVRITVKILGDGIGERALLERHLDKLPETRVFIEKVSESEQDFRLRRVKYVINEM
FT                   MEKGEEIKEWKVLRKAAIKKEFYKEFVDFLKRE"
FT   gene            241900..242517
FT                   /locus_tag="Bcell_0221"
FT   CDS_pept        241900..242517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_20029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28509"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU49"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_20029"
FT                   /protein_id="ADU28509.1"
FT                   /translation="MFRNALEEVDSFIKSNVFTLSGNDLYNLKKDFYDKSVEFMGHSNN
FT                   LTGITELVVNMYLNHWVEAQSLPYTLKRNYKVKGVNGKENELDIAFLDKSLEIQYGISV
FT                   KREIGSTRWETHEKSSTSYKELTKKYSVRNNLLQDYWRLDNIKRGISRALPTVTIIFEG
FT                   VKVGEETMIKKLTEDTPSFQYLVLYQHQEAIFYDLKKKLCIL"
FT   gene            242620..242949
FT                   /locus_tag="Bcell_0222"
FT   CDS_pept        242620..242949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lmn:LM5578_0671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28510"
FT                   /db_xref="InterPro:IPR008489"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU50"
FT                   /inference="similar to AA sequence:KEGG:LM5578_0671"
FT                   /protein_id="ADU28510.1"
FT                   /translation="MQKLKAEVVITIPEDMVLITRVEYEMLKQKELSGLYWNMKDLEKR
FT                   INKKSEWIKENILYPGRFRKILDINKGGFVYYPETKGQHWSFQATKMAEFLDNNFGNIF
FT                   SGKIQ"
FT   gene            243049..243543
FT                   /locus_tag="Bcell_0223"
FT   CDS_pept        243049..243543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28511"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU51"
FT                   /inference="similar to AA sequence:KEGG:DSY0690"
FT                   /protein_id="ADU28511.1"
FT                   /translation="MNLYELFQMWINHPKKGSGRRNLDNTDECWKKVLQDIRNWESSED
FT                   KNDNDFAKYLLYTGKIRRVHLDLNEVNYNNHYVSWTSTENLEDLYWFNSSCDHTIITAE
FT                   ATKDNPGISIKGFIEAMKSDNKNFELNSPAIRAEQEVIFPLQEKSIISIERILKLNRNE
FT                   K"
FT   gene            243873..244607
FT                   /locus_tag="Bcell_0224"
FT   CDS_pept        243873..244607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY05522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28512"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU52"
FT                   /inference="similar to AA sequence:KEGG:PY05522"
FT                   /protein_id="ADU28512.1"
FT                   /translation="MKFERLDTVDRILLTSEDSKRLDDWWLNIHEGAFNEFRPVLEEGV
FT                   IIQELDPHLKFDKDFVKAHGLTTSLALLYFKQLDDVRVYYEIYRTIGENQVEHILEGTK
FT                   NYVELKSDLTINKNNHIGLKIEHAVHYLDAVTSSHIALMNYMELYRDERERVSFQKLRK
FT                   TKTKKTKKGKKKNTRPINMVVYNIKIPDVHITEEERQAYKKMKEAWKVRGHWRTLPSGK
FT                   KTWIKPHIKGNKEKLEPNIYHF"
FT   gene            244951..247215
FT                   /locus_tag="Bcell_0225"
FT   CDS_pept        244951..247215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpb:Cphamn1_1151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28513"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU53"
FT                   /inference="similar to AA sequence:KEGG:Cphamn1_1151"
FT                   /protein_id="ADU28513.1"
FT                   /translation="MIEKIRIKEVASYDSTGIEVNLSKINYIYGSNGTGKTTISELLRN
FT                   RDNQKFSSCNIEWKQGSPDFDLFVYNRYFVQENFSIHNDIKGIFTLGKESTDILALING
FT                   KLKEAEKHQDRIGNLENNIRQKKEQIQILKTNFTNHCWELKQKYDENFKEAFTGFRNKR
FT                   ENFMERCLDEAVNNNSELYTYEELNSRVESVFKNSRVKIRPIPEIQYDSSVEEQSIFQS
FT                   KIIGKNDIDIARLISELNLSDWVQQGHRHMEGTDGICPFCQQELPRSFKGKLDEYFDET
FT                   YTEQIQNLNSSIEKYERDTIGFFEQYNFLITEDIPYINKEKISSLFEIMNSTFKENMQL
FT                   LERKRNEPSRSIELSSITNYLEQIKSEVVQANVQISEFNRVIDNIKEEKERLIKDIWRF
FT                   IVEENKGNYDNYMSNFRRENGALVGMENGKVQQVGFKRKLEEEAIELQNQLTSVLPSIQ
FT                   EINTLLKSFGFTNFQLAESDEQGNYKIVRENGEDANETLSEGEKTFITFLYFYQLINGS
FT                   NDQDKVNTARIVAIDDPISSLDSNILFMVSNLINNLKKKVRSNDTNFKQLIILTHNVYF
FT                   HKEISFNKEHGSKKLNDETFLILRKTDNASQITKYEENPIKNSYELLWNELNENPNSIT
FT                   TPNIMRRILENYFKFFGNVDVHKIIEEFPDEDKVVCNSLLSWANDGSHHVNDDLYVDSN
FT                   QEQNKIYFKVFRKIFINSNHESHFNMMMGNFDSEVEQNDANDEASKEIQEVLAQVAASQ
FT                   E"
FT   gene            247274..248017
FT                   /locus_tag="Bcell_0226"
FT   CDS_pept        247274..248017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0226"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase-like protein"
FT                   /note="KEGG: bwe:BcerKBAB4_1179
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28514"
FT                   /db_xref="GOA:E6TU54"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU54"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_1179"
FT                   /protein_id="ADU28514.1"
FT                   /translation="MNEKQFLKTMIETVKYDDYDYKDELLGILRNSIITYRKTNQFTKK
FT                   SWQSWEYIDLRVPVPMLKVARGLKNDFEKLAALIYIETPEYDFGGLNIKPKPVELESDE
FT                   DIEHDVVFDEIKETIVQGIRNAKYAIWVSVAWFTDNEIFEELMLRKRVGVNIRIITSNE
FT                   ESNRYLMDKLERNFEVVKVPLKGTYLSNRLHDKFCVIDFEYVMHGSYNWSKNARGNDEA
FT                   LATAIDRDFVRKFADEFMRLYVENH"
FT   gene            249681..250469
FT                   /locus_tag="Bcell_0227"
FT   CDS_pept        249681..250469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0227"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: esi:Exig_0281 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28515"
FT                   /db_xref="GOA:E6TU55"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU55"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADU28515.1"
FT                   /translation="MKQEDAVKAISQSLMKDELVKAIFLKGSMGRGEYDEYSDVDLYCF
FT                   VDEEDEDLFLTHRLKHLETYRKILFYEDFFIIAPQMIAVFDNLLHVDLFTVTEKSFKEK
FT                   DYFHVLYDPEGRLTKFQSTQNLLLSLEEFSGCAYDVAWFLFQYNKARQRGNDLWAVEML
FT                   QHVMVNFSKVLLHRYKPEKAQLGLKSLESQLPPIQLDKIKKIFMYMTPNFHKKAVYNLI
FT                   YLMSDEINWIESKVENDSQAVPFLKMMINLLIQQEEEEKN"
FT   gene            250538..250975
FT                   /locus_tag="Bcell_0228"
FT   CDS_pept        250538..250975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0228"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bwe:BcerKBAB4_5364
FT                   NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28516"
FT                   /db_xref="GOA:E6TU56"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU56"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU28516.1"
FT                   /translation="MFIVNVEGAIYKDDKWLIIERSKKEEHAGGLLSLVGGKVEQEGYT
FT                   SDILERTVKREISEEVDVTVKEKLKYVHSTSFVADSGENVVDIVFLCEYDSGKAIAKSP
FT                   DEVESVNWMTPQQVYEHPNAPDYLKVSIKKAENVKSAIVAL"
FT   gene            250995..251546
FT                   /locus_tag="Bcell_0229"
FT   CDS_pept        250995..251546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0229"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bha:BH0285
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28517"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU57"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU28517.1"
FT                   /translation="MNKNIYIIRHCEAIGQSSDSPLTERGFTQANELSDFLSNIKVKVD
FT                   RIISSPYLRAVQTIKPFAENKNMELEMDRRLTERILSSTFFPDWMDKLEATFKDMDLKY
FT                   EGGQSSNEAMNRIVEVVNDIVASDSENTIIVAHGGVISLLLNHYDKKFGFEQWKGLSNP
FT                   DVYQLRILQNNFDIKRLWND"
FT   gene            252024..252359
FT                   /locus_tag="Bcell_0230"
FT   CDS_pept        252024..252359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_2570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28518"
FT                   /db_xref="GOA:E6TU58"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU58"
FT                   /inference="similar to AA sequence:KEGG:Cbei_2570"
FT                   /protein_id="ADU28518.1"
FT                   /translation="MNNYYWIVSAIVNYVLGIVFVIPGGFLYIFILYLLEETVGWVIDP
FT                   TLEPDFLLGALFLATITGLFYFPILILINVFIYKRLLAKKYLYYLFVVFFLALGVFSYL
FT                   YYKLYLF"
FT   gene            252447..252881
FT                   /locus_tag="Bcell_0231"
FT   CDS_pept        252447..252881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcq:BCQ_3245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28519"
FT                   /db_xref="GOA:E6TU59"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU59"
FT                   /inference="similar to AA sequence:KEGG:BCQ_3245"
FT                   /protein_id="ADU28519.1"
FT                   /translation="MRNQEEDLYEYNRVKKETYKKSLLGCFLAILLIILIPIIYVGGVF
FT                   ISSVNEEQVITESTSPNNLEKITIIQKGGGFLHRGSTVILKSSNDSIKVPIHEGSSLQE
FT                   LEIHIYWENDEEATISILEGYVISFNKSNSLLEKSFKVVE"
FT   gene            252941..253273
FT                   /pseudo
FT                   /locus_tag="Bcell_0232"
FT   gene            253429..253761
FT                   /locus_tag="Bcell_0233"
FT   CDS_pept        253429..253761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0233"
FT                   /product="multidrug resistance protein"
FT                   /note="KEGG: mac:MA4621 multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28520"
FT                   /db_xref="GOA:E6TU60"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU60"
FT                   /inference="similar to AA sequence:KEGG:MA4621"
FT                   /protein_id="ADU28520.1"
FT                   /translation="MNKTAAIVGLITNLLFGYILVKYLLIVYLLFFLSFTQLIGWNLDP
FT                   TMEEGLFFPMLIISLLVTALYFIPLTLLNIKVYCILRVTKVNYIMGIVLLIIIGGIIGF
FT                   DFDKFY"
FT   gene            254004..254543
FT                   /locus_tag="Bcell_0234"
FT   CDS_pept        254004..254543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28521"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU61"
FT                   /inference="similar to AA sequence:KEGG:ABC0487"
FT                   /protein_id="ADU28521.1"
FT                   /translation="MLQIALSIIVSFSLFQTDAFQLLEKDPLEPDPHKPLGDVVSIEDA
FT                   LTEFEEIYGRMGKTPTYLPFKPTISGGNVEKSEERVRIDYLDEKSGKTLSIHIHVHPIN
FT                   IKSEKDGIYLENGTEAGIINTENIGFIFVHFVLDDLEYLIGINKDKFNNNEECIDELVK
FT                   VANSLSDKATPSAYGY"
FT   gene            254903..255640
FT                   /locus_tag="Bcell_0235"
FT   CDS_pept        254903..255640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_6196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28522"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU62"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_6196"
FT                   /protein_id="ADU28522.1"
FT                   /translation="MIVVTKDGKNKSKGWFKTVLLNDEDTDEQVIDKQETYSDKEELSI
FT                   DDMQVDETNSKQILTKENKDKMTLDLLVSLENLLNDRQLVIYNNKDLKSQLKNANETID
FT                   RLKYDLNKKEKLVEDKIEEISLLESNLTNKQMSYDQLMEDFKDYQYTSKNDYEKISNQL
FT                   DKEKNKYYKLDEELKTIQYENLIEIKSLKEKIRTLEVENQEYAEKCQKIMDEKNELRQT
FT                   INDFTERMSMSFSPKNSSSIKSE"
FT   gene            255680..256891
FT                   /locus_tag="Bcell_0236"
FT   CDS_pept        255680..256891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0236"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   gym:GYMC10_6197 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28523"
FT                   /db_xref="GOA:E6TU63"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU63"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADU28523.1"
FT                   /translation="MLAYGVKLLELLSIDKTAEKSFLKIRLVLDEEVVLFWEIDDDTAS
FT                   YLVGLTLREEGHKYRLSFHSSRNSVNNRNISWLTKTYKDNSERINFTCSDDYINQLKRI
FT                   KSIEKIKDIDALPFLTSALKEEKDEQVAEEDTLYLRRPAWRIALILSITILTVFSFSSY
FT                   KYFYNPVYGDNPKLINEYEKKEITLKKKEQRANRLSYEETKGTGYIPYIELKDLITYGL
FT                   PEGSVAITFDDGPSEYTTDIIDILNEYQVGGTFFFIGKNVIKHPSSVQYVNENGYSIGN
FT                   HGYTHMNFIKLSEEGQENELLKTNRLIEDITQERVTMFRPPYGSFNDDVIDLMGNKEMN
FT                   MVIWNVDPKDWKSPNSTKIVDHLHSSDMSGSIILLHETKMVVEALPEIIEYLQNEDLQI
FT                   VNLR"
FT   gene            257073..257447
FT                   /locus_tag="Bcell_0237"
FT   CDS_pept        257073..257447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0237"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: amt:Amet_3941 regulatory protein GntR, HTH;
FT                   PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28524"
FT                   /db_xref="GOA:E6TU64"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU64"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADU28524.1"
FT                   /translation="MSQSLHDKKPIFIQMKEKIEDQIVKGQLKEHDQIPSTTKMVQFYK
FT                   VNHITVLKGMNLLVDEGIIYKKRGVGMFVAEGAKEQLLEKRKDVFADEYVLPMIQEAEK
FT                   LGLTEKDIVDVIEKMKGEFK"
FT   gene            257444..258313
FT                   /locus_tag="Bcell_0238"
FT   CDS_pept        257444..258313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0238"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: amt:Amet_3942 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28525"
FT                   /db_xref="GOA:E6TU65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU65"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28525.1"
FT                   /translation="MTFNVKADNISLKYKDFEAVKNVSFTLEEGKTYGLIGRNGAGKTS
FT                   LLSILASFQESNSGTLTIGGENPFENRNVMPHVSFMYESDYSDEYEPVKSYFEFAERYR
FT                   PKFDRAYAEELSASFRLPLDKPIKQLSSGMQSALNATIGLASRTPVTILDEVYLAMDAP
FT                   TREVFYKEVIEEQARHPRIMILSTHLVSEMEYLFDHVLILHNGSLLINEPIDEIVSRGA
FT                   TVTGDKNIVDDFVKGMRQINTQHLGNTKAVMIYEQLSEDKYVEAQRLGLEVGPVSLQEL
FT                   FIHLTEED"
FT   gene            258320..259042
FT                   /locus_tag="Bcell_0239"
FT   CDS_pept        258320..259042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_3943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28526"
FT                   /db_xref="GOA:E6TU66"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU66"
FT                   /inference="similar to AA sequence:KEGG:Amet_3943"
FT                   /protein_id="ADU28526.1"
FT                   /translation="MTQPSNTFKVATDLFLIQMKWSLWFIPIVFAIYLIVIPLVPNLEE
FT                   LDLNFLAFQFQPSKIYMLVIGILTCFAFMSHYVKYGVTRNDYFYGAALAAIGVAISITV
FT                   TSAILAGILQFTGTFISFSPGTANMEFIHSSSTWLVPIIVYSLIIITYYIAGWLIAIGF
FT                   YRYGGFGGMGFILISITFITLIDLLWEGDPTAPMLGWLSIPFPNLSFSVAAILSGLVIV
FT                   CGMWITLLTTKRVTIKVE"
FT   gene            259388..259660
FT                   /locus_tag="Bcell_0240"
FT   CDS_pept        259388..259660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28527"
FT                   /db_xref="GOA:E6TU67"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU67"
FT                   /inference="similar to AA sequence:KEGG:GC56T3_2140"
FT                   /protein_id="ADU28527.1"
FT                   /translation="MKRLLIKASIFSAAIHVIYLLWIVGYSWFVTRNYVPDIADAYENI
FT                   AYLQNEVTFGFVIHPVYTILSFIIIAIIGALGIQFYDSFRLKRAQ"
FT   gene            complement(259707..260042)
FT                   /locus_tag="Bcell_0241"
FT   CDS_pept        complement(259707..260042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0241"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: DnaJ homologue, subfamily C, member 28,
FT                   conserved domain; KEGG: bpf:BpOF4_16820 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28528"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU68"
FT                   /inference="protein motif:PFAM:PF09350"
FT                   /protein_id="ADU28528.1"
FT                   /translation="MEEKYNDLIGDILERSGEKDNYEGKGKPLSKNYLKMDVYQNFQKI
FT                   AKDAGYLPEWVKLQKEISTLISCCQGEEDVQVINEKIKKYNKICPTQLQRRQITMNTIS
FT                   EEKNNWK"
FT   gene            260360..261043
FT                   /locus_tag="Bcell_0242"
FT   CDS_pept        260360..261043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssp:SSP0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28529"
FT                   /db_xref="GOA:E6TU69"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU69"
FT                   /inference="similar to AA sequence:KEGG:SSP0396"
FT                   /protein_id="ADU28529.1"
FT                   /translation="MYMTVEQKPRKVSNVANNLVGSLIISYVLFNMLNLYIWSNHFNVI
FT                   DVAIKPFILAPIPFICVALLTHYLKTSTLKAKILQFKSNMSQKWQAHIGLVYAVISLAL
FT                   TYKIFILFHLYVLNGHFNPVDLIIKPFLALPIAAFITMLLVKGTKYTQVRKKYVTELNN
FT                   SNQDRNENKRIAVKNLVENKATDRLIMGNFALHTPYVFNIDINIEARIGKDSFVSKVDV
FT                   LEPFP"
FT   gene            complement(261053..261706)
FT                   /locus_tag="Bcell_0243"
FT   CDS_pept        complement(261053..261706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:261644..261646,aa:Sec)
FT                   /locus_tag="Bcell_0243"
FT                   /product="Methionine sulfoxide reductase A"
FT                   /note="KEGG: pjd:Pjdr2_0219 peptide-methionine (S)-S-oxide
FT                   reductase; manually curated; PFAM: Methionine sulfoxide
FT                   reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28530"
FT                   /db_xref="GOA:E6TU70"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU70"
FT                   /inference="protein motif:PFAM:PF01625"
FT                   /protein_id="ADU28530.1"
FT                   /translation="MKNTYDIQATTIAFATFGMGUFWGPDARFGHLPGVVRTRVGYAGG
FT                   TLKDPTYRNMGDHTEVLQVQFDPTILSYKDILRLFWKHHHGFKDSFYKGRQYMSLLLYH
FT                   NQQQQQDAEEIKLEIEETHQQTLQTEVAPFSTFYVAEDYHQKYYLKRYKHVIEKLHDVF
FT                   PTDDELVNATLVARLNGFVKEHGTLADLSKEIPNWGISQSRIDELLFLLKSIKW"
FT   gene            complement(261973..262539)
FT                   /locus_tag="Bcell_0244"
FT   CDS_pept        complement(261973..262539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0244"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: gem:GM21_4072
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28531"
FT                   /db_xref="GOA:E6TU71"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU71"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADU28531.1"
FT                   /translation="MKYRESGMPEEALWENFFNPIEILKKLEVTEKVNTLIDVGCGYGT
FT                   FLIPASHIVKENVIGIDIDEHYLRVCQERVATNDKVRLITGDITDIVKSAEGDIKLADY
FT                   ITLFNILHCEDPVQLFIDAAKLIKVGGKVGVIHWINDDTPRGPSLEIRPSPNQIIKWAK
FT                   DAHLSLEKQVAFPPYHFGMLFNKIN"
FT   gene            262669..263559
FT                   /locus_tag="Bcell_0245"
FT   CDS_pept        262669..263559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0245"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: hor:Hore_05450 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28532"
FT                   /db_xref="GOA:E6TU72"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU72"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU28532.1"
FT                   /translation="MELHQLRSFYYVATYLNFSRAAEKLLVSQPAVSRQIEALERLYGL
FT                   PLFYRSKKKVELTPAGRELLTYAKKMMTLAEDAKEALLTLKNGDSGELHVGCGTTIGNF
FT                   AITALVVHFQKKYPNIHIHLDIDNTDTIINKLNERKLDVAIIAKDVDREAFNVDSLFQD
FT                   NIHLVCLAEEMQKYKQSQSLDQLENETYILRKRGSHTRECVDEYFKTMNFQPQNIIEVN
FT                   NNEAIKQAVIQKLGVGFLSSITYKIEREHQILRQIRLQKPSKREFSFIYPKGKYYSTVM
FT                   EMFHTFLKDNMSKIT"
FT   gene            complement(264090..265124)
FT                   /locus_tag="Bcell_0246"
FT   CDS_pept        complement(264090..265124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28533"
FT                   /db_xref="GOA:E6TU73"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU73"
FT                   /inference="similar to AA sequence:KEGG:Slip_1405"
FT                   /protein_id="ADU28533.1"
FT                   /translation="MSIMELIKKTIPFFISRIIVYAIFAVASLLFLGLMLGLGILLFRW
FT                   FEFASFFFILMIVGTFFAVLGILRFVERYFLYMVKVGHIAVVTELLRTGKVPEGKNQIS
FT                   YGKDQVVNNFGSANVAFVVDKIIYGAVKQIQRWLMRIGNFLSFVPAAKKIIGIISKIME
FT                   VSLRYVDEAILSYIMLRKSQIAEAAATAEEGSDSEEESVWKSACDGVVLYAQSWKKIVM
FT                   TAAGIVAFVYILNFVIFIPSVFAFMGISSAITSNAGAAAILGWFAIVGAYIVTAMIKRA
FT                   IVDPIAMIAMVRAYQLNIQNIEPNIDLQQKLLNISSKFKQLFNKRKEDTPQPPTADQGA
FT                   TSSV"
FT   gene            265609..268119
FT                   /locus_tag="Bcell_0247"
FT   CDS_pept        265609..268119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0247"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="KEGG: bce:BC2136 nitrite reductase [NAD(P)H] large
FT                   subunit; TIGRFAM: nitrite reductase [NAD(P)H], large
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28534"
FT                   /db_xref="GOA:E6TU74"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU74"
FT                   /inference="protein motif:TFAM:TIGR02374"
FT                   /protein_id="ADU28534.1"
FT                   /translation="MIYYEEGFHFRKYVNHLTNNKIECEVLHIEDGGIQVKKKLVMIGN
FT                   GMAGVRCIEEILKRESSMFDITIFGDEPYPNYNRIMLSNVLQGKTTIEDININDWNWYK
FT                   ENGVTLFTGEKVTHINRLNKQVVTDKGNTVAYDELIIATGSSAFILPVPGSDLEGVVGF
FT                   RTIDDTNYMLNTAKRYKKAVVIGGGLLGLEAARGLMDQGMDVHVVHIMPYLMEQQLDEA
FT                   AARLLKKDLEAQGMKFLMEKQTKEIYGDGRVQGISFADGSSVACDLVVMAVGIRPNIAL
FT                   AKEAGIDVNRGIIVNNHLQTSQSSIYAVGECAEHNGIAYGLVAPLYEQGVALAEHITGL
FT                   ASTGYEGSLLSTQLKVAGCDLFSAGKIKEDDETQAIIVQDQFAGVYKKVLITNNKIVGV
FT                   VLYGDASDGTRLFSMMKKETDISEFTSASILQKAGEDSEAAMIAEMSAEDTVCGCNGVK
FT                   KGTIVQSILEQDLKTFDEVKTCTKAGASCGKCKNVVEGILALTLGDSFDASAKSNGMCG
FT                   CTPLSRDEVVAEMKEKGLQSPKEVRLVLGFEQEEGCSKCRPALNYYMRMLRPEEYEDDK
FT                   ASRFVNERMEGNIQNDGTFSVIPRMYGGTTTADDLIKLGEVAKKYDVPLVKVTGASRIG
FT                   LYGVKKTDMPHIWEELGMRSGYAYSKSLRNVKSCVGSQFCRFGTQDSLGLGIQLEKALE
FT                   MVDTPHKMKMGVTGCPRNCAEVLTKDFGVVCVENGYQLYFGGNGGTEVRECDSLTTVAT
FT                   EEEVLEMAKAYVQYYRETGIYGERTSNWVERIGVEPIKEVLLNEATKQELAIHFDHAKT
FT                   TYDEAWGNMINNAKQKDMYDVVKI"
FT   gene            268143..268460
FT                   /locus_tag="Bcell_0248"
FT   CDS_pept        268143..268460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0248"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   bwe:BcerKBAB4_1989 nitrite reductase (NAD(P)H), small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28535"
FT                   /db_xref="GOA:E6TU75"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU75"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADU28535.1"
FT                   /translation="MNAIQEKVKVLELAQLPQLIGKEVEIKGESIAIFHLSNGDVRAVA
FT                   SRCPHTNGPLAEGIVAGEFVYCPLQDWKVSLVTGEVQKPDDGKVVTYETEVIDGYVYVV
FT                   V"
FT   gene            268464..269888
FT                   /locus_tag="Bcell_0249"
FT   CDS_pept        268464..269888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0249"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: bwe:BcerKBAB4_1988 bifunctional
FT                   uroporphyrinogen-III methyltransferase/uroporphyrinogen-III
FT                   synthase; TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28536"
FT                   /db_xref="GOA:E6TU76"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU76"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADU28536.1"
FT                   /translation="MTNQTGFVSFVGAGPGDSGLITNKGLKSIKKADVILYDRLVNPRL
FT                   LREAKKTCDFIYCGKLPNRHIMRQEKINETLIEQAKLGQYVVRLKGGDPSVFGRVGEEA
FT                   EALVNEGIEYEIIPGVTSSIAAAAYAGIPVTHRDYSNSFTLRTGHASVTKETVDNTYNG
FT                   QYLGETIAYYMGVKSLKTNCHTLIEQGKTPQTKVAVIEWATLGKQRVVEGTLETISDIV
FT                   ETENIKNPAMTIIGDVVSLRQKIKWFDKKKFIGKRVLVAKSSGTSFDLEDYFTGHGAEA
FT                   YSFPTVKMEEAAFTNGELTKALQSDRIIFTAPESVDTFLSSMLNHSFDIRDLPRDIQFL
FT                   SEKTRKKLMEKGIIATKAEFSEKTTAVISPSGKKIDQSLFVDSHVFRSHAWERDHRFDE
FT                   LNERILTEDNWQTVIFPNKASIDSFIAEIERLRIELKALSFAYIGESVKKYAIQCGFTH
FT                   VDQEVQNDLENNKWKR"
FT   gene            270126..270740
FT                   /locus_tag="Bcell_0250"
FT   CDS_pept        270126..270740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0250"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: transcriptional regulator, LuxR family; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28537"
FT                   /db_xref="GOA:E6TU77"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU77"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADU28537.1"
FT                   /translation="MRLLIGLDHELLRNGLVHLLKDVRQVEYMVLATSTEMFIESVQKY
FT                   EFDLIVVDADLRGAGGLRSLISILEILPHTTKKVFMYNSLHPELEELLMNKDIQGLFYE
FT                   QSPLGDLMSFFEKVLNGEQAFLNNGSPRNYREIDEEFHELSKREEEVFYMKLRGYTVKD
FT                   TAQILNISPKTVENHRRNIRKKLNIHKGSEWYDWGKKLGVI"
FT   gene            271056..272783
FT                   /locus_tag="Bcell_0251"
FT   CDS_pept        271056..272783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0251"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; KEGG: bpf:BpOF4_18455 cysteine ABC transporter
FT                   permease/ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28538"
FT                   /db_xref="GOA:E6TU78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU78"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ADU28538.1"
FT                   /translation="MKQLKEIARSQKKEMYVLLCLSILIGLVIVGQAYFIVEIVDRVFL
FT                   QGETFQAVLPFLGGLVLVLIARAIFSYANGRTGISMAAKVKKDYRRALLKKYSTNPIQA
FT                   SLKGQSGQKVSVLLDSVDEIDSYFSKYYPQMIQTSIVPLIILIAIFSQNWVSGLIMVVT
FT                   APFIPIFMIVIGSATQKKSEQQMDKLAAFSGRFLDILQGLTTLKLFGRAKKQRDVIQQS
FT                   SLDYREATMTVLKTAFLSSLALEFISMLSIALVALEVGLRLVIYGHLTFFTAFFVLILV
FT                   PEFFNSLKELGSAFHTGRGSMGAANKIHEELEEKEQPVIWGSKALDKKPVTIELRHASF
FT                   RYGESGFSLENIDATINPLSEVAIVGRSGSGKTTLLHLLSGIIPTTEGDVFVNGNKLFD
FT                   YKETDWFDELSYISQNPYLFSGTIAENIAIGGKKDATRQEIIAAAEKAGIAEMIEDLSE
FT                   GYDTKIGEAGRGLSGGEKQRVALARAFLKKPSIVLFDEPTVGLDLQTERILQRSIKELS
FT                   ETATIITVAHRLHTIKNADQILFLSDGQLLGKGTHEELLASVEEYRHMVAAQQGGNAG"
FT   gene            272780..274504
FT                   /locus_tag="Bcell_0252"
FT   CDS_pept        272780..274504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0252"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; KEGG: bpf:BpOF4_18450 cysteine ABC transporter
FT                   permease/ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28539"
FT                   /db_xref="GOA:E6TU79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU79"
FT                   /inference="protein motif:TFAM:TIGR02868"
FT                   /protein_id="ADU28539.1"
FT                   /translation="MKELNIVIKLMLVEKKDVLYSILFGFLAGIAAVSLFANSGYLISK
FT                   AAINPPLYILTVSIALLKFFSFTRALSKYAERYYSHRATFTILSNLRVKFFEKLEPLAP
FT                   KVFHKYRSGDLLARIVGDVESLQNFFLRVYYPPIIMVIVFLATIAFTTFFSVEVAVALV
FT                   VGLFITGFIIPMIFAVRQRAIENQLRSVRGSVSTEATEFLYGFRDLKLYQRLEQQEKNL
FT                   IDASNTYVDEQSKESVHALYAQSLNQTITLLVSWVILAMGAYLVSAGTLDGVFLAMLVM
FT                   ISLTVFENATPMAAFPSHFEDSRRAAGRLFTIVGEEDIDQNETVPKEKMSTNVAPAIKL
FT                   NDVTFIYPEETRPALKHLNLTIPAGSKTAIVGPSGSGKSTFMQVLLKMYTSYDGTFDVN
FT                   GVSLSKLDESSIWETSNVVLQHNHFFYGTIRDNLLLVSEDLSDAEMESALRKVQLDTFS
FT                   LYDQVLEKGENLSGGEKQRLAIARAMLKQSRLWLLDEPTSSIDVLTEAAIYHNLFEESK
FT                   EDTLVLISHRLTGLEMMDQIIVMEQGTVIEAGSFDELMEKQGYFYEMKQIEKSVFTA"
FT   gene            274930..275841
FT                   /locus_tag="Bcell_0253"
FT   CDS_pept        274930..275841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0253"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: oih:OB3303
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28540"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU80"
FT                   /inference="protein motif:PFAM:PF08378"
FT                   /protein_id="ADU28540.1"
FT                   /translation="MMLNERLKSTNHQVLAALSPRMTLPKDSYIYFNNLKKGYEGECKF
FT                   DELCEKYLPPEWFVLRNLHYTLKGTDFQIDSILISQYNLILVDIKNFENDYYIKDGNWY
FT                   TLSQHQISNPIAQKERIAILFQDLLNHFSSNLLVETYLLFINPAFTLYQAPIDSSLILP
FT                   TQINRFMKTLNEKPIKLSESHHKLAEFLLSNQTSDKKHKCIPEHRYDMLKKGITCEVCN
FT                   NFMKLSSKRSYLKCTSCGCEEKVEKAFIRNVLQYRVLFPEKAITTNNLVDWCEVLSDRT
FT                   VSGLLRSNYKFIGHGKSVQYLV"
FT   gene            complement(276708..276875)
FT                   /locus_tag="Bcell_0254"
FT   CDS_pept        complement(276708..276875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28541"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU81"
FT                   /inference="similar to AA sequence:KEGG:Bsel_2508"
FT                   /protein_id="ADU28541.1"
FT                   /translation="MDMTTFLIMVAPPLLLVACVVLVFVWATFAKEPAFVREAQEQAEL
FT                   QEDTNEASSS"
FT   sig_peptide     complement(276783..276875)
FT                   /locus_tag="Bcell_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.950 at
FT                   residue 31"
FT   gene            complement(276927..277940)
FT                   /locus_tag="Bcell_0255"
FT   CDS_pept        complement(276927..277940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0255"
FT                   /product="cytochrome bd-type quinol oxidase subunit 2-like
FT                   protein"
FT                   /note="KEGG: cytochrome bd-type quinol oxidase subunit
FT                   2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28542"
FT                   /db_xref="GOA:E6TU82"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU82"
FT                   /inference="similar to AA sequence:KEGG:Bsel_2507"
FT                   /protein_id="ADU28542.1"
FT                   /translation="MDYEIIGITVLWTFLYGYLIVASIDFGAGFFSYYTKITKKNHITH
FT                   NIIQRYLSPVWEVTNVFLVFFFIGIVGFFPSTAYYYGTALLIPGSVAIILIAIRGSYYA
FT                   FATYGAKDSNFYSFLYGATGLLIPASLSTVLTISEGGYVSVEDGKVQLLYGELFTSLYS
FT                   WGVVILAIVSVLFISASFLTYYASRAKDLDALELLRKYALVWAFPAIIMGVVVFFLLGN
FT                   QNPEHYQNMLDIWWVFAVSFINFAIATYLIWKRKNYGTAFILVMLQYFTAFYGYGISHF
FT                   PYLLYPYLTIYDGFTNETMAIALIIAFIAGLLLLIPSLYLLMRLFLFDADYVKGKK"
FT   gene            complement(277960..279315)
FT                   /locus_tag="Bcell_0256"
FT   CDS_pept        complement(277960..279315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0256"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: cytochrome bd ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28543"
FT                   /db_xref="GOA:E6TU83"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU83"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ADU28543.1"
FT                   /translation="MIEYDPVIYSRILTALTLGFHVIFATIGVGIPLMIAIAEWMGIRR
FT                   NDPHYTLMARRWARGFVITVAIGVVTGTAIGLQLTLLWPSFMQAAGHTIGLPMFMETFA
FT                   FFFEAIFLGIYLYTWDRFKSKWKHFLLVIPIVIGATASAFFITSVNSFMNVPQGFNIVD
FT                   GVLTDVSPLAAMFNPATPTKIAHVIITCYLTSAFILGAIAAYHIIKGNAHVYHKKALHL
FT                   TMVSAFVFAIGTALIGDLSGKYLHEYQPEKLAAAEWHFETEAEAPLILGGILTEDNEVK
FT                   YALEIPYALSILAGGSPDTVVVGLNDFDEEYLPPLWVHYAFDLMVFIGIYLAAVSAIFV
FT                   FINWTKKWNAFTKPLLWAVVAGGPLSMIAIEAGWFFTEVGRQPWILNGVMTVSEGATTS
FT                   QHVDILLYVFVVLYAILGVTCVVVLRRMFKTNPVERELEKRGISHTGSRIAK"
FT   gene            279729..279881
FT                   /locus_tag="Bcell_0257"
FT   CDS_pept        279729..279881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0257"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: bay:RBAM_020300 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28544"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU84"
FT                   /inference="similar to AA sequence:KEGG:RBAM_020300"
FT                   /protein_id="ADU28544.1"
FT                   /translation="MSYRDQLDQNSQKFHHNWTRYKRSKSQVNGHTEMTQTNIILRSNA
FT                   KAHRW"
FT   gene            280208..280738
FT                   /locus_tag="Bcell_0258"
FT   CDS_pept        280208..280738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0258"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: bbe:BBR47_52290 RNA polymerase ECF-type sigma
FT                   factor; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28545"
FT                   /db_xref="GOA:E6TU85"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU85"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU28545.1"
FT                   /translation="MISADRNVEITKWHEEYGVAISKYIYRMLRDYHQAEDLTQETFIK
FT                   AFRYFESFEEKSNPKTWLYSIAHNVTIDYLRKRRPLPQIEDEIMNTIDTRLLPEEIVER
FT                   NESVHILYNALENMKPSYREVIVTRRINECSIKETSEKLTWSEGKVKSTLHRAMPVLMK
FT                   ELQESGYSYEQSV"
FT   gene            complement(280911..281738)
FT                   /locus_tag="Bcell_0259"
FT   CDS_pept        complement(280911..281738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0259"
FT                   /product="arginase family enzyme"
FT                   /note="KEGG: afl:Aflv_0304 arginase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28546"
FT                   /db_xref="GOA:E6TU86"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU86"
FT                   /inference="similar to AA sequence:KEGG:Aflv_0304"
FT                   /protein_id="ADU28546.1"
FT                   /translation="MSLTSTNVTVLDFDHTYLSQKTLLQPHYQWLDFSKIHGTQGYCNL
FT                   DTLERIRNKLIQNHKNSITFLGNGNYHYISYLLIERIKQPFTLILFDNHTDTIKSSITP
FT                   YISCGSWLLHAVESLPSLQHVIIVGTRADLDKSIPNHIRNKVTMISNHHPKINCASDLA
FT                   KILFSLIKTEAAYISIDKDVLDESDAYTNWDHGIMRLSVLNEVLDTLYRLVSIIGVDIC
FT                   GEYRLDFSQVYTQKAQQATFINEKANEQILKVVNQFSKRIQEKTKNELSKARF"
FT   gene            complement(281888..282328)
FT                   /locus_tag="Bcell_0260"
FT   CDS_pept        complement(281888..282328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28547"
FT                   /db_xref="GOA:E6TU87"
FT                   /db_xref="InterPro:IPR025273"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU87"
FT                   /inference="similar to AA sequence:KEGG:BPUM_3619"
FT                   /protein_id="ADU28547.1"
FT                   /translation="MKRTGEIVLGVIGAIGYAFFTVAGFFFLWLQNQDEFMGELSAELQ
FT                   ADDELSAAEVDAVLGFLDGGFLSSSGIFLIILSVVAIVLGIVAMVLLKGNNKPKVSGLL
FT                   FIITSVVAAIATLGAGIFPGIFYLIAGIMCFARKPKEPIESY"
FT   gene            complement(282472..283548)
FT                   /locus_tag="Bcell_0261"
FT   CDS_pept        complement(282472..283548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC00600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28548"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU88"
FT                   /inference="similar to AA sequence:KEGG:CTC00600"
FT                   /protein_id="ADU28548.1"
FT                   /translation="MKNMTLLIGLITIALIGAGCTSSQVGVSADELYSNILSTNDDFFA
FT                   YYAEGEMTFHYGDGLSEKATFKEHVSQEGKRKVITIDNATNQQSIAVNDGFDLYFYEEA
FT                   NDTAIKIDLSDEAIPTLTHREQVTSMLENMKDTHYYEVKGEVVVNGIDTYHMVLTAKES
FT                   NLLIGDIELWVDKKTWFMVKGISVAGDITTTIEYKEIDFSPQFDDDTFTIDLPSHITFT
FT                   EVNDTLNESIKIIDSISDAEEIVQTPFYLFDEEDLSLLSIESYSLSGEIQEEVTLYYWK
FT                   NDIPYLSLSVAPTYNEDAYLGGEKVTIRGSIVAEYLESLRYLIWDENNIQYSISILHPD
FT                   VELDDIIQLVNEMKLSND"
FT   sig_peptide     complement(283459..283548)
FT                   /locus_tag="Bcell_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.441 at
FT                   residue 30"
FT   gene            complement(283545..285017)
FT                   /locus_tag="Bcell_0262"
FT   CDS_pept        complement(283545..285017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0262"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: ctc:CTC00598 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28549"
FT                   /db_xref="GOA:E6TU89"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU89"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU28549.1"
FT                   /translation="MKIKTWLMISYFIVMILPITTIYALYITISSYDKEQDLENYLDVL
FT                   QTFSNLEPILNNASLYQLQPMTNYEHIQKMGSDSLQINLYRPDGVQLFSTLNSPSTNTP
FT                   LFASTTEVYQNLNEIQKNYRTYSLKKPVFENGELAGIYEMKLARDEWLEGVSNRTLTLF
FT                   TLFSFFFILTYAVVIFLLNRKLNRPLQLLHARMTDFAKEKEISPLKTIPKDEIGELMGH
FT                   FEEMRVEIEGTKKELLNHQKEKDFIVASLSHDLKTPLTVVRAYNEALLYGQLSPRERNE
FT                   YKQVLFEKLDFMSQMLDDLVTYNSLQSTRNHSEFKVVDGEEFFDMLLSGYEESAASKDI
FT                   QLHTHYDVESKYKVNPKQMIRLVDNVMTNGLRHTPQMKSLWIGAYKQTSPLPKWVFPSL
FT                   IKKVDEWRKGGTVILVQNEGSFIDSENVDYLFQPFVQGETARSQSGSSGLGLSIAKMII
FT                   EQHGGKIMLWSEKPHGTLIACWLQEIEGDDYR"
FT   gene            complement(285014..285724)
FT                   /locus_tag="Bcell_0263"
FT   CDS_pept        complement(285014..285724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0263"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cno:NT01CX_1324 two-component response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28550"
FT                   /db_xref="GOA:E6TU90"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU90"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU28550.1"
FT                   /translation="MSHTRNILIVEDDKDIARIVVDHLRKEGFHVTWASTGMEGLEDFK
FT                   QNSFDLVLVDLMLPEMDGFTLCKTIRLESNVPLLIISAKQEDASKIRGLDLGADDYLTK
FT                   PFSLIELSARIHSHLRRYDRYLHQHEAQPMIDFLHGLSIDFLKKNVYLNGKPLLLTTKE
FT                   LDLLLLLAKNPCQTFSKTELYEHIWQQSSLDGNNTVTVHIKGLRTKLQDNSRTSKFIQT
FT                   VWGEGYRFIGEVIQ"
FT   gene            285933..286622
FT                   /locus_tag="Bcell_0264"
FT   CDS_pept        285933..286622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28551"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU91"
FT                   /inference="similar to AA sequence:KEGG:Bsel_2584"
FT                   /protein_id="ADU28551.1"
FT                   /translation="MRISNKIYLFFSFLVVFSLLLGTSAFAEQEPITREKLEEWEEQGI
FT                   DPNHTEVSENLLEYVNEHLSDIFASMHIDRSERELGVLVFSFIEPVSEEHASAMKQLVS
FT                   SPAEVELRQVQYKEAELNAKTAEIDLNQFQEAGISIYRVGPDVTHNRVEIAIEPYNEEN
FT                   ARMIYDYYGSEMIHVVEGEQPMLLLTEQEIEESNTDEVGEVELKEEKSTISTFFSSIVD
FT                   WFRNLFK"
FT   sig_peptide     285933..286016
FT                   /locus_tag="Bcell_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            286878..287489
FT                   /locus_tag="Bcell_0265"
FT   CDS_pept        286878..287489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0265"
FT                   /product="flavoprotein WrbA"
FT                   /note="KEGG: bpf:BpOF4_18640 multimeric flavodoxin WrbA;
FT                   TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric oxide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28552"
FT                   /db_xref="GOA:E6TU92"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU92"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ADU28552.1"
FT                   /translation="MSNINVAIVYYSSTGTNYQLAQWAKEGAQELGAAAKVLKVPELAP
FT                   EAAIEQNPAWKAHMEETKDVPEVTLDDLENADAIIFSVPTRFGNVPGQMKQFLDTTGGL
FT                   WFNGKLANKAVSAMSSASNAHGGQEATILALYNTMYHWGAIVVAPGYTDPVAFESGGNP
FT                   YGTSVTVSQDGKMQEDVEKAVKHQARRTVEVAQWIQHGTK"
FT   gene            complement(287628..288278)
FT                   /locus_tag="Bcell_0266"
FT   CDS_pept        complement(287628..288278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0266"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28553"
FT                   /db_xref="GOA:E6TU93"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU93"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADU28553.1"
FT                   /translation="MLKKRLMNLSIFIIAILVSGYVVYDYILKESSRNDQRIEEYLSTG
FT                   GIENRDEEVSYSESEEIGPYPGRIAPNFTLPSWDESSEISLHDYRGNFVIMNAWASWCG
FT                   PCKDEIPYLIDFHENYAEEDVEVLGVNLTNTETSKSSAIAFINDFNIPYDIAMDVEGFV
FT                   EKEYLIVSLPMTFVIDPDGRTIIRKVGYMNYEQIIALYEEAQEIYYNEGDSKG"
FT   gene            complement(288368..288931)
FT                   /locus_tag="Bcell_0267"
FT   CDS_pept        complement(288368..288931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0267"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: bsaA; glutathione peroxidase; PFAM:
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28554"
FT                   /db_xref="GOA:E6TU94"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU94"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADU28554.1"
FT                   /translation="MSIYHYSAVAMNGKDKSLREYKGKVVLIVNTAGRCGFTYQYKDLQ
FT                   RLYDRYKDKGFVILGFPCNQFDHQEPDSNDQIQTSCMLNYGVSFPLFQKTDVRGNDAHP
FT                   LFNYLTGQKNFKGFNEMHPVSKILLPLINEKHPEYLSDNYSIKWNFTKFLIDPEGNVVD
FT                   RFECTTDPIDIERDIESLLQQVTA"
FT   gene            complement(289042..290289)
FT                   /locus_tag="Bcell_0268"
FT   CDS_pept        complement(289042..290289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0268"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   bpf:BpOF4_16840 hemolysin related protein containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28555"
FT                   /db_xref="GOA:E6TU95"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU95"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADU28555.1"
FT                   /translation="MEQIPIYLILLLFLLLIMSAFFSSAETAYSSANRIRLKTMMDENN
FT                   KGAQRAYSILHNFDQALSTILVGNNLVNIAAATISAQVATAIFGPNLGVFVSTFVMTVL
FT                   VLIFGEILPKSYAKEFAETFSSKISWILLVLIKFLSPITWVFLQLKIFVSKLIKKEKTA
FT                   PSVTEEELKELISISEEEGVIDESERELVHRSLDFNDIIVAEIVTPRMDIVAIDVNNTV
FT                   DEIKNTFIKERYSRIPVYEGNIDNIIGILSERDFLKAYIQLEYDVDIRKLLRDPVFVFE
FT                   SMRIHTLLPQLQKNKGHMAIVIDEYGGTEGLITLEDILEEIVGEIWDEHDEDINLLKQV
FT                   DPSTLIVHADCPLDDFVRKTKIELPDTPYHTIGGWLSEVFQRIPSVNEEVQYEHISLKI
FT                   IDADERRIRAIEVSLN"
FT   sig_peptide     complement(290212..290289)
FT                   /locus_tag="Bcell_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.912 at
FT                   residue 26"
FT   gene            290521..290994
FT                   /locus_tag="Bcell_0269"
FT   CDS_pept        290521..290994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0269"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: gym:GYMC10_0156
FT                   coat F domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28556"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU96"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADU28556.1"
FT                   /translation="MSQGHLAWHETLEIHELVAAQSIGLMKMKKAIKDINNQELHGIYE
FT                   SAIKGVTNNLMELIAFYPDMPRAESTMTEKELEGLYAGDLLTFSKMSVRNYAIAITEAA
FT                   TPEVRKVFQKHLNNAIDLHGKVFNYMYKTGKYPAYDLDKLLKNDLQLARKALK"
FT   gene            291289..291522
FT                   /locus_tag="Bcell_0270"
FT   CDS_pept        291289..291522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28557"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU97"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1481"
FT                   /protein_id="ADU28557.1"
FT                   /translation="MSTTKKGKTFAADQKTLTNTPERREFTVASDISSENPFKSNAYYP
FT                   GDSVNEHKELEKANLDIAEDELRQQNENNSLD"
FT   gene            291636..292364
FT                   /locus_tag="Bcell_0271"
FT   CDS_pept        291636..292364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0271"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: sporulation protein, yteA family; KEGG:
FT                   afl:Aflv_0378 DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28558"
FT                   /db_xref="GOA:E6TU98"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR014240"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU98"
FT                   /inference="protein motif:TFAM:TIGR02890"
FT                   /protein_id="ADU28558.1"
FT                   /translation="MLTNDQINALKKELMQMKEEQLTRLNGQHYGLELELLKESVGELS
FT                   NYDNHPGDQGTELYEREKDIALNEHSEQLLDEIDNALKAIEEGSYGKCEVCGTDIPYER
FT                   LEAIPNARRCIQHAEEKSVSNKRPVEEDVIAPAFGEFEYDESVRNETFFDAEDAWQTVS
FT                   IYGSSETPSDFLNVDNKDYNNMFVESEEPIGIVEDIEGILTADIEGNYSGPSVDHKEYE
FT                   QYLDENDVTSVLDGNKKEEE"
FT   gene            292548..292895
FT                   /locus_tag="Bcell_0272"
FT   CDS_pept        292548..292895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0272"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: bha:BH3000 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28559"
FT                   /db_xref="GOA:E6TU99"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TU99"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU28559.1"
FT                   /translation="MTILNKLDIEQGAKILKLLGDNTRLNIVTLLMEDECCVCELVEIL
FT                   QMSQPSISQHVAKLKSFNIITERRKGQWIFYKINTSAEIYPLIDSIVSHFPEQNDRIKA
FT                   LEEKGLRVCCN"
FT   gene            292955..294028
FT                   /locus_tag="Bcell_0273"
FT   CDS_pept        292955..294028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0273"
FT                   /product="arsenical-resistance protein"
FT                   /note="KEGG: aoe:Clos_1114 arsenical-resistance protein;
FT                   TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28560"
FT                   /db_xref="GOA:E6TUA0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUA0"
FT                   /inference="protein motif:TFAM:TIGR00832"
FT                   /protein_id="ADU28560.1"
FT                   /translation="MGNEQAQGQGLSFFERYLTIWVAVCIIVGIAIGQLMPAVPNTLDE
FT                   WKISEISIPVAILIWLMIFPMMAKIDFSSIVNAGKKPKGLVITLVVNWLIKPFTMFFFA
FT                   WLFFRFIFSPFIPETLATEYIAGAVLLGAAPCTAMVFVWSYLTKGDAGYTLIQVSVNDL
FT                   ILIFAYGPIVALLLRVNNVIVPLDTVFLSVLLFIVIPLAAGYISRVILVKRKGMDWFQN
FT                   VFLKKAGNFTIIGLLLTLVILFSFQGDVILNNPFHIGLIAVPLIIQTLFIFVIAYLWAK
FT                   WWRIKHSIAAPAAMIGTSNFFELAVAVAIALFGLNSGAALVTVVGVLVEVPLMLYLVKI
FT                   ANKTKHWFPESSVVKHG"
FT   gene            294101..294514
FT                   /locus_tag="Bcell_0274"
FT   CDS_pept        294101..294514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0274"
FT                   /product="arsenate reductase (thioredoxin)"
FT                   /EC_number="3.1.3.48"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; TIGRFAM: arsenate reductase (thioredoxin); KEGG:
FT                   bpf:BpOF4_02675 arsenate reductase; PFAM: Protein-tyrosine
FT                   phosphatase, low molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28561"
FT                   /db_xref="GOA:E6TUX8"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUX8"
FT                   /inference="protein motif:TFAM:TIGR02691"
FT                   /protein_id="ADU28561.1"
FT                   /translation="MTKPIIYFLCTGNSCRSQMAEAWGKAYLGEKYDVYSAGIEAHGVN
FT                   PKAVQAMKEVDIDITDQTSDTIDQELLQKADLVVTLCGHANDVCPATPPNKERVHWGFD
FT                   DPAKAEGTDEEKWAVFQRVRDEIGARIKRFAEE"
FT   gene            complement(295011..295577)
FT                   /locus_tag="Bcell_0275"
FT   CDS_pept        complement(295011..295577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0275"
FT                   /product="Conserved hypothetical protein CHP00730"
FT                   /note="PFAM: Conserved hypothetical protein CHP00730; KEGG:
FT                   bha:BH2746 lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28562"
FT                   /db_xref="GOA:E6TUX9"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUX9"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADU28562.1"
FT                   /translation="MIKKICVFCGSSFGGNNIYLKEVVALGKSLAENNIELVYGGGHSG
FT                   LMGALAKSVIDHSGQVTGVIPQKIYDQVEHIELTHLHIVETMHERKHKMYDLADAFIAL
FT                   PGGIGTLEELAEIMTWQQIGYHEKPVGVFNINDFYEPFQHLLSHMIKEGFLKKDFIDQL
FT                   VVENSLHDLLDKISSYEPLKHNKWN"
FT   gene            295701..296642
FT                   /locus_tag="Bcell_0276"
FT   CDS_pept        295701..296642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0276"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   bpf:BpOF4_18100 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28563"
FT                   /db_xref="GOA:E6TUY0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY0"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADU28563.1"
FT                   /translation="MHTFEKLYTLFITFSALFGLLLGRYDFIRENANDIIVPALVMMLF
FT                   ITFLQISFKETIHAMKNTKFTVTSLGINFIWTPLLAGLLAYIFLYDHPALWIGFILLMV
FT                   TPCTDWYLIFTSIARGNVPLSTAVLPINFIVQVLLLPIFLIIFAGTTGFIQMTTIVQSI
FT                   LFVLCLPLLMAYIVKRLTRKRQVLYDNINAKLSSLPVVFLCIAIMAMFASEGYLLFQNL
FT                   ELLAVLLIPVTLFFIINFYMSQLIGKKLNFNRADRVSLVLTTLARNSPIALALAIVAFP
FT                   AEPLIPLTLIIGPLLELPILMLATQLLLKNGK"
FT   gene            297202..298422
FT                   /locus_tag="Bcell_0277"
FT   CDS_pept        297202..298422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0277"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   pjd:Pjdr2_2154 N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28564"
FT                   /db_xref="GOA:E6TUY1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR028584"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY1"
FT                   /inference="protein motif:PFAM:PF07221"
FT                   /protein_id="ADU28564.1"
FT                   /translation="MDKTLLYRAKQEIEKELTDRILPFWKKRVIDGSGDGFHGYIDYHL
FT                   TIDHDSEKGCILHSRILWSFSAAYRKYKNDTDLQVATRAFNYLKNYLIDDEFGGLYWSV
FT                   TNEGELNDTRKHIYNQAFGIYGLVEYFRATNNEEALQLAKEIYQLIEMHGFDEENKGYL
FT                   EAFSRQWEKDEDLRLSDKDMDVEKTMNTHLHILEAYTNLYRVWKDDVFKEKFELLFDVV
FT                   AEKVLNEKTGHYSLFFDAGWKKESDVISYGHDIEGSWLMTEAAEVLGCKVRQNKMKTMA
FT                   IKMVDACIEEGLENDGSLINEKDSNDVDATRVWWVQAESLVGFLNAYELSGEERYLKHF
FT                   HNSWEYIKKYVIDDKHGEWYWELDQDNNVNKEKPIVEPWKGPYHNSRACMEAVERITKI
FT                   TNNYIDR"
FT   gene            298437..299639
FT                   /locus_tag="Bcell_0278"
FT   CDS_pept        298437..299639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0278"
FT                   /product="glycosidase related protein"
FT                   /note="PFAM: glycosidase related protein; KEGG:
FT                   pjd:Pjdr2_2155 glycosidase PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28565"
FT                   /db_xref="GOA:E6TUY2"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR028583"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY2"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADU28565.1"
FT                   /translation="MENVFQARMKAVHERYKETIQRENKKLENGNGIYDRYEHPILTKE
FT                   HVPPYWIYDYNEETNPYFMERLGMNVVFNPGAIYLNGKFHLVARVEGVDRKSFFAVAES
FT                   DNGIDGFKFWDYPVTLPDTNEDEVNVYDMRLVQHEDGYIYGLFCSERKDKSAPPGDTSS
FT                   AIAQCGIVRTKDLKTWERLNDLETKSAQQRNVVLHPEFVNGKYAFYTRPQDDFIEAGTG
FT                   GGIGWGLSDSIEKAKIDEELIVDPKEYHTIKEVKNGQGDAPIKTDKGWLHVAHGVRNTA
FT                   AGLRYTIYVFLTDLNEPWKVTHRPGGHFIAPEGIERVGDVSNVVFTNGLIEKDGEVFIY
FT                   YASSDTRCHVATTTIDRLLDYATNTPEDKLRSTYSVEQRKELIGNNLSLFEKNPELDPR
FT                   N"
FT   gene            300179..300688
FT                   /locus_tag="Bcell_0279"
FT   CDS_pept        300179..300688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0279"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcy:Bcer98_2006 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28566"
FT                   /db_xref="GOA:E6TUY3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU28566.1"
FT                   /translation="MEEIVIRQLEESDAAEFLDIRLNALKSNPEAFATTYKELMDSGNP
FT                   LEQLKKQLKSDQSFTYGAFINKQLVAIATIRLYAIEKMKHKGMLLGMFVSDQTRGLGVG
FT                   KRLMQEVVKEARKIGLEQIQLMVVTTNKAGKAFYESLGFETYGIENNAMKYNGEYWDEE
FT                   LMVLFL"
FT   gene            300970..301821
FT                   /locus_tag="Bcell_0280"
FT   CDS_pept        300970..301821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0280"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bha:BH2190 manganese-containing catalase;
FT                   PFAM: manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28567"
FT                   /db_xref="GOA:E6TUY4"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY4"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADU28567.1"
FT                   /translation="MFYHIKELQYDAKPTRPDPVFAKQLQEVLGGHFGEISVALQYLFQ
FT                   GWNARGDEKYRDLLMDVGTEELAHVEMLATMIARLLDGASLGDQEDAAKNPVVGAIMGG
FT                   MNPQHVIVSGLGAMPADSVGNPWTASYIKASGNLLADFRLNLTYESQGRLQVTRLYNST
FT                   NDPGVKDMLSFLIARDTMHQNMWEAAISELEAQENIVVPSTFPKHLEKNEVAYDFYNLS
FT                   EGEQSSRGRWAKGKSMDGLDKFKYYSKAPAYGEKPFLKPAPKHIHNTLPTIRSEQDEGE
FT                   NE"
FT   gene            302186..304645
FT                   /locus_tag="Bcell_0281"
FT   CDS_pept        302186..304645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0281"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: pjd:Pjdr2_5065 glycoside hydrolase family 2 sugar
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28568"
FT                   /db_xref="GOA:E6TUY5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="InterPro:IPR041625"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY5"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADU28568.1"
FT                   /translation="MQRITLNGDWDFRKVGENEWLVGKVPGSVYNDLLQHKKMEDPFYR
FT                   DNEDAVKKLSEFDYEYKRSFQVDSSFLENDSQLLIFEGVDTLSKIFINDTLVNETNNMH
FT                   RRYELDVKGIVQEGENDIKVVLLSPLQYVEKKHNENPIWGVTDAVEGFPHLRKGHSMFG
FT                   WDWGPQLPDLGIWRNVSLEGYSKAKLQDVYVTQKHDDHVVELSVAIEKVQFSTDTTTVF
FT                   TKVYDPDGNLLEESANTSENNNIHETFTIPNPQKWYPAQYGEQPLYLVEVEVVVNGKKV
FT                   DTKSLQIGLRTIDIVQEDDEWGQSFYFKINGTPIFSKGANYIPEDNILARTSREKTERL
FT                   IKDCVAANFNMIRVWGGGHYPEDYFFELCDQHGLIVWQDFMFACAVYDLSEEFEATVKQ
FT                   EFIDNIKRIRHHASLGIWCGNNEMESAWVDWDFPKTEKHKLDYLKLFEEIIPEIVKEYD
FT                   PQTFYWPSSPSSGGGFDKPSDENIGDVHYWDVWHGLKPFTEYRKFYYRFVSEFGFQSFP
FT                   SLKTIKSFTLPEDRNIFSYVMEKHQKNGTANGKILYYLSENFKYPKDFHSLLYTSQILQ
FT                   AEAIKYGVEHWRRNFGRCMGAIYWQLNDCWPVASWASIDYYGRWKALHYFAKRFFSMTL
FT                   ISAKESATGAEIVVTNDYEKAFRGKVKWALRTNSSEVVKQGEEEVIVDGVCAKSIVHLD
FT                   FSKELKEVNRKSYLEYQLIDEHGSNISNGTVLFVPAKHFEFLNPELDLHVEDKNDRFIL
FT                   SVSAKAYAKYVEIDHQELDFILSDNYFDISAGEEVKVELIKEPSLSNISKEHLLNGLTI
FT                   RSLYNTY"
FT   gene            304666..306030
FT                   /locus_tag="Bcell_0282"
FT   CDS_pept        304666..306030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0282"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: bpf:BpOF4_18015
FT                   beta-glucosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28569"
FT                   /db_xref="GOA:E6TUY6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY6"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ADU28569.1"
FT                   /translation="MAIIQFPKDMRWGTATASYQIEGAANIDGRGPSIWDTFSKTPGKV
FT                   LNGDNGDVACDSYHRYKEDVAIMKDLGITTYRFSFAWPRVIPNGTGEVNQLGLDFYHNF
FT                   IDELIANDIEPMATLYHWDLPQALQDKGGWGSRETIDAFVEYAELMFKEFNGKIKYWIT
FT                   FNEPWCASFLSHYGGEHAPGFTDLQLGMDAAHHMLVSHGKAVQKYRELGVKGGQIGYAP
FT                   NVEWNEPYSNKQEDIDACRRAGGFFIEWFMDPVFKGSYPQFMLDWFKEKEGVEPPIQDG
FT                   DLEIISQPIDFLGINYYTGSVGRYVEDQAAQQHSLFNHERVDQGYQKTDIGWNVYPEGF
FT                   YNVLKYVTDLYGQVPIYITENGSCYNDEPENGVVKDDKRIDYLRQHLTALRRAMDSGVN
FT                   IKGYMTWSLLDNFEWAWGYSMRFGIVHVNYRTLERTKKDSFYWYKQTVANNFFEV"
FT   gene            306192..307025
FT                   /locus_tag="Bcell_0283"
FT   CDS_pept        306192..307025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0283"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; KEGG: xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28570"
FT                   /db_xref="GOA:E6TUY7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY7"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADU28570.1"
FT                   /translation="MRLGGPVFFKNHDAESWAEAVKVEGYRAALCPVNYEDGEETINAY
FT                   KRSAIKNDIVIAEVGAWSNPISPDDEMRRSAIEHCKRQLELAEMLEAKCCVNIAGSRGE
FT                   QWDGPHVDNFSDDTFTLIVDTVREIIDAVQPKHTFYTLEMMPWVYPDSSDTYLALIKAI
FT                   ERDAFAVHYDPVNIITSPRNYYNNKNMIRDFFKKLSPYIKNCHAKDINLLGKLTVHLEE
FT                   VIPGKGLLHYQTLLTELNKLDKDTPLIIEHLSTEAEYREAANYIRSVANTMNIDL"
FT   gene            complement(307113..307553)
FT                   /locus_tag="Bcell_0284"
FT   CDS_pept        complement(307113..307553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0284"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   bay:RBAM_027660 Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28571"
FT                   /db_xref="GOA:E6TUY8"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY8"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADU28571.1"
FT                   /translation="MNERKLYEALNLHLANWNIIGSKLRQFHWFVKGPDFFTLHEKFEE
FT                   LYNEATSYVDEIAERHLSIGGTPISTLREFIDNASIEEVDGNLHAKEMVANVTDDFTLM
FT                   TEELNDAIFIAEENNDHVTADLFISMKASVEKHIWMLKAYLS"
FT   gene            307759..310047
FT                   /locus_tag="Bcell_0285"
FT   CDS_pept        307759..310047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0285"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; CHASE4 domain
FT                   protein; histidine kinase HAMP region domain protein; KEGG:
FT                   eat:EAT1b_2235 diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28572"
FT                   /db_xref="GOA:E6TUY9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUY9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU28572.1"
FT                   /translation="MKLKVKTAIVILSSVFTLLVILFISINPIMLSQYKQLELELVEQN
FT                   NERVKSALNNELNRLKMIVRDYSVWDDTYQYMQDGNEQYINSNWVEDTFNTNNINFVVY
FT                   ISEEGELLYDQGYDAVTDSSVHIEELLDWEELQPFIFEQNSVIILGHEHPIFVASHQIY
FT                   PSLQNAPANGVLLMGSVIDSTVVEALSATTQLPLELSLSQQYEESTVKLLNDELIQGNY
FT                   FFPIEGTSLEGNLSFTLDRDVYQSGRRGLIGFFTLYALISLCLTAICIYSLDKFILSRF
FT                   TTLSDQLKEIQQSRDLNKRIVVSGNDEISSLKRAINHMLYALFQSQTEIQKLALTDELT
FT                   GLSNRNDFRSRFEVMVKAEAQQRIAILFIDIDLFKRINDALGHYVGDTVIKETSKKLKE
FT                   NIPPDAIVGRWGGDEFIVALPFEEEREVVTLSKQLLLDIARPIVMKGYTFEITSSIGIS
FT                   TAPNDAKEPEDLIRQADIAMYEAKRHGKNQYRFYQDVAKYAYFNHYVSLENDLRYALQN
FT                   NEFNIYYQPIMNADGNVLGVEALLRWENRDKGMIPPDKFIPVAEELGMMPFIGKWVLKE
FT                   SIRQVKRWHELGYEDISLSVNVSKTQLVSNDFCSIVKTTLEECDFPPELLVLEITESDV
FT                   AIYMEKLTLASKVLTEMGVKISLDDFGMGASSLHYLKEIFVDQLKIDRSFVNGIPSDSF
FT                   DSALLSGIVTLCKKLKIEVVAEGIETEEQYIYLKEDNISLQGYYFSKPLPKDEVEMFII
FT                   EKNNSIENR"
FT   gene            310391..311335
FT                   /locus_tag="Bcell_0286"
FT   CDS_pept        310391..311335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0286"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tpd:Teth39_2154 ROK
FT                   family glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28573"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADU28573.1"
FT                   /translation="MYIIGIDIGGTNMRVGLFKDGNMIKKTSVFTRTEEGVVAIITRLK
FT                   QLIVNVLEQANIEMGQVKGIGVGCPGPLDPWKGEIQSPPNLPGWDHIPLKKILEEEYSL
FT                   PVFLHNDANAAALGEYTFAYNRNVNNLVYITVSTGVGGGVVADGRLLLGVNGSAAEIGH
FT                   MIINPNGNLCSCGNRGCLEAQASGTGIVSKTKALLQTTKEASVLKGKSKLTSKDVFVAA
FT                   ENGDALCKRIIEEVQFDLALGLTNIVHAYNPEMVVYGGGVMQAGESFIKPVIEKAEKMI
FT                   LPGMKGRLTFAATKLGGELGLYGAAALVDYFQE"
FT   gene            311457..311789
FT                   /locus_tag="Bcell_0287"
FT   CDS_pept        311457..311789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0838 membrane-associated Zn-dependent
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28574"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ1"
FT                   /inference="similar to AA sequence:KEGG:IL0838"
FT                   /protein_id="ADU28574.1"
FT                   /translation="MKRYMMIGAAVIILAFFSWFSFGQGLPHEHRVAADHAIDFIASEH
FT                   ALSKEAIKLDGIRYWEEEDRFSLNILDESEDKMYQIALRVAEDDELAFILDVTGQFDDF
FT                   GLAYCH"
FT   sig_peptide     311457..311528
FT                   /locus_tag="Bcell_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            312119..312571
FT                   /locus_tag="Bcell_0288"
FT   CDS_pept        312119..312571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0288"
FT                   /product="regulatory protein MarR"
FT                   /note="KEGG: bpf:BpOF4_15070 hypothetical protein; PFAM:
FT                   regulatory protein MarR; SMART: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28575"
FT                   /db_xref="GOA:E6TUZ2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU28575.1"
FT                   /translation="MSRREMDQMFGYHIGVLSHLIQNQYNKNLSQFDLTISQAKVLYLL
FT                   SHDGDKLQSELQKRLFIQASTMNGIIDSMLKRALIEKRDSQEDRRSKVISLTEKGISIE
FT                   RELWVNLDHMERELLAGFSIEEQQLLMMWLKRMKENMQEVDRDKTT"
FT   gene            312587..313987
FT                   /locus_tag="Bcell_0289"
FT   CDS_pept        312587..313987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0289"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: MATE efflux family protein; TIGRFAM: MATE
FT                   efflux family protein; PFAM: multi antimicrobial extrusion
FT                   protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28576"
FT                   /db_xref="GOA:E6TUZ3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ3"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADU28576.1"
FT                   /translation="MDQKQQSERLGTEPISKLLRRLSIPAMIGMFVMALYNVVDTIFIS
FT                   YFVGITGVAAVTIAFPLMMIMMAIAAALGVGGASVISRRLGERREEDANKVFGNILLLV
FT                   IVVSIFGMIGAFTFLDQLLYLFGATDNIIGPARDYMLPIMLGTFFFSFGFTTNAIIRSE
FT                   GNARFAMMMMIIPSILNILLDPIFIVVLDMGVQGAAIATVISQAFVTIYVLRYFISGKS
FT                   TLTISIANMKPHFALIKEVITVGLPAFFRQVAGSVMMIAINAMLIQFGSEFHVGVFGIV
FT                   QRVLMFTLMPMMGILQGMQPMIGYNYGAKNITRLQDTIWLGLKVVTVYSAIVFVVVMTI
FT                   PELFMRIFTSDQEVIQSGAEGMRIMFAAAILIGAQVVSGGLYQALGKAKPALILSMARQ
FT                   VLFLIPLVLILPHFFGVKGVWIAFPIADILSFALSAAFLYRDRKLFFIKSKDNSDHDTL
FT                   GTERVVSS"
FT   gene            complement(313993..314139)
FT                   /locus_tag="Bcell_0290"
FT   CDS_pept        complement(313993..314139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28577"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ4"
FT                   /inference="similar to AA sequence:KEGG:bll2660"
FT                   /protein_id="ADU28577.1"
FT                   /translation="MMKKESFSLMTSGLLLIGSIFFLIGSGLSFFKALDSYNGRVNGNS
FT                   MLD"
FT   sig_peptide     complement(314062..314139)
FT                   /locus_tag="Bcell_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.618 at
FT                   residue 26"
FT   gene            complement(315012..315434)
FT                   /locus_tag="Bcell_0291"
FT   CDS_pept        complement(315012..315434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0291"
FT                   /product="UspA domain-containing protein"
FT                   /note="PFAM: UspA domain-containing protein; KEGG: UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28578"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ5"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADU28578.1"
FT                   /translation="MFSHLLLAIDGSDHSRRAAEKAIELGKLTDHATIEILYVVDGSKS
FT                   KSDILKYGDSEAASKNRQQMLHSFEELINDAGISTKITILHAGTPAESIIKHANEGNYD
FT                   CVVLGSRGLSTVQTMIIGSVSHKVMKYAKAPVLMVK"
FT   gene            complement(315572..317035)
FT                   /locus_tag="Bcell_0292"
FT   CDS_pept        complement(315572..317035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0292"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28579"
FT                   /db_xref="GOA:E6TUZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ6"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ADU28579.1"
FT                   /translation="MNFTQKLKKEWLGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPM
FT                   VGLYASFCIAVVIAFVGGRPGMISAATGAMALLMITLVADHGLEYLLAATILCGILQIL
FT                   FGVFKLATFMKFIPRSVMVGFVNALAILIFTAQLQHFVDETWVMYALVALTLAIIYILP
FT                   RFTKAVPSTLVAIIVVTAIALIMNIGVRTVGDMGELTQTLPVFALPNIPLTFETLMIIF
FT                   PYSLALAIVGLLESLLTASIVDDMTDTESNKNKESRGQGIANVITGCFGGMAGCAMIGQ
FT                   SVINVKSGGRGRLSALVAGAFLMFLIIVLGNIVVQIPMAALAGVMIMVSIGTFDWRSLT
FT                   NIHKIPRTDAAVMIVTVGTVVYTHDLAQGVLAGVVLSAIFFAWKISKVKIKSVLSNDKL
FT                   ERTYYVEGQLFFASVTDFLDKVNYNEDIEKVIIDVSKAHLWDDSAVGAIDKIEGKFEQK
FT                   SIKVEIKGLNEESSVLLKKIGGLSKASEH"
FT   gene            317959..318246
FT                   /locus_tag="Bcell_0293"
FT   CDS_pept        317959..318246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_01125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28580"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ7"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_01125"
FT                   /protein_id="ADU28580.1"
FT                   /translation="MKGQQDLINIFVDKVLEKHNVKPETAELKDDEKKRVRDIIENIQE
FT                   DVSRFLENYEKQTTEHDVQEEQTAEASEQGDATIQKPTTKPKIFYNKDEN"
FT   gene            318335..318796
FT                   /locus_tag="Bcell_0294"
FT   CDS_pept        318335..318796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0294"
FT                   /product="Spore coat protein X/V"
FT                   /note="PFAM: Spore coat protein X/V; KEGG: bcl:ABC2511
FT                   spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28581"
FT                   /db_xref="GOA:E6TUZ8"
FT                   /db_xref="InterPro:IPR011428"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ8"
FT                   /inference="protein motif:PFAM:PF07552"
FT                   /protein_id="ADU28581.1"
FT                   /translation="MNQEVYRSTDSKDKKWNALDPISKHPLCDTQDETQDAANKNKTLQ
FT                   LNEEYILIKDSCDVTVNSTDTKAAVNLQIGLQAAIAVLISISVASSETAEKLTQELLQS
FT                   SKVKQISRQQTIVENSRNVDVSTTDTQAAVNIQILLQLLLALAVKLDIL"
FT   gene            318866..319011
FT                   /pseudo
FT                   /locus_tag="Bcell_0295"
FT   gene            319398..319838
FT                   /locus_tag="Bcell_0296"
FT   CDS_pept        319398..319838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28582"
FT                   /db_xref="UniProtKB/TrEMBL:E6TUZ9"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0502"
FT                   /protein_id="ADU28582.1"
FT                   /translation="MKSLSVIFVLLSMITFRSCGEAQAHSDVTLTLTPSYVEDTLYLTP
FT                   VITYLGDNLTTFIYVNEMAYIERVETDEEEVIYEHDDSGFDVDQRLELDEEDEVAGNTV
FT                   VLEGIEPGFYVVHLVADFSTELEEGMEQDFSHRMRQTIEVRD"
FT   sig_peptide     319398..319472
FT                   /locus_tag="Bcell_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.745 at
FT                   residue 25"
FT   gene            319872..320762
FT                   /locus_tag="Bcell_0297"
FT   CDS_pept        319872..320762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0297"
FT                   /product="ribokinase"
FT                   /note="KEGG: bha:BH3728 ribokinase; TIGRFAM: ribokinase;
FT                   PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28583"
FT                   /db_xref="GOA:E6TV00"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV00"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ADU28583.1"
FT                   /translation="MTEKPLITVIGSLNMDMVTTAKTMPREGETIHGESFKMVPGGKGA
FT                   NQAIAAARLGGHVQFIGMVGDDPFGHHLIKVLKNEGIKRNEVKIVPNTSTGVATILLSE
FT                   NNNRIIVTEGANGYVTKAYLEKLKERILESTIVLIQFEIPLEAIYYTLEICTQNNIQVV
FT                   INPAPAKQLPTSMWKKATFITPNETELKELFTARAREHLGEKLIVTKGENGVVFKSHGE
FT                   DIHIPSYPVEVVDTTGAGDTFNGAFVVALTEGKSIKDSVNFANAAAALSIKKFGAQGGV
FT                   PNRIKLDEFLNRLRP"
FT   gene            321019..321216
FT                   /locus_tag="Bcell_0298"
FT   CDS_pept        321019..321216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0298"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: cold-shock DNA-binding domain protein; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28584"
FT                   /db_xref="GOA:E6TV01"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV01"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADU28584.1"
FT                   /translation="MTGKVKWFNSEKGFGFIEREGGDDVFVHFSAIQGEGFKTLEEGQE
FT                   VEFEIVDGDRGPQAANVVKL"
FT   gene            321460..322335
FT                   /locus_tag="Bcell_0299"
FT   CDS_pept        321460..322335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0299"
FT                   /product="aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /note="PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; KEGG: bbe:BBR47_11130 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28585"
FT                   /db_xref="GOA:E6TV02"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV02"
FT                   /inference="protein motif:PFAM:PF04655"
FT                   /protein_id="ADU28585.1"
FT                   /translation="MDQSFQDIIVGVHGEKGKEWLTHFSTLKKEVEDRFEINIEETFKL
FT                   SYNFVAKAVHRKTKAPVVVKMGVPNEELTLEMLALQAFNGRGAISLIDKDDSLGAFLLP
FT                   YIQGEQHGSLTNVEATIAVMKDLPIIEKQIDHFPTVHKLFQAFHKHRVRNGGTSGVIDP
FT                   VIFHEAERMVDDLLSSEKYRCLLHGDLHGGNIMHDRLQWIMLDPKGVAGEREFEPAQFF
FT                   LNAPLDLLANSKVMDGWLRKFESTLHLERNRVLAWAFCKGVLSSVWSIESNEQNWQWAI
FT                   KRAEIIKSYM"
FT   gene            322364..322771
FT                   /locus_tag="Bcell_0300"
FT   CDS_pept        322364..322771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0300"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   bpf:BpOF4_13095 camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28586"
FT                   /db_xref="GOA:E6TV03"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV03"
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /protein_id="ADU28586.1"
FT                   /translation="MNKHGLVIIAIFLGGALGTLFRYFINMQVVDLLFPLGTVMENIAG
FT                   SFLLGALTAYILVKKVNPIIKEGLGVGFCGGFTTMSTLAADTVFLSTESSMISLVIYIT
FT                   LSLFGGITAAYLGMGLSTVMLKKAVKAGDIE"
FT   gene            322768..323142
FT                   /locus_tag="Bcell_0301"
FT   CDS_pept        322768..323142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0301"
FT                   /product="CrcB protein"
FT                   /note="KEGG: bha:BH2986 camphor resistance protein CrcB;
FT                   TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28587"
FT                   /db_xref="GOA:E6TV04"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV04"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADU28587.1"
FT                   /translation="MNILFVALGGGIGAVCRYFLGVWLKTNTKERFIPTAMLIVNVLGS
FT                   FGLGLFLNIVYGAIPLLVDAELPFLLIGIGFFGAFTTYSTFSVEAVTLLQKKKWKAFTS
FT                   YVVLSIGGSIAAFIIAFTII"
FT   gene            323764..324453
FT                   /locus_tag="Bcell_0302"
FT   CDS_pept        323764..324453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0302"
FT                   /product="spore coat-associated protein"
FT                   /note="KEGG: oih:OB1302 spore coat-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28588"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV05"
FT                   /inference="similar to AA sequence:KEGG:OB1302"
FT                   /protein_id="ADU28588.1"
FT                   /translation="MSIKKKLSMGVLTAALGLALIGGGTFAYFSDTATQTNTFASGTID
FT                   LDVDPEVQVAMYNLKPGDWMPRSFELQNNGSLDIKYVDLNTEYSVTDSDGDAVVPGLAD
FT                   EYAKQLIVQFLNNTTGDEDYEVLFEVSLYDLANLTPEDLATKIDVDTVMTHPGIWIPVF
FT                   GGGFWLKQPQYEDISEEITGIAAGDTADFDVQFRFNDTGERQNDLQGLNLELTWTFEGF
FT                   QTDGEER"
FT   sig_peptide     323764..323847
FT                   /locus_tag="Bcell_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.485 at
FT                   residue 28"
FT   gene            324596..325429
FT                   /locus_tag="Bcell_0303"
FT   CDS_pept        324596..325429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB2527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28589"
FT                   /db_xref="GOA:E6TV06"
FT                   /db_xref="InterPro:IPR023848"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV06"
FT                   /inference="similar to AA sequence:KEGG:OB2527"
FT                   /protein_id="ADU28589.1"
FT                   /translation="MRSTRSKRYRRRFKKIGMTTQVLVIMYAAVASTSVLSSGTVAYYS
FT                   NQSSASTTISSAAYWWDGSNLDFIGKNTQNVKACAPIEITVELKNKGFDMTETTVFEVY
FT                   FAATGNPEQNGDKDGEGTVEKLSAGEITNLTYTAEKDGFYTFKVYQLPGFEDNYDEIQE
FT                   IWSEKVHVNCNAAKNEVEIEEDDIEIESEQESETNEEEDQKSLQEEKAKKEDELEDTSD
FT                   NKKEKEENDKEMKEDSDDAEEKIEKEEDKKEKSEEEVKTKDIEKKDESKEKKEGE"
FT   sig_peptide     324596..324709
FT                   /locus_tag="Bcell_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.676 at
FT                   residue 38"
FT   gene            325433..326032
FT                   /locus_tag="Bcell_0304"
FT   CDS_pept        325433..326032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0304"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /EC_number="3.4.21.89"
FT                   /note="TIGRFAM: peptidase S26B, signal peptidase; KEGG:
FT                   oih:OB2526 signal peptidase I; PFAM: Peptidase
FT                   S24/S26A/S26B, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28590"
FT                   /db_xref="GOA:E6TV07"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV07"
FT                   /inference="protein motif:TFAM:TIGR02228"
FT                   /protein_id="ADU28590.1"
FT                   /translation="MKYLKVAKKIASGLVTFTLFVSLIAMVFIVISTKASGGEPELFGY
FT                   QIKTVLSGSMEPEFKTGSIIAVEPGGDMTRFQEGDIITFVERDNILITHRIVDVVHSGE
FT                   YLMYETKGDANNAPDSSLVLSDNVVAHYTGFTIPYVGYVASFAQSREGSALLLIIPGLI
FT                   LFFYAAYSIWDAISQLEKKNKKKERLDKVDEVEDPI"
FT   sig_peptide     325433..325546
FT                   /locus_tag="Bcell_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.906 at
FT                   residue 38"
FT   gene            326078..326755
FT                   /locus_tag="Bcell_0305"
FT   CDS_pept        326078..326755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0305"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="KEGG: oih:OB2525 hypothetical protein; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   Gram-positive anchor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28591"
FT                   /db_xref="GOA:E6TV08"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV08"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU28591.1"
FT                   /translation="MQRKMKIVFVATTGFLVALLFIMSVQYNNRTFADSNPVNITTTPH
FT                   SVLFEVDNMKPGDWADRQLTIQNRGDVDFTYHMEVEKTSGSDKLYHGLALEVYDGSELL
FT                   YEGSLGGFTGFEPRYLEALHEEDFLLTVRFPTELGNDYQGLDAEVEFTFIAEEVINGTE
FT                   DDEDTEQRRIDDASLEKEPQEGDILPTTATNTYNYLLIGIIALIAGIAFFLWSRKKKMK
FT                   IDS"
FT   sig_peptide     326078..326179
FT                   /locus_tag="Bcell_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.586 at
FT                   residue 34"
FT   gene            complement(326832..328640)
FT                   /locus_tag="Bcell_0306"
FT   CDS_pept        complement(326832..328640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0306"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="KEGG: choline/carnitine/betaine transporter;
FT                   TIGRFAM: choline/carnitine/betaine transporter; PFAM: BCCT
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28592"
FT                   /db_xref="GOA:E6TV09"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV09"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADU28592.1"
FT                   /translation="MDNNKFEYETKKTNIVFFISAPIVALFVLWGFIAPGHLERVSNDA
FT                   LALTLNNFGWFYMLCTAFFIVFVLFLAISPFGKLRLGKPDERPEYKFYTWLGMLFSAGI
FT                   GVGFVFWGVAEPALYFLDPHPDYVDAADQYKAAAGLRYAVFHWALHPWAIFSLVALTLA
FT                   YVQFRKDQPALISSAFQPILGDRIYGPLGKGIDVLAVLATSTGVATTFGLSALQITGGL
FT                   SHLTGTIPNNPATQLTVIAIVTVLFIFSAATGVNKGIRILSTINLTVAGLLLVFVIIFG
FT                   PTLFIAESVVSTIGGYIANVTQMSLDLNPFGDGEWLGMYTIFFWAWHISWAPFMGIFIA
FT                   RISRGRTIREFVAGVLIVPSLLAVIWFTAFGGTALDMIMGGNDHIANLVLENVEVALFV
FT                   TLNELPLGMIMSGLAVILIIIFFITSADSASYVLAALSSEGSLDPKLWVKVVWGFLIAS
FT                   TASVLLVSGGLSGLQTASIVAALPFAIIMVIMIFSLLMMMSRDTRAEQLWTRRKRTRKI
FT                   KKEVHSEMYDRVKDNMLDDMKEDVYEEIKEEVYEQVKEEVYDDIKEEVYEEFKEKIYDD
FT                   LREDLSEQLNGELEERMDDSDDKKKE"
FT   gene            complement(329075..329629)
FT                   /locus_tag="Bcell_0307"
FT   CDS_pept        complement(329075..329629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0307"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bha:BH2050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28593"
FT                   /db_xref="GOA:E6TV10"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV10"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADU28593.1"
FT                   /translation="MTNDSTIVMINGSMSSDSFTKKLLENVEDRLNKNGQNTTMIDVRE
FT                   LHLEIYDPDAPFPTQLEPVREQLREADGVIVGAPEYHGSYTGAIKNFLDYLGFKEFEQT
FT                   PIALLTTTGGLKAGTNTLNHLRLVFRNLHGIVIPQQFAISNKEAPTSLEFDENINARLE
FT                   AFVNAIQKEVVKKQLYEEWKR"
FT   gene            329911..330243
FT                   /locus_tag="Bcell_0308"
FT   CDS_pept        329911..330243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0308"
FT                   /product="export-related chaperone CsaA"
FT                   /note="KEGG: bld:BLi02184 CsaA; TIGRFAM: export-related
FT                   chaperone CsaA; PFAM: t-RNA-binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28594"
FT                   /db_xref="GOA:E6TV11"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV11"
FT                   /inference="protein motif:TFAM:TIGR02222"
FT                   /protein_id="ADU28594.1"
FT                   /translation="MATFDDFLKLDMRVGTVLESEEFLEARVPAIKLKIDFGEEIGIKQ
FT                   SSAQITKRYEPEALIGRQIVAVVNFPPLRIAGFKSEVLVMGGVPEKGDVILLNVDESVP
FT                   NGTKIS"
FT   gene            complement(330297..331184)
FT                   /locus_tag="Bcell_0309"
FT   CDS_pept        complement(330297..331184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28595"
FT                   /db_xref="GOA:E6TV12"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV12"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0509"
FT                   /protein_id="ADU28595.1"
FT                   /translation="MKDKQLISYIHDDDNKQKLFDIIQSNAAFYCNKWKKHHVPTTFSG
FT                   WNWAAFFFTPIWLSYRHMYGSVLVYYLLIFFIWSIHTIFPLFVFYGNIDPALAILWTCI
FT                   TTFAVHLYFGLKGNALYARKISSLLFDTSEEKAKVPLFQRTGRSYISAVIVPITFVILL
FT                   LLPAIRVEAWMDTSTLPYGTYVYYEDHGPPLSVKEALDHELPIFEKYTSTVELLYYSPE
FT                   PVGDRDVRVVLEFNLEGNWQTIRDRTYTFFRSDRVNLHLLDAEDPLLQTGQYRVTVFME
FT                   EEIVGTQSFLVELP"
FT   gene            331331..331939
FT                   /locus_tag="Bcell_0310"
FT   CDS_pept        331331..331939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28596"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV13"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0510"
FT                   /protein_id="ADU28596.1"
FT                   /translation="MKKMRIYIIISIFFILLGCESEVEIEGEGFPYNQIHENFQYTTFH
FT                   YPEEWDVVSIQYEVRHRFQDWQDPENHQYDEVPYRYTLLFGKRATDNEITEEELDDYND
FT                   EQALAGGTHRQLYYHTYYDYYGKLDMSKNGFIRLLSAFDDVEEWEINDETFLVLRESNE
FT                   WVVNWHRNGTYYDLMILNEAGISDEEQMTELLTMFFLQY"
FT   gene            332259..333944
FT                   /locus_tag="Bcell_0311"
FT   CDS_pept        332259..333944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0311"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   esi:Exig_2860 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28597"
FT                   /db_xref="GOA:E6TV14"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV14"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADU28597.1"
FT                   /translation="MNMKEMFADALMPHLKETPLTSEQVLQLIEKPKYENLGDLAFPCF
FT                   QLSKLLRKSPAIIANEIAEKLQSSSISSVEVKGAYVNVFFDKVLVGKAIIDKVIARGTS
FT                   YGSNDVNSRGKVVIDFSSPNIAKPFSMGHLRSTVIGNALAAIAEKNGYESVKINHLGDW
FT                   GTQFGKLITAYKLWGNEEEVRENTIPTLLKLYVQFHEEAEKDPTLVEEGRRSFQKLENG
FT                   DQEAVALWKWFRNESLKEFNKVYTLLGVTFDAVQGESYYNEHMEEVVKELEEKEILEES
FT                   DGALVVTLNDDMPPCLIQKNDGTTLYATRDLAAAKFRKETYDFVKCLYIVGGEQQLHFQ
FT                   QLFQVLQIMDEEWAADMVHIPFGLILKDGKKMSTRKGKVVLLEEVLQEAINKTKQNIID
FT                   KNPLLDNIDDVAKQVGVGAVIFHDLKNERIGNVEFNLDQMLTFEGETGPYVQYTIARGN
FT                   TLLAKAKTKQHSFKGLDGDLSWEVIKLLEQFPAVIERAFTAYEPSIVAKYVIKLAQAFN
FT                   SFYGNVKILQEDKHQESRLALTQSVTIVLTEGLRLLGMQAPEKM"
FT   gene            334040..334426
FT                   /locus_tag="Bcell_0312"
FT   CDS_pept        334040..334426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0312"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: bpf:BpOF4_13485 rhodanese domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28598"
FT                   /db_xref="GOA:E6TV15"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV15"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU28598.1"
FT                   /translation="MKNKMIYILPVLLLIGYFGYQYFLSYGIEEISTKELEALLLEEND
FT                   DYFFVDVREVHEYEEAHIEGMANVPLSRLESTYSSVPKDKTVVIICRSGKRSLEAANIL
FT                   KGKGYDDLVHVKGGMLTWDGEVTS"
FT   gene            334454..334828
FT                   /locus_tag="Bcell_0313"
FT   CDS_pept        334454..334828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28599"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV16"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0559"
FT                   /protein_id="ADU28599.1"
FT                   /translation="MAALVAIPMLYMRYYPVASACMTLHEVNECKDGVIVDVRDYNMAY
FT                   KEQFDNKKNIPLPYLHRFYGEIEAKKVIVLSSDIVSRNLSIRFLRKKGFIVIGYSIIDP
FT                   KNIGSSEHVVNKKRRHCHEI"
FT   gene            334818..335078
FT                   /locus_tag="Bcell_0314"
FT   CDS_pept        334818..335078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0314"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bmq:BMQ_3874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28600"
FT                   /db_xref="GOA:E6TV17"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV17"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADU28600.1"
FT                   /translation="MKYNAQMKNRVKRIEGQVKAILRMMEEEKDCKDIVVQMSAARNAL
FT                   DRTLGLVVSTNLEQCVREQIEKGEDTEPLIQEAVNLLVKSR"
FT   gene            335126..335491
FT                   /locus_tag="Bcell_0315"
FT   CDS_pept        335126..335491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0315"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: gwc:GWCH70_0563 rhodanese domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28601"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV18"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADU28601.1"
FT                   /translation="MNIFYIAIAVLLIWFIFLRFIPAKGVKQLNTYQLNDILEEKKYQF
FT                   IDVRTPGEFKQNHISNFKNIPLGELMHRYGELNKEQEVVLICQSGMRSNKASKLLKRLG
FT                   FSKITNIKGGMAAWSHQ"
FT   gene            complement(335607..336167)
FT                   /locus_tag="Bcell_0316"
FT   CDS_pept        complement(335607..336167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcq:BCQ_1895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28602"
FT                   /db_xref="GOA:E6TV19"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV19"
FT                   /inference="similar to AA sequence:KEGG:BCQ_1895"
FT                   /protein_id="ADU28602.1"
FT                   /translation="MLIYSLLFLFPITLYFIAMAHKQANRTNMEKMMLTMGGAMIIGFT
FT                   IGIFFGGLFYGDFFLSLMISLITTCLIGFVIGMPHGKLPIIEGVFTGGMAGAMGAMTAE
FT                   MLNIPEVRILLLLLFLLSSLGGFWCFHFWTKNKQFEKKIQRFFLHFFTMIYLIIVTVIF
FT                   VMYPPFEGSDNDQNHDHGLEVLQ"
FT   sig_peptide     complement(336105..336167)
FT                   /locus_tag="Bcell_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.804 at
FT                   residue 21"
FT   gene            336414..336791
FT                   /locus_tag="Bcell_0317"
FT   CDS_pept        336414..336791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0317"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: gwc:GWCH70_1719 transcriptional regulator,
FT                   ArsR family; PFAM: regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28603"
FT                   /db_xref="GOA:E6TV20"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV20"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADU28603.1"
FT                   /translation="MAKDACDIYCFDEEKVGRLKVEMKEEEITDTSNIFKVLADPTRLK
FT                   IAYSLTLEEELCVCDIANVIQSSTATASHHLRSLKKQGLARHRKEGKLVFYRLDDDHVK
FT                   QLIKIAFDHQREGKMEDDETK"
FT   gene            336775..338904
FT                   /locus_tag="Bcell_0318"
FT   CDS_pept        336775..338904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0318"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: gwc:GWCH70_1718 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28604"
FT                   /db_xref="GOA:E6TV21"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV21"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADU28604.1"
FT                   /translation="MTKQNSEQFVVQGFTCANCAARFEKNVKNISTVDDATVNFSIGKI
FT                   KVDGEVTIEQLEEAGAFENLKVRKESESAEPQQPFWKKRENILVYFASILVITGWSLVF
FT                   SYGEGHLLTIGVFLIAIVIGGYRLFLQGLKNLFQLQFDMKTLMTIAIIGAAIIGEWGEG
FT                   ALVVILFAISEALERYSMESARRSIRSLVDVTPKEATVVRDGLESTIPVKEIKVGDHII
FT                   VKPGEKLAVDGVVTKGTSAINEASITGESIPQTKQAGDNVYAATLNEEGVLEVKATKEV
FT                   NDTTIAKIIHLVEEAQNNKAPAQQFIDRFATYYTPAIMLLALLVAVVPPLLFSASWEQW
FT                   IYLGLATLVVGCPCALVISTPVAIVTAISNSAKKGILIKGGIYLEKARAIDVIAFDKTG
FT                   TLTRGFPEVTNIVGLSVEEKDVLAHAYALEKHSQHPLAKAIVRKAEAHLKSEDYQEMVI
FT                   EDTNSLTGKGVSAIVNGRMMYVSSPAYVNENYPTLITNAHVNEITKLQNEGKTVVVVGS
FT                   EEKVFGLIGLRDEVRPNVKKIVAKLGKAGVKHIVMLTGDNKATASAIAREAGVTEVHAE
FT                   LLPEEKLQHIKNWIENGYRVAMVGDGMNDAPALALADVGVAMGTIGTDTALETADIALM
FT                   GDDLEKLTDLKLLSKKTMQIIKQNIVFSLGLKAVALLLVPFGWLTLWIAIFADMGATLL
FT                   VTFNSLRLYRIKMKE"
FT   gene            complement(339444..340007)
FT                   /locus_tag="Bcell_0319"
FT   CDS_pept        complement(339444..340007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0319"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: flavin reductase domain protein FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28605"
FT                   /db_xref="GOA:E6TV22"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV22"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADU28605.1"
FT                   /translation="MLQSTDKTVLHCYPGLVALVTAKHESTQNIMAAGWHSYISYDPAI
FT                   YGVAVAKERFTHHLIKNSESFAINFIPAEFAHYIEGSGKLTGANGDKFTTLKIDWKSGE
FT                   TVNSPILKDAYVAYECKVIDMQTYGDHDWIVGKITKFHKDSTKFTDKGLPNFSAVELPI
FT                   YLGQSKYIIANQSTTVKEVSLDKE"
FT   gene            complement(340300..340989)
FT                   /locus_tag="Bcell_0320"
FT   CDS_pept        complement(340300..340989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0320"
FT                   /product="Lipoprotein LpqB, GerMN domain"
FT                   /note="PFAM: Lipoprotein LpqB, GerMN domain; KEGG:
FT                   lipoprotein LpqB, GerMN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28606"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV23"
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /protein_id="ADU28606.1"
FT                   /translation="MKKIFFGTLLSFVITLSLSGCGQGEENDNTTPIDRSGADDTEQEI
FT                   VEDDTTDNLDEGIENEEDNNKEEEEADSQLREDDETATQTDDVEMVDNVVLYFSDDQLM
FT                   EMYRVNTDVSVPANEEGAKNAYELWTAGPLQENLVSLLPETTTVQSVTFEDDVAYVSFS
FT                   ENILEANLGSSGELMLIEQIALIAKQFGVGKTQILIGGEVHESFLGHMDTSEPFTAGNP
FT                   EDYEVVE"
FT   sig_peptide     complement(340915..340989)
FT                   /locus_tag="Bcell_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.883 at
FT                   residue 25"
FT   gene            341177..342295
FT                   /locus_tag="Bcell_0321"
FT   CDS_pept        341177..342295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28607"
FT                   /db_xref="GOA:E6TV24"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV24"
FT                   /inference="similar to AA sequence:KEGG:Bsel_2282"
FT                   /protein_id="ADU28607.1"
FT                   /translation="MGGYKVGKVTLGFFLIFIGVVWIVQQLIGASLLKYVMTYGWFIIL
FT                   IILVLEYANKYFNRVEEKKISFDGFSVSVLFIFMLISGGIFSVQKTGVVDVFFFLGPEN
FT                   SIEIEEEYEVDDLNLFLMEYVNGSIEVVGEDTSTVHIEGKVTSRHYDESGIAENFEKAR
FT                   KVEEGEGSFEYVVKESSSIFSSNRNHLTIEFVITVPKEALLEIEAVNGSLTASHIENGV
FT                   SLKTTNGDIEINDVVGHATVRSTNGSLSLASIIGEIEAVTTNGKISVKNVDGKVLARGT
FT                   NGAIDIESHQVGGDWEIKTTNGKISIDIPKEANVYIEGETSNGSVDGNLEWERKYAGEL
FT                   VLTRRQGSSTLGDGTYSIIVNGTNGGIEVNTH"
FT   gene            complement(342416..343366)
FT                   /locus_tag="Bcell_0322"
FT   CDS_pept        complement(342416..343366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0322"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: substrate-binding region of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28608"
FT                   /db_xref="GOA:E6TV25"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV25"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADU28608.1"
FT                   /translation="MLNWKRLGLAGGLSLTLLVAGCGDADTDGDATEGDTTEGETAGEE
FT                   TTDEATTNEEGGEIELVYVEWDSEVASTHVIGQVLADQGYDVTLTPIDNAIMWQSVANG
FT                   EADGMVAAWLPATHGDLYEEYSDSLVDLGTNLEGAKIGLVVPSYMTIDSIEDLDQYADE
FT                   LGSTITGIEPGAGVVQAAETAVDEDYANLDGWDVQTSSSGAMAQALGEAVNNEEPIVVT
FT                   GWTPHWKFASYDLKYLDDPQGSFGEAEYIATMVREGLQEDLPGAYQILDQFNWTAADME
FT                   EVMLDIQEGASAEDAAAAWIEANEEKVAEWVAGVE"
FT   sig_peptide     complement(343289..343366)
FT                   /locus_tag="Bcell_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.920 at
FT                   residue 26"
FT   gene            complement(343596..344498)
FT                   /locus_tag="Bcell_0323"
FT   CDS_pept        complement(343596..344498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0323"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28609"
FT                   /db_xref="GOA:E6TV26"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV26"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28609.1"
FT                   /translation="MFDTIRDYINTVLDFIVRLVNFELVPAIPIAEGTKNTIDWITSTF
FT                   SFIFTPIRVHYSTFMEWTAELIYSVPPIITILVVAVIAYFLTGRKFGLPAFSIVGLWLI
FT                   HNQGLWEELMYTFTLVLNASILSVIIGVPIGILMAKNNTAEAIIKPVLDFMQTMPAFVY
FT                   LLPAVAFFSIGMVPGVFASLVFATPPTIRFTNLGIRQVSKELVEAADAFGSTGSQKLFK
FT                   VELPMARATIMAGINQTVMLALSMVVIASMIGAKGLGREVLSALQRAQVGPGFVAGIGI
FT                   VILAIIIDRLTQSVNTKKN"
FT   gene            complement(344491..345687)
FT                   /locus_tag="Bcell_0324"
FT   CDS_pept        complement(344491..345687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0324"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; CBS domain
FT                   containing protein; KEGG: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase; CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28610"
FT                   /db_xref="GOA:E6TV27"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV27"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ADU28610.1"
FT                   /translation="MAKIKVDKLTKLFGKKQKQASNMLKEGKSKNEILQECGVTVGVNQ
FT                   ASFEVQDGEIFVIMGLSGSGKSTLVRLLNRLIQPTSGSVWVDNEDLANISEEQLREVRR
FT                   KKMSMVFQKFGLFPYRTILQNVEYGLEVQGIDKEQRTKTALSSLELVGLKGYEDQYPDQ
FT                   LSGGMQQRVGLARALANDPEVLLMDEAFSALDPLIRKDMQDELLDLQVSMKKTIIFITH
FT                   DLDEALRIGDRIALMKDGSIVQIGTPEEILVNPANDYVEKFVEDVDRSKVLTAQHIMKR
FT                   PETVNIDKHGPRVALERMREEGISSMFVVDSNRNLKGYITADDASAAKKNGITNLSEIL
FT                   HNNIPKVEKDTPMHDIFNIIHDSPIPVAVIDNNKLVGIIVRGAVIAALAGDGEVKFNV"
FT   gene            346068..346628
FT                   /locus_tag="Bcell_0325"
FT   CDS_pept        346068..346628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0325"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: transcriptional regulator protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28611"
FT                   /db_xref="GOA:E6TV28"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV28"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0355"
FT                   /protein_id="ADU28611.1"
FT                   /translation="MRSEEKLQKDIDALEEARNRFITEIAKNIHLYNITPSAGRLYGTV
FT                   FFAEEPMTLDEMSKAMGMSKTSMSTGIRSLLDANMVERVWERGIRKDLYKAEDDWYKSF
FT                   SNVFINRWRNATELNLDAIKETKQLHLKLLKDTDSEDIRKKVTLDLEKLEEAEQYYYWL
FT                   TNVISLFETGEIYDIVPKHKKSD"
FT   gene            347271..347813
FT                   /locus_tag="Bcell_0326"
FT   CDS_pept        347271..347813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0326"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28612"
FT                   /db_xref="GOA:E6TV29"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV29"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU28612.1"
FT                   /translation="MREEFDRLYETYHNTLFQYLFYMVRNREVAEELVQEVYIKVLHSY
FT                   QSFKGKSSEKTWLYSVAKHVGIDWIRGQSRKKRKIDGQQFEWSEREYEIHDHAPLPEEI
FT                   LLQKDELQQIYKKLQLCSEDQQQVIILRYIQSLSISETADVLGWTESKVKTTQHRAIKA
FT                   LKKQLMQDDFDVKEASE"
FT   gene            347810..349066
FT                   /locus_tag="Bcell_0327"
FT   CDS_pept        347810..349066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28613"
FT                   /db_xref="GOA:E6TV30"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV30"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0516"
FT                   /protein_id="ADU28613.1"
FT                   /translation="MNKKRWDEEELEDQLRELPQIKDSQSKEALFQAIEKKMNEAHTEK
FT                   IKEPRINKKRTWIYPVIASFAAVLLLILIVPSFIHNDMPLNDLAGDYDDAADSGGPDTL
FT                   FGGDESVEEEMFIMEEPEANNISERTESSADEMPETEQSIVPIPYVLDVAIPTGNGNVY
FT                   QPIGFVIGEMVATDELGAGDLLAKIEYALHSPHANWGIESVSEQIQSISMIEEENTVAL
FT                   DFYEDNRMASLSSMESESFRNVVTEYFSVLGFDYVQFTVNGNQGFDFGQEGREVEWSLL
FT                   SDNRGYYVYADEGGERYLLRGANAEEPIYEDGELISLRATLENMKNVADNAWYEPGIPE
FT                   TVFFDDVERIDNYAIITLTDDSALTLEQFDLFEEVLAHTMHDFSIDYFTIEGGPIEDIK
FT                   EHRTTERLSTRTTPNIKYD"
FT   gene            complement(349409..350785)
FT                   /locus_tag="Bcell_0328"
FT   CDS_pept        complement(349409..350785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0328"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: bha:BH0511 magnesium (Mg2+)
FT                   transporter; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28614"
FT                   /db_xref="GOA:E6TV31"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV31"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADU28614.1"
FT                   /translation="MISEEVGVEHMNATQLTVLVIKYIREAKRDSLQTLLEELHPYDLA
FT                   ELYRSLPEKHHFKFLTFMNSKQIADLMMELDSDMQMEVLQKLGIEKSSKVMDIMDNDDL
FT                   ADLLAELTEEKLDEYLSAMQKDESKTVQQLMSYPPETAGGIMTNEFVWIRDYYTVRDAV
FT                   DKFKTFAELTRNIYYLYVIDENKKLVGVVSYRDLLLANIDEKIGDIMFNRVISVPIDMD
FT                   QEEVAQLIQRYDFLAVPVVDNSNELKGIVTVDDVIDVFIEEANEDIEKLSASGKSIDFN
FT                   TKASVASFRRLPWLILLLFIGLISGSILDGFEATLEQVVALIFFMPMIAGMTGNTGTQS
FT                   LAVVVRGLVTNTLEKRTILKLIWREFKVGIIIGLTCGLLVLGVAAFWQSSLLFGFVVGV
FT                   SLLATLIIGTMSGTIIPLILYRIGIDPAVASGPLITTLNDIFSLLIYFGIATSLIHYLI
FT                   "
FT   gene            complement(351813..353513)
FT                   /locus_tag="Bcell_0329"
FT   CDS_pept        complement(351813..353513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0329"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   afl:Aflv_1359 cytochrome c oxidase (b(o/a)3-type) chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28615"
FT                   /db_xref="GOA:E6TV32"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV32"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADU28615.1"
FT                   /translation="MGQSNEALQNLHDDYTLQVDPKIKPLSMIHVSIAFVAFIVGVFGG
FT                   LLQGLARGGMIELPSWLGYYQILTLHGVLLALVFTTYIIFGFFFAGMSRTHGAFSDRLR
FT                   KLGWAGFIVLTLGTVICAFMILTNQASVLYTFYTPLQAHWLFYAGLVLFVVGTWLEGTA
FT                   LLAHFFKWKKANPGKPTPLFGYMTTATILLWFIASIGVAVSVLFLILPWAMGITDEINV
FT                   VLSRTLFWYFGHPLVYFWLMPAYMVWYISIPKIIGGRLFSGSLAKLAFALFLLFSIPVG
FT                   FHHQLMEAGISEFWKYLQTVLTFIVVVPSLLTAFSIFATFEQTGRAKGGKGLLSWIKKL
FT                   PWGDARFFAPFMGMIIFIPAGAGGLINASFQLNAVVHNTLWVVGHFHLTVGTTVLLTFF
FT                   GMAYWLIPVLTGRKFDRHANRCGIVQTWLWATGMFLMSGAMHLLGLLGAPRRTAYTTYI
FT                   DHPQALQWFEGIFTSHVTVAIGGVILTAAGVLMFYNFIYLGFLAPKGQTEFPVTPDPLD
FT                   TPSTPRFLESWKLWIGIAIALILFAYTIPIIHMIIDAPPGSPVFNYLIQ"
FT   gene            complement(353513..353983)
FT                   /locus_tag="Bcell_0330"
FT   CDS_pept        complement(353513..353983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0330"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   bbe:BBR47_04020 probable bo3-type cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28616"
FT                   /db_xref="GOA:E6TV33"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV33"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ADU28616.1"
FT                   /translation="MHLHKYEKIWLIFGVSSLILFLTILGVSAFAMGHHPPSHMHTVDP
FT                   QNLNNDPMFSNPGLEQIDDTTYRATIIGQAFGYSPSVIEVPVGSTVEFHVTSADVVHSF
FT                   TIPGTNVNFMLTPGHVNMSVHTFHEPGEYLVICNEYCGTGHHHMQMRIEVTP"
FT   sig_peptide     complement(353882..353983)
FT                   /locus_tag="Bcell_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.568 at
FT                   residue 34"
FT   gene            complement(354005..354157)
FT                   /locus_tag="Bcell_0331"
FT   CDS_pept        complement(354005..354157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_1898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28617"
FT                   /db_xref="GOA:E6TV34"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV34"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_1898"
FT                   /protein_id="ADU28617.1"
FT                   /translation="MSKPNLQEKDKPVSEQEEGSLKGTFTFVLFLGSFLVITWFIVFIL
FT                   FLTRI"
FT   gene            354596..355654
FT                   /locus_tag="Bcell_0332"
FT   CDS_pept        354596..355654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0332"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28618"
FT                   /db_xref="GOA:E6TV35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV35"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28618.1"
FT                   /translation="MSFIELKNITKYFAGTSNPAVHSLNLGIDKGEIITLLGPSGCGKT
FT                   TTLRMIAGFEHPTDGAIEIDGKQIFNKTHALPPEKRGIGMVFQDYALFPHMTILKNVMF
FT                   GLNKWSVREKKQRAKEVLELVGLEDFANRYPTQLSGGQQQRVALARALAPKPHVVLMDE
FT                   PFSNLDAGLREKMRFDVTNILRKANTTAIIVTHDQKDAFAVSDRVVVMKDGVIQQIAAP
FT                   KEMYRCPKNCFVAQFVGKTNLLTGTMDDDQRHIHTHIGKVCLPDQWKEHVETVKLSIRP
FT                   EGCQLAEQGAYCGVVERVTYGGEYQELYVRLHNQPELSSEPMLIYAPVEQDVEIGRIVS
FT                   FDIKPELIALVE"
FT   gene            356209..356436
FT                   /locus_tag="Bcell_0333"
FT   CDS_pept        356209..356436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0333"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="PFAM: Domain of unknown function DUF1858; KEGG:
FT                   lsa:LSA0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28619"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV36"
FT                   /inference="protein motif:PFAM:PF08984"
FT                   /protein_id="ADU28619.1"
FT                   /translation="MKKEINLNKSVYDLVTQFPEIKEIMVSIGFDNITKPGMLQTAGRV
FT                   MTLPKGCRMKEIPLEKVIEEFEKHGFTVYQ"
FT   gene            356451..357683
FT                   /locus_tag="Bcell_0334"
FT   CDS_pept        356451..357683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0334"
FT                   /product="protein of unknown function DUF438"
FT                   /note="PFAM: protein of unknown function DUF438;
FT                   Hemerythrin HHE cation binding domain protein; KEGG:
FT                   bld:BLi02075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28620"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV37"
FT                   /inference="protein motif:PFAM:PF04282"
FT                   /protein_id="ADU28620.1"
FT                   /translation="MSEIINNREQEKLDKSKRQEMLKEIIKDLHAGKSVEEVKQRFNDA
FT                   VGTISVAEISDMEHSLMVEEGISVEEVQRLCSVHTEVFKGSIEEIHNQNEPEQQPGHPI
FT                   HTFKLENRAIDQHVNFKLQLHTERFEKDQSEENIKKLIDDLSELLDIDKHYSRKENLLF
FT                   PFLEKYGIFGPTKVMWGVDDRIRAAIKKARMELVNGDLNTKEIVESLNYIIYEVTEMIY
FT                   KEENILFPMSLQTLTEDEWIKIANESDIIGYTFAEPAGVWKPERAGVDGNVHSGEGYIK
FT                   LETGILTVDQLENMMNHLPVDITYIDKDDFVRYFSHGKERIFHRTKSVIGRTVQNCHPP
FT                   QSAHIVNELLDDFKSGKKDSEDFWIKFRDKYVLIRYFAVKDKDGNYAGTLEFTQNIGPI
FT                   QEITGEKRLMS"
FT   gene            complement(358133..358882)
FT                   /locus_tag="Bcell_0335"
FT   CDS_pept        complement(358133..358882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0335"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: rhomboid family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28621"
FT                   /db_xref="GOA:E6TV38"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV38"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADU28621.1"
FT                   /translation="MFIRNESFGQFVRSYKLVTVLIAINLVIYFWMSMYPKLGGQLIEA
FT                   YGVGSNYHIAMGELWRIVTPIFLHGSIMHLLFNCFSLFLFGPALEKMLGKGKLLIAYFA
FT                   TGILANIATFILAPLFYFHLGASGAIYGLFGIYLYMVLVRKDLIDPRNAQLIITILIIG
FT                   VIMTFINPGINRYAHIFGLISGAALAPILLRKITSASLYSMASDPNEVTFDPNRWQKHA
FT                   KNKQRLKIIGIVAGVLLLVLYFLQARL"
FT   gene            359312..359671
FT                   /locus_tag="Bcell_0336"
FT   CDS_pept        359312..359671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0336"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="KEGG: bmq:BMQ_0224 holo-(acyl-carrier-protein)
FT                   synthase; TIGRFAM: holo-acyl-carrier-protein synthase;
FT                   PFAM: 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28622"
FT                   /db_xref="GOA:E6TV39"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV39"
FT                   /inference="protein motif:TFAM:TIGR00516"
FT                   /protein_id="ADU28622.1"
FT                   /translation="MIVGTGLDLVEMDRIHALYQRKPAFARRVLTPVELERFNQLSEKR
FT                   AIEYLAGRFSAKEAFSKALGIGIGKQLSFQDVSIMNDIKGKPIVITEKISNMKIHLTIT
FT                   HTRCYAAAQVIVEEK"
FT   gene            359748..361280
FT                   /locus_tag="Bcell_0337"
FT   CDS_pept        359748..361280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0337"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: gwc:GWCH70_1954 carbohydrate kinase, YjeF
FT                   related protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: protein of unknown function UPF0031;
FT                   YjeF-family domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28623"
FT                   /db_xref="GOA:E6TV40"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV40"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADU28623.1"
FT                   /translation="MYVVTGAEMHQIDRHTMREIGLKEEVLMENAGQACYQHLIKFISK
FT                   KENLVVLVGTGNNGGDGFVIGRLLKEAGYNVDVWVIPPEQKIRGTASVHKRIFERFGYE
FT                   WKPFETNEELFQSNLKNYSIVIDALLGTGVKGKPRSPYREIIEAINHLPVKKISVDIPS
FT                   GVSPVEGDSDPIGIKADETYTLQAPKLSAYSYPTASFYGKVHVLSIGIPKVSFEHVGVS
FT                   RRLITEEQVKKTLTKRMPDAHKGSVGRALIIGGALQMTGAPVLTTYACLRSGAGLVTLA
FT                   VPDSIQPIVSQKLTESTFYPFKSKNGQIESGQLENVDYYSNFQGVAIGPGMGREQEHQL
FT                   FHAFKNYVGPLVIDADGLYHLSRELQLWKKERRSAPTIITPHPGEMASLTKLSIQEVEA
FT                   NRFDVSKQFAMTYNMYVVLKGPFTIITTPAGEQWINVTGNESLAKGGSGDVLTGMILAF
FT                   LLQHKNIAAAIYNAVYIHGKTADMLIKTHDVWSVLASDIANNLPKVILSMRK"
FT   gene            361328..362374
FT                   /locus_tag="Bcell_0338"
FT   CDS_pept        361328..362374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_09160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28624"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV41"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_09160"
FT                   /protein_id="ADU28624.1"
FT                   /translation="MKKIISLLVVGAALTLVLAACGEKTQEDVIADLESTYDQLTGYKA
FT                   EAEMTLQTGEEPQKYDVEVWYKEPSYYRVALSNEENDPDQIILRNDEGVFVLTPALNKS
FT                   FRFQSDWPDNNSQVYLYESLIDDILMDPERTFSATDEHYVFQTNTNYSNQNLSQQEIML
FT                   NKSDLSPASVKIMDVDLKPLVELKFHSFELNTEFGDSDFDMERNMTSAQLDMNVPTLGE
FT                   GEEEVMAEEEALDVLFPMYVPDGTMNSSIEEIETENGTRVVLTYEGEQPFTLVQQRSRV
FT                   VEASTPINMAEGEPVDLGFTYGALTRDGDTLSVTWSYEGSDFFLSSQHLEKEDIVAVAR
FT                   NVYGTEEK"
FT   sig_peptide     361328..361396
FT                   /locus_tag="Bcell_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.546 at
FT                   residue 23"
FT   gene            362569..363714
FT                   /locus_tag="Bcell_0339"
FT   CDS_pept        362569..363714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0339"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: alanine racemase;
FT                   PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28625"
FT                   /db_xref="GOA:E6TV42"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV42"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADU28625.1"
FT                   /translation="MNSTNHFYRNTWVEVDLNAIRENVKNLKNHLPSHVHIMAAVKANG
FT                   YGHSSVPVAEAALQAGATYLGVALLDEAIELRENGIKAPILVLGYVSPKYVNVAAEYDI
FT                   RLTVFQSEWVEEAAKVLEADNKGKIACHVKIDTGMGRLGIRTKEEGNALIVKLKKYSLF
FT                   TIEGLFTHYATADELDTSYLELQQQRFKDMISWFEATWGAEVPMKHCGNSATALRFSSE
FT                   YYNLVRYGISMYGLSPSEEIKELLPFPLKQAFSLYSEITHIKKAEKGDGISYGATYKSP
FT                   GEEWIGTIPIGYADGWIRANATGEVLVNGERVPIVGRICMDQMMVALKQPVQIGTKVTI
FT                   IGKQGNSFITIDEVANRLNTINYEIPCTIGSRVPRIMVDKK"
FT   gene            363882..364157
FT                   /locus_tag="Bcell_0340"
FT   CDS_pept        363882..364157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0340"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="KEGG: bha:BH0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28626"
FT                   /db_xref="GOA:E6TV43"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV43"
FT                   /inference="similar to AA sequence:KEGG:BH0521"
FT                   /protein_id="ADU28626.1"
FT                   /translation="MSEESTKKIMVSLPQELVNELDGLLEGNVNRSELIHKATKMYLKE
FT                   HKKQIIRETMQQGYMEMAKINLNIATEAFLAEEEAEHTLDRLVSGV"
FT   gene            364147..364512
FT                   /locus_tag="Bcell_0341"
FT   CDS_pept        364147..364512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0341"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: bpf:BpOF4_09170
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28627"
FT                   /db_xref="GOA:E6TV44"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV44"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ADU28627.1"
FT                   /translation="MGCKSLIVKRGDVYFADLSPVVGSEQGGIRPVLIIQNDIGNRFSP
FT                   TVIVAAITAQIQKAKLPTHVEINAKKYGFDRDSVILLEQVRTIDKQRLTDKITHLDDDM
FT                   MVKVNDALRISLGLIDF"
FT   gene            364830..365654
FT                   /locus_tag="Bcell_0342"
FT   CDS_pept        364830..365654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0342"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Rsbr domain protein; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28628"
FT                   /db_xref="GOA:E6TV45"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV45"
FT                   /inference="protein motif:PFAM:PF08678"
FT                   /protein_id="ADU28628.1"
FT                   /translation="MDANIRDIIFQYKDAIIDQWLVEIRKFRKEDSLQNITDTMYENTN
FT                   REFADKLLSTVQNDNGEEEVLILFSERLIQLGWPLNYITRGLQEFRKITVTTLSKQEAD
FT                   YYKSMEFFQEIEDWIDSIVNILVNEYSGSWENTVFLQKMALKELSAPLIPVVDKISVMP
FT                   LIGTIDTERAKYIMENLLQGVIEHRSEVVLIDITGVPVVDTMVAHHIIQASEAVRLVGA
FT                   TCILVGIRPEIAQTIVNLGIDLSKFPTKSTLRKGIEAALEMTSRQIVEIETE"
FT   gene            365666..366022
FT                   /locus_tag="Bcell_0343"
FT   CDS_pept        365666..366022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0343"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28629"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV46"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADU28629.1"
FT                   /translation="MRIPILKLHDYLLISVQVELDDKTALQFQEDVLGKIHEVGSRGVV
FT                   IDLTSVEMIDSFIAKVLGDVVDMSNLMGAKVVLTGIQPAVAMTLIDMGIMLEDVPTALD
FT                   LEQGLERLQLELEG"
FT   gene            366025..366429
FT                   /locus_tag="Bcell_0344"
FT   CDS_pept        366025..366429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0344"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28630"
FT                   /db_xref="GOA:E6TV47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV47"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU28630.1"
FT                   /translation="MQVQTHVDIQSEWGIVAARQAGRKLAREIGFGSVDQARITTAISE
FT                   LARNIYLYAKKGQIHIEEVIASNNRKGIKVIAVDKGPGIKDIRKVMEDGYTTSGGLGAG
FT                   LPGVKRLMDEFSIDSEINNGTKITAIKWLR"
FT   gene            366444..367457
FT                   /locus_tag="Bcell_0345"
FT   CDS_pept        366444..367457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0345"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="PFAM: Stage II sporulation protein E; Phosphoserine
FT                   phosphatase RsbU; KEGG: protein serine/threonine
FT                   phosphatase; SMART: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28631"
FT                   /db_xref="GOA:E6TV48"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV48"
FT                   /inference="protein motif:PRIAM:3.1.3.3"
FT                   /protein_id="ADU28631.1"
FT                   /translation="MEETRLSMYQSYKEMLTSYIKSKSEHALYSAQQFSKEMMEKDMSP
FT                   EEMVSLHLSVFKEIVDELPEEVIASFDLLLEVMIGYGLAHQEHLSLRDRQRQLDSELDV
FT                   AARMQKSLLPNEQIEVDAVDLGVVSVPAGKMSGDYYHYLSDEHGNIGIAVADVIGKGVP
FT                   AAMCMSMIKYAMDSLPEQRLQPAALLENLNRVVARNIDSDMFITMVYGTYAPREHLFYY
FT                   ASAGHEPGFFYEAATNTFEDLKTKGLVLGVSPKVHYKEFSINMEPGDFIVLLSDGVTEC
FT                   RIHDHFLERSQISSLIGKYKHLPAQAIAENVFRELEKIQDFELKDDFTLLILRRNV"
FT   gene            367513..367842
FT                   /locus_tag="Bcell_0346"
FT   CDS_pept        367513..367842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0346"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: anti-sigma-factor antagonist; TIGRFAM:
FT                   anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28632"
FT                   /db_xref="GOA:E6TV49"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV49"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADU28632.1"
FT                   /translation="MNLQVDVKDKGQAKTVHLNGEVDVYTADSLKKVLLPLAEKNNETI
FT                   VVDLSNVNYIDSTGLGIFIGALKATNKSGSQFKITGVNARIKRLFSITGLDEVIDIDAD
FT                   QREGV"
FT   gene            367845..368336
FT                   /locus_tag="Bcell_0347"
FT   CDS_pept        367845..368336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0347"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="TIGRFAM: anti-sigma B factor; KEGG: putative
FT                   anti-sigma regulatory factor, serine/threonine protein
FT                   kinase; PFAM: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28633"
FT                   /db_xref="GOA:E6TV50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TV50"
FT                   /inference="protein motif:TFAM:TIGR01924"
FT                   /protein_id="ADU28633.1"
FT                   /translation="MTEAADKIQMKIPAKPEYVGVVRLTVSGIANRIGCSYDDIEDIKI
FT                   AVAEACTNVVEHAYKDTASDPTILFSCSIFEDRLELAITDRGGEVDVSKFQNGKGPVNA
FT                   DQPVGDLKEGGLGLFLIETLMDKVEISSTSGVTIVMTKFLQRDEVELNEDRISTEVPKQ
FT                   "
FT   gene            368299..369087
FT                   /locus_tag="Bcell_0348"
FT   CDS_pept        368299..369087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0348"
FT                   /product="RNA polymerase, sigma 28 subunit, Sig B/F/G
FT                   subfamily"
FT                   /note="KEGG: transcriptional regulator, LuxR family;
FT                   TIGRFAM: RNA polymerase sigma-B factor; RNA polymerase
FT                   sigma-70 factor, sigma-B/F/G subfamily; RNA polymerase
FT                   sigma factor, sigma-70 family; PFAM: sigma-70 region 4
FT                   domain protein; sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28634"
FT                   /db_xref="GOA:E6TVS5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVS5"
FT                   /inference="protein motif:TFAM:TIGR02941"
FT                   /protein_id="ADU28634.1"
FT                   /translation="MKTESQQKSRNNKEQVLQWIAEYQSTGNKEIQTKLVLEFESLVHA
FT                   LARKFSRGQRHDEDLIQVGMIGLLAAIRRFDPTIGKSFESFAVPTIIGEIKRFIRDKTW
FT                   SVHVPRRIKEMGPKVKNAVDTLTTQLQRSPKVEEIAAHIDASEEEVLETMEMGKSYQAL
FT                   SVDRSIEADDEGSAVTLLDLVGSTEGGYEKTDQQMLLEKAFTVLSDREKQILHLTYFEN
FT                   LSQKDTGEKLGISQMHVSRLQRRALQKLRESLKVEATECL"
FT   gene            369088..369693
FT                   /locus_tag="Bcell_0349"
FT   CDS_pept        369088..369693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0349"
FT                   /product="Stage II sporulation protein E"
FT                   /note="KEGG: stage II sporulation E family protein; PFAM:
FT                   Stage II sporulation protein E; SMART: protein phosphatase
FT                   2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28635"
FT                   /db_xref="GOA:E6TVS6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVS6"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADU28635.1"
FT                   /translation="MIQHHKLNGVEISTYTKAKKGNWCSGDSFYTNETEDYIICAIADG
FT                   LGSGEDARESSSAAINLITEYHRLELDDLMAMCNNVLWNKRGAVVAILKIYKHDRSIVY
FT                   CNVGNIGCHFYTPSGKLTRPIPSRGYLSGKKQKFRIQRMNFEQGMSFVLYSDGLLFTPF
FT                   FHSYFSNLDSPKGAIEQVLQTMENSDDDTTIVIGKIID"
FT   gene            369983..372169
FT                   /locus_tag="Bcell_0350"
FT   CDS_pept        369983..372169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0350"
FT                   /product="Tex-like protein protein-like protein"
FT                   /note="KEGG: Tex-like protein protein-like protein; PFAM:
FT                   Tex-like protein-like; RNA binding S1 domain protein;
FT                   SMART: Resolvase RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28636"
FT                   /db_xref="GOA:E6TVS7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVS7"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADU28636.1"
FT                   /translation="MKWTEQNDSILSIVTKELQLKKDRVKSVIELSEDGNTVPFIARYR
FT                   KELTGGLDEEQIRSILDAWNYATNLANRKEEVIRLIEEQGKLTEELRENIEKSTKLQEV
FT                   EDLYRPYKQKRRTKATVAKEKGLEPLAMWLFSLPNEGEIENEAEKYVNEEKEIHSIEDA
FT                   LQGARDIISEYISDDAEIRKKIRQMTYQNGKITSEKKAKAEDEKEVFQMYYEYSEEVSK
FT                   IVPHRVLALNRGESEGVLKVSIEPPRDKIIAWLTRFVMKDKMTIAKEQVIISIEDGYKR
FT                   LIEPSIERELRNEVTEKAEEQAIHIFSENLRNLLLQPPLKDRIILGVDPAYRTGCKLAV
FT                   VNETGKMLAIDVIYPTPPRNEVDQAMKKVKEYIEKYNVEMIAIGNGTASRETEQFIVNT
FT                   IKEVDKQLFYLIVNEAGASVYSASKLAKEEFPDLQVEERSAVSIARRIQDPLAELVKID
FT                   PKSVGVGQYQHDVTQSKLNDSLTFVVETVVNKVGVNVNTASASLLQYVSGLSKAVANNI
FT                   VKQREEEGKYTNRAKLKKVPRLGAKTYEQCIGFLRVIDGDEPLDKTGIHPESYKVTKEI
FT                   MRYLDMTKDDLGTEEAKKKIDAVEINELADKFDIGVPTLKDILDALTRPGRDPRDDVPK
FT                   PLLKTDVLTMEDLSAGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLANKYVKHPMEV
FT                   VSVGDVVTVWVDDVDSKKGRIALTMLEPAKQIKE"
FT   gene            complement(372492..372629)
FT                   /locus_tag="Bcell_0351"
FT   CDS_pept        complement(372492..372629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28637"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVS8"
FT                   /inference="similar to AA sequence:KEGG:BMD_0232"
FT                   /protein_id="ADU28637.1"
FT                   /translation="MPSWLQRQLKEAYQQKDMRQVRLLNQCWFYYKKTIPTSSQKQNEV
FT                   "
FT   gene            372807..373268
FT                   /locus_tag="Bcell_0352"
FT   CDS_pept        372807..373268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0352"
FT                   /product="protein of unknown function SprT"
FT                   /note="SMART: protein of unknown function SprT; KEGG:
FT                   protein of unknown function DUF335 SprT"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28638"
FT                   /db_xref="GOA:E6TVS9"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVS9"
FT                   /inference="protein motif:SMART:SM00731"
FT                   /protein_id="ADU28638.1"
FT                   /translation="MTNKELQELVETISEEYFYKPFKHKAFFNSRLRTSGGRYSLSTHD
FT                   IEINPKQMEHFGIEELTKIIKHELCHYHLHIEGKGYMHKDADFKTLLKKVGGSRFCKTI
FT                   PNPRQRSSKIHVYACTKCNISFKRKRRFNTEKYVCGGCKGRIKLVKTIS"
FT   gene            373407..373482
FT                   /locus_tag="Bcell_R0033"
FT                   /note="tRNA-Asn4"
FT   tRNA            373407..373482
FT                   /locus_tag="Bcell_R0033"
FT                   /product="tRNA-Asn"
FT   gene            373491..373581
FT                   /locus_tag="Bcell_R0034"
FT                   /note="tRNA-Ser1"
FT   tRNA            373491..373581
FT                   /locus_tag="Bcell_R0034"
FT                   /product="tRNA-Ser"
FT   gene            373598..373672
FT                   /locus_tag="Bcell_R0035"
FT                   /note="tRNA-Glu2"
FT   tRNA            373598..373672
FT                   /locus_tag="Bcell_R0035"
FT                   /product="tRNA-Glu"
FT   gene            373702..373777
FT                   /locus_tag="Bcell_R0036"
FT                   /note="tRNA-Val2"
FT   tRNA            373702..373777
FT                   /locus_tag="Bcell_R0036"
FT                   /product="tRNA-Val"
FT   gene            373837..373912
FT                   /locus_tag="Bcell_R0037"
FT                   /note="tRNA-Asp1"
FT   tRNA            373837..373912
FT                   /locus_tag="Bcell_R0037"
FT                   /product="tRNA-Asp"
FT   gene            373943..374027
FT                   /locus_tag="Bcell_R0038"
FT                   /note="tRNA-Leu3"
FT   tRNA            373943..374027
FT                   /locus_tag="Bcell_R0038"
FT                   /product="tRNA-Leu"
FT   gene            374148..374234
FT                   /locus_tag="Bcell_R0039"
FT                   /note="tRNA-Leu4"
FT   tRNA            374148..374234
FT                   /locus_tag="Bcell_R0039"
FT                   /product="tRNA-Leu"
FT   gene            374247..374323
FT                   /locus_tag="Bcell_R0040"
FT                   /note="tRNA-Arg2"
FT   tRNA            374247..374323
FT                   /locus_tag="Bcell_R0040"
FT                   /product="tRNA-Arg"
FT   gene            374348..374424
FT                   /locus_tag="Bcell_R0041"
FT                   /note="tRNA-Pro2"
FT   tRNA            374348..374424
FT                   /locus_tag="Bcell_R0041"
FT                   /product="tRNA-Pro"
FT   gene            374610..374683
FT                   /locus_tag="Bcell_R0042"
FT                   /note="tRNA-Gly2"
FT   tRNA            374610..374683
FT                   /locus_tag="Bcell_R0042"
FT                   /product="tRNA-Gly"
FT   gene            374740..374816
FT                   /locus_tag="Bcell_R0043"
FT                   /note="tRNA-Ile2"
FT   tRNA            374740..374816
FT                   /locus_tag="Bcell_R0043"
FT                   /product="tRNA-Ile"
FT   gene            374977..376519
FT                   /locus_tag="Bcell_R0044"
FT   rRNA            374977..376519
FT                   /locus_tag="Bcell_R0044"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            376853..379783
FT                   /locus_tag="Bcell_R0045"
FT   rRNA            376853..379783
FT                   /locus_tag="Bcell_R0045"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            379853..379968
FT                   /locus_tag="Bcell_R0046"
FT   rRNA            379853..379968
FT                   /locus_tag="Bcell_R0046"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 97.23"
FT   gene            complement(380960..381136)
FT                   /locus_tag="Bcell_0353"
FT   CDS_pept        complement(380960..381136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:MAL8P1.11 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28639"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT0"
FT                   /inference="similar to AA sequence:KEGG:MAL8P1.11"
FT                   /protein_id="ADU28639.1"
FT                   /translation="MELEDEMNSDEVIDIDEVAAGVETIDDNSVHEDENTHGINSNEES
FT                   NEKNVDAADREKS"
FT   gene            complement(381140..382864)
FT                   /locus_tag="Bcell_0354"
FT   CDS_pept        complement(381140..382864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0354"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28640"
FT                   /db_xref="GOA:E6TVT1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU28640.1"
FT                   /translation="MFKWSNRSLSFKYGSVYVLTIILFLVSALLVNYLLEETRSEVASM
FT                   NQSADNSQKIAQMEVLMQERFTILAQHMINPQNTSEANFNNTVNEFNSLLDSLEAYIDS
FT                   DEKQTLLNVALDNDYAIIDIFENYITLRESEKSANFNRGQLEQARRSFQQSTFSLNQLK
FT                   NIFESEREEMVGTTYQSFDRTNQILTFSILISVIIGTLILVVVNRDVKKRLTNILSFSE
FT                   KIENGDLTVNNINMNGKDEFSKISTSLNTMKSGIEEILGDISNVSNNINDKSEDLEQSA
FT                   TFLNDVSKNVSSKLNELIAIVEEQSAAVVQISHTNESFNGRINTIEKSSMNMKESSLEV
FT                   ASTTKEGIELMNESVSNIDSINRMVANSASKVNVLVEKAADISQITELINKVAEKTNLL
FT                   ALNASIEAARAGSYGRGFAVVAEEIRSLSSEVNQSINDMNIIIQGIQQEADEVEKVLLS
FT                   SNEKTQEEQKKMEKNISYLTNNASSIDDLVNNIDSIYTSLLTMTKESDEINDSLEELTR
FT                   MSEKTTLYINEASDSIYEQNNIIHNINDHSSDLYTSVGQLNASMSRFSVKGVSRKTE"
FT   gene            383341..384471
FT                   /locus_tag="Bcell_0355"
FT   CDS_pept        383341..384471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0355"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG:
FT                   bpf:BpOF4_09240 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28641"
FT                   /db_xref="GOA:E6TVT2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT2"
FT                   /inference="protein motif:PFAM:PF01053"
FT                   /protein_id="ADU28641.1"
FT                   /translation="MRFETKNVHFQEKLDHTEMSKTKPIYQTSAFSFHDLDDMESFFKG
FT                   EKSYLYTRVGNPNTDDLGKGVADLEGADKGAAASSGISAILAAVLAVAKSGDHIIATED
FT                   LYGGTYQLMAKELIDFGIETSFVDFTNKDSVINAIKDNTVLLYSESITNPLLRVENIEQ
FT                   VVGIAKEYKLKTIIDNTFATPYLIRPHESGVDLVVHSATKYIGGHSDLSAGVVTGSNAL
FT                   MSKVKAKITNIGSNLGPFDGWLACRGLKTLSLRMERQSRNASTLANYLASNENIKKVYY
FT                   PTAASKKGNGAIVSIELAEHVDVHQFFRQLSWVKVVPTLAGVETSVTYPLGTSHRSVPE
FT                   ATRERLGVSTNLVRISVGIEDEEDIVEAFTEALSFS"
FT   gene            384594..385577
FT                   /locus_tag="Bcell_0356"
FT   CDS_pept        384594..385577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0356"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   bpf:BpOF4_09245 thiamine monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28642"
FT                   /db_xref="GOA:E6TVT3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT3"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADU28642.1"
FT                   /translation="MNNEVNWIRGITPNKHHQQQLKVGIGDDAAIYGHDKKMESVVAVD
FT                   TMVEGIHFTKQTMPMKSIGHKALAVNISDIAAMGAIPQYYLVSIAIPKTSWKKKELNDI
FT                   YNGMNELATVWSMDLIGGDTVSTNDALVISVTVIGKVEKERRLLRSNARCGDVVFVTGE
FT                   LGLSAYGLQALLEKGYENIDDDELLPYLQAHQKPDPHVRAGRLLANCGYRIALNDISDG
FT                   LASEAKEIADASQVTVELDWAAIPTTNKLKEYPQEKQEEWLLYGGEDFKLVGTIGKENW
FT                   EKLKAAFQAHSLPIFKIGSILTGNSEVLLKKENKREVLKKTGYGHL"
FT   gene            385595..386059
FT                   /locus_tag="Bcell_0357"
FT   CDS_pept        385595..386059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0357"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="PFAM: Uncharacterised protein family UPF0079,
FT                   ATPase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28643"
FT                   /db_xref="GOA:E6TVT4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT4"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADU28643.1"
FT                   /translation="MIYEWEMKSSSIEETTQLAEKLATHLAKGDVVTLEGDLGAGKTSF
FT                   TKGLAKGLGVTRNVNSPTFTIIKEYEGKHMMLYHMDAYRVEEEYEDLGLEEYFEGEGVT
FT                   VIEWPSMIAEQLPQERLSIHIQYTGETTRNIVITAFGQRYISICKEIFEA"
FT   gene            386056..386760
FT                   /locus_tag="Bcell_0358"
FT   CDS_pept        386056..386760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0358"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   bmq:BMQ_0257 glycoprotease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28644"
FT                   /db_xref="GOA:E6TVT5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT5"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADU28644.1"
FT                   /translation="MNGLAIDTSTYVMGVAVMKDGELAGEFMTNMKKNHSLRLMPAIRK
FT                   LLEEVDLTPEQLNRIVVAEGPGSYTGVRIGVTTAKTLAWSLNIPVVGVSSLEIIAQHGR
FT                   YTEGVISPFIDARRGQVYTGLYQSKNGIVKRVRDDQIIQHEDWLQSLREEGENVFFASP
FT                   DMDKHVEGIKRILGEAAMIGGVTEMAPRPGELIKLGMEKEVDVSTHEFSPNYIRMAEAE
FT                   TKWLAAKKEGQS"
FT   gene            386781..387233
FT                   /locus_tag="Bcell_0359"
FT   CDS_pept        386781..387233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0359"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: bha:BH0547 ribosomal-protein (S18)-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28645"
FT                   /db_xref="GOA:E6TVT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT6"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADU28645.1"
FT                   /translation="MGVEVNVRRMDISDLGDVLEVELDAFPNPWSRKAFINELTTNQFA
FT                   YYIVAVVEGRVVGYAGVWVVIDEAHITNIAVHSAYQRMGIGDLLLKGILEIAKMLGANK
FT                   ATLEVRVSNDKAKSLYEKHGFENGGIRKNYYTDNNEDAQIMWVMLE"
FT   gene            387215..388237
FT                   /locus_tag="Bcell_0360"
FT   CDS_pept        387215..388237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0360"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /note="KEGG: O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28646"
FT                   /db_xref="GOA:E6TVT7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT7"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADU28646.1"
FT                   /translation="MGDVRVTKNMILSIETSCDETSVAVVKNGREVLSNIVSSQIESHK
FT                   RFGGVVPEIASRHHVEQITYILEEAMREADVSFKDIDAIAVTEGPGLVGALLIGVNAAK
FT                   AVAFAHNKPLIGVHHIAGHIYANHIVEELTFPLLTLVVSGGHTELVYMTEHGSFEVIGE
FT                   TRDDAVGEAYDKVARTLGLPYPGGPHVDKLAQEGEATIDLPRAWLEPGSYDFSFSGLKS
FT                   AVINTLHNAKQKGITLPIENVAASFQESVIEVLVTKTIQAAEEKKVNRILLAGGVAANK
FT                   GLRSALKKACEEKGLTLTIPPLSLCTDNAAMIGAAGAIAFEKGKRANDWLNGEPGLILK
FT                   "
FT   gene            388525..390765
FT                   /locus_tag="Bcell_0361"
FT   CDS_pept        388525..390765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28647"
FT                   /db_xref="GOA:E6TVT8"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT8"
FT                   /inference="similar to AA sequence:KEGG:BH0549"
FT                   /protein_id="ADU28647.1"
FT                   /translation="MWIMWIYQKIYTFVKLSLCFYVSLFVLLCITDSPVVAESDKKEQH
FT                   ITIILVPGLSFEEMEWLYHHASDNHLWTTGAYAAINLRSDGNYSYLNNAVSLSVGRRAV
FT                   GVKDWNSFERDELVDGTKAVDLMRQWYGDDGSADLVHPYLHLLEEKMAANSYGAHIGWL
FT                   GESLNEQNVFTYVIGNADTREDKERYASLFVMNKSGEANGNLYDVIVDNRDAPLGVEID
FT                   KTLVVEKLIDVQKQHERTFTVVEWGDLYRLFSEEGKIEPEHFDYLYENTLLRLEETVAM
FT                   VQHLNTEVWLLSPAVNNNAYARKNQLGPLWIWKNDSNTSKATLYSETTRRTSLVSNTDI
FT                   AETWVQAYIDDSLHSGSSLGNALLYKPVVEENDWSFIDFQKRLNEINYVYAKRGAVLSS
FT                   YVTGLVLLLIVVSLMIWLLKDVEKWKKAAVLLLLSGVSSPFIFIIIPPVMTNSSPYLYV
FT                   MLVTFLSFLLGLLITKLSKKPFSVACGLFFITLMFDVILGGYLLERSFLSYDPVIGARY
FT                   YGIGNEFAGIFIVSGLLMIVPFIGKFKDHLSFKAAFTIWFKLMSVLVILLIALGSSTYG
FT                   ANAGASLAVSVVMFFLTIQLLLKNITWPVKLVTGFLFLFVVLVGIYALQLKAPSTHIYI
FT                   AFQQLLSGDTSAIWQTIIRKVEMNIKIFRVSYWTQLFITSYFLVGLIVWRRKKQELHKQ
FT                   QTFMMNTCIVASLALLVLNDSGIVAAATSMFITISVCYGWSLQNSVSARANG"
FT   gene            complement(391218..393152)
FT                   /locus_tag="Bcell_0362"
FT   CDS_pept        complement(391218..393152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0362"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28648"
FT                   /db_xref="GOA:E6TVT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVT9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28648.1"
FT                   /translation="MILLQCVQLSKSFGAERILSNVKLEVQSRERVALVGRNGAGKSTL
FT                   LKIIAGDLSFDSGDLIIPKNVSIGYLAQDSGLNTDRSIWEEMNTVFVHLKQMEKQLRKL
FT                   EEKMSNPNQSDYEKVLSDYDQLQQDFKDAGGYQYEADIRGILSGLNFAHFDYNTTVNTL
FT                   SGGQKTRLALGKLLLSKPDLLILDEPTNHLDIETLTWLENYLSSYDGAILVVSHDRYFL
FT                   DRIVNQVYELSFNETTKYPGNYSNYLEEKAKRLEIELKRFEKQQEEMKRLEDFVQRNIA
FT                   RASTTKRAQSRRKQLEKMTPLDRPIDDDHSAKFRFNINKQSGNDVLSIENLSVGFNGNT
FT                   LFENINLKITRGESVALIGPNGIGKSTLIKAISKKLSPIAGQINYGSNVKIGYYDQEQT
FT                   ELTSNKTVLQELWDEYPQTPEKDIRTVLGNFLFSGDDVLKIVYDLSGGEKARLALAKLM
FT                   MLNANLLILDEPTNHLDIDSKEVLESALIDYPGTLLFVSHDRYFVNRMATRVAELSSTK
FT                   ITDYLGDYDYYVTKKLEQEELKKLAEKKAAATRTASPEKQSSEGSAKHDYEREKELKKK
FT                   ERQRQRRIEELEVLIEKEETSIAQWEEDLCDPVIYQDHEKSLELNNNIEKSKANVDKWM
FT                   EEWEQLQDE"
FT   gene            393296..393775
FT                   /locus_tag="Bcell_0363"
FT   CDS_pept        393296..393775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0363"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: molybdenum cofactor biosynthesis protein C;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein C; PFAM:
FT                   molybdopterin cofactor biosynthesis protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28649"
FT                   /db_xref="GOA:E6TVU0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU0"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADU28649.1"
FT                   /translation="MSSFTHFNEQGRAKMVDISDKGETVRTAVAKGSIQVNKEIYDGIQ
FT                   QGTMKKGDVLAVAQVAGIMAAKNTSQWIPMCHPLSLSGVNIHFDWETSESEYTLHIEAS
FT                   VKTKGSTGVEMEALTAVSATALTIYDMCKAVDKGMIIGENYLLEKTGGKNGDFKR"
FT   gene            393868..394503
FT                   /locus_tag="Bcell_0364"
FT   CDS_pept        393868..394503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0364"
FT                   /product="CoA-binding domain protein"
FT                   /note="KEGG: CoA-binding domain protein; manually curated;
FT                   PFAM: CoA-binding domain protein; Rex DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28650"
FT                   /db_xref="GOA:E6TVU1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU1"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADU28650.1"
FT                   /translation="MDIEQAKIPQATAKRLPLYYRFLESLQSSGKHRVSSSELSEAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLTFFRKTLDQDEVTKVILVGVGNLGTALLNYN
FT                   FSKSNNMRIEMAFDVDENKVGQEIGNVSIHHLNNIEELIQGEIEVAILTVPANAAQPIA
FT                   DQLVKAGIKGILNFTPARLSVPENVRIHHIDLSVELQSLVYFLKHYPM"
FT   gene            394750..396159
FT                   /locus_tag="Bcell_0365"
FT   CDS_pept        394750..396159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0365"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: drug resistance transporter, EmrB/QacA
FT                   subfamily; TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28651"
FT                   /db_xref="GOA:E6TVU2"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU2"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADU28651.1"
FT                   /translation="MSKVPHKWLVVITVLLGTFTIILNNSMLNPAVPHLMNVFGGDAVA
FT                   TGWVITIFMVTMGITMPVTGYLGDKFGKKQLYMAGLFIFILGSILGAFSWDLSSLILFR
FT                   GLQGIGGGLMMPTSMALIFEVFPRKERGLATGIYGIAAMMAPTIGPTLGGFIIEMGSWQ
FT                   WLFLCNIPTGLLGLIFSYLYLKQTKKVNGLTFDLSGFVAVTLGVGAILLALGRVSEIGH
FT                   LTNVLNIALIVFGLLSLFLFIRIENRKEQPLLDLSIFKVRAYTYSVWIGSISSISLFAG
FT                   IFLVPLLVQNVYGYGAIMTGLSLLPGALLSGIFMSIGGRMLDKKGPALVVTTGLILTTI
FT                   PTFLYGFLSLETALWVIFVLNGVRGIGMGLSTMPSTTAGMNAIPEQLITRGSAMNNVLR
FT                   QMSSSLGIVFISVYFEVRRGQLTALNGTSLEQSSLQAINEGFIIIAILSLISIPIGILL
FT                   GKEHKKQQKDH"
FT   gene            complement(396985..397185)
FT                   /locus_tag="Bcell_0366"
FT   CDS_pept        complement(396985..397185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pal:PAa_0346 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28652"
FT                   /db_xref="GOA:E6TVU3"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU3"
FT                   /inference="similar to AA sequence:KEGG:PAa_0346"
FT                   /protein_id="ADU28652.1"
FT                   /translation="MPMWFTVTLVIAIVLLFVYSIFYKKKKSQTLKAESAANNKICKTC
FT                   QTSIPQEHDKSLCPNCKTILT"
FT   gene            complement(397478..397681)
FT                   /locus_tag="Bcell_0367"
FT   CDS_pept        complement(397478..397681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28653"
FT                   /db_xref="GOA:E6TVU4"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU4"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0565"
FT                   /protein_id="ADU28653.1"
FT                   /translation="MKNNSARFFGYFYFFIATAFVYFAIQQHNRSEGWDIWTLLLIALA
FT                   AIDYMISFRYFGAANKERRKKQ"
FT   gene            complement(397682..398413)
FT                   /locus_tag="Bcell_0368"
FT   CDS_pept        complement(397682..398413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0368"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: abortive
FT                   infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28654"
FT                   /db_xref="GOA:E6TVU5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU5"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADU28654.1"
FT                   /translation="MSKRYWIILLSFIIMHLSLSFVTLPLLLRFGSFESESALLGTAVF
FT                   ITFTIGFFVILALTVTANRDEEFTRNKADIPDTILWSFLGIFMVYIAQIVAGLIQMYVF
FT                   GIEPGSENTEQLVGFATAVPLLIIVFSVFVPIMEEIVFRKIIFGSLFKRYGFWIAALLS
FT                   GVIFAIVHMDFKHLLVYLLGGIVLAYLYVKTKRIIVPIIAHVGINSFVMIVQVIFGEQI
FT                   QNYLDRVENMQVIFYLFGGLF"
FT   gene            398842..399126
FT                   /locus_tag="Bcell_0369"
FT   CDS_pept        398842..399126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0369"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: bpf:BpOF4_09355
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28655"
FT                   /db_xref="GOA:E6TVU6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU6"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADU28655.1"
FT                   /translation="MLKPLGDRIVIELVEQEEKTASGIVLPDSAKEKPQEGKVVAVGTG
FT                   RVTENGERVALEVSEGDAIIFSKYAGTEVKYEGKEYLILRESDVLAVIG"
FT   gene            399187..400824
FT                   /locus_tag="Bcell_0370"
FT   CDS_pept        399187..400824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0370"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: chaperonin GroEL; TIGRFAM: chaperonin GroEL;
FT                   PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28656"
FT                   /db_xref="GOA:E6TVU7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU7"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADU28656.1"
FT                   /translation="MAKDIKFSEDARRSMKRGVDALANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDNFENMGAKLVSEVASKTNDIAGDGTTTATVLAQAMISEGLK
FT                   NVTSGANPMGIRKGIEKATQAAVAELQSISNPIESKESIAQVAAISAADDEVGQLIAEA
FT                   MERVGNDGVITVEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDDPYILITD
FT                   KKIASIQEVLPVLEQVVQQGKPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLDDIATLTGGEVITEDLGLDLKSASITQLGRASKVVVTKDNTTIVDGSGDAAEI
FT                   ANRVNQIKAQVEETTSDFDKEKLQERLAKLAGGVAVVKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVSGGGTALVNVINAVKAVDAEGDEATGVNIVLRALEEPVRQIAHNAGLE
FT                   GSIIVERLKGESVGVGFNAATGEYVNMVEAGIVDPTKVTRSALQNAASVAAMFLTTEAV
FT                   VADLPEEDGGAGGGMPDMGGMGGMGGMM"
FT   gene            complement(400909..401201)
FT                   /pseudo
FT                   /locus_tag="Bcell_0371"
FT   gene            401801..402616
FT                   /locus_tag="Bcell_0372"
FT   CDS_pept        401801..402616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0372"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; KEGG: tex:Teth514_0986 xylose isomerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28657"
FT                   /db_xref="GOA:E6TVU8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU8"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADU28657.1"
FT                   /translation="MDVGYMTNGYGLLVGAGGGVTSVKDIRYETLCEDKAVIETVASQG
FT                   YSSVEMFDGNLERFANSPEQLQQILDENNVSLLGVYIGANFIYKDALEDELWRIEHISD
FT                   LAAKFGAKHIVLGGGAVRPNGNTEEDYTLLANALEKAEAIVTNKGMVASYHPHLGSMVE
FT                   SPDQVDKLFEQSKIPFCPDIAHLAAGGGDPLSMIKKYKDRIKYIHLKDLKDGTFMPLGK
FT                   GDLPITEIIEYLKSEGYEGDWLVEIDGYNGEPEEASLTSYEFLKGKLDS"
FT   gene            402677..403849
FT                   /locus_tag="Bcell_0373"
FT   CDS_pept        402677..403849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0373"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: tex:Teth514_0988 oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28658"
FT                   /db_xref="GOA:E6TVU9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVU9"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADU28658.1"
FT                   /translation="MKELKVGLIGAGFMGKAHVVGYSNTPKLFAPAPVRPIFKTVCDID
FT                   EAVAEEAKERFGFEKSTTDYMDIINDPDIDIVSVCTPNDTHAEISIAALNAGKHVLCEK
FT                   PISNNPEDAKAMADAAEEAKKKGIISMCAYQYRRVPAVVLAKKFVEEGSIGEILNIRTQ
FT                   YLQSWSADPNSPLSWRFQKKYAGAGALGDIGTHVIDIAQYLAGDIDEVVSNVRTYIKER
FT                   PVQEGGADLLGTVKIDGDAEKAPVDVDDEASFLVNFKSGAVGSIEATRNAWGRNNYITI
FT                   ELHGTKGSILFNYERLNELQVCFSDDPDDRRGFKTIYTGPAHYYGDVTWNIPGMNIGYG
FT                   ELKTIESYDFLKAVVEGVQPSTTFAEAYKVDRVCQAVLKSSSSRAWEKVQ"
FT   gene            403903..405084
FT                   /locus_tag="Bcell_0374"
FT   CDS_pept        403903..405084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0374"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: tex:Teth514_0987 ABC-type sugar transport
FT                   system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28659"
FT                   /db_xref="GOA:E6TVV0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV0"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0987"
FT                   /protein_id="ADU28659.1"
FT                   /translation="MKKYKKLILTGAVLLTSFFGVACNDDGNEDAVGDVDVEINVDDVE
FT                   IATEPIRINPDIDAESEIFSEGPQGEIAVSAHEVELTPEEVKEISEGNYTAAISMHYAG
FT                   NDWSRAQIDGLQQTFAKMGIEVIAITDAQFSVEKQASDIETLMARNPDILVSIPVDPVS
FT                   TAGAYRQAAEAGIHLVFMDNVPDGFNPGEDYVSVVSADNYGNGIVAARTMAEELGGEGK
FT                   IGVIYHDADFFVTAQRVEAFERTIEEEYPNIEIVERGGIAEPEDGESVASAMITRNAEL
FT                   DGLFVVWDVPAEGALAAARTAGLDDLVVTTIDLGSGVALDMARNQHIKGIGAQLPFDQG
FT                   VAEAILAGYAILGKEAPSYVAVPALTVTRDNLLESWKLVYNEEAPSEIIDALD"
FT   sig_peptide     403903..403971
FT                   /locus_tag="Bcell_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.734 at
FT                   residue 23"
FT   gene            405104..406264
FT                   /locus_tag="Bcell_0375"
FT   CDS_pept        405104..406264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0375"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28660"
FT                   /db_xref="GOA:E6TVV1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADU28660.1"
FT                   /translation="MKTMKVGMIGGEFMAKAHSLAMAAVPMFFEDGVRLEKHTIADIDK
FT                   DSAKGAASKLGFSHYTDDWKTIINNPEIDIVDIVTPNHLHEEMAIAAAEAGKHIICEKP
FT                   LGRNAEETARILEVVEKAGVKHMVAFNYRKTPAVALAKKYIEEGSIGKILNFRGTYLQD
FT                   WSADPNSPLSWRFNKEIAGSGTLGDIGTHVLDLAHYLVSDIAEVNAITRTWVEERPTQD
FT                   AQTDSLGTIKKGNINKGKVTVDDEVITLLKFSNGAIGSLEATRNAWGRHNFLTFEIHGE
FT                   KGSLFFNYERRDELQVCFSDDPDDRRGYKTVYTGVSHPYGEGLWPIPGLGIGYSEVKII
FT                   EMHDFLSAIMNDKECQPSFKEGHRIAQVTDAILTSAENQQWTKTKQ"
FT   gene            406339..407838
FT                   /locus_tag="Bcell_0376"
FT   CDS_pept        406339..407838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0376"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: art:Arth_1915 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28661"
FT                   /db_xref="GOA:E6TVV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28661.1"
FT                   /translation="MGKVILQMSKINKSFNGVNVLNDVDFEVEEGEVHALMGGNGAGKS
FT                   TLMKILTGVYSKDAGEIKVDGEVKDLIGHKGALEAGISMIFQEFSLIPKLTVAQNIYLN
FT                   REPKTKFGLVDDRKMIRDAKELLSELELSISPKELVENISVGYWQMTEIAKALSMNTKI
FT                   LIMDEPTSTLTKSETEVLFSLIKRLKNNGITIIYISHRMDEIFRVCDRISVLRNGKNAA
FT                   TLKSSDTTMEELVTHIIGGNLKSSFEWVEREKINNRKPLLEVKNLKSGDKVNNVSFSLY
FT                   EGEILGLAGLMGSGRSETARAIFGVDQLEDGEIWIKGKERSINSPQDAISYGLGLVPED
FT                   RRSQGLVLGHNVKENLILSSLNLLSNKKVINEKLANKEVERFVEKLNIKTDGIYKTVSL
FT                   LSGGNQQKIVLAKWLLNNTEILILDEPTSGVDIGAKTEIIEIIREIADSGKAVLVVSSE
FT                   MKELLAMSDRILVMKDGEITSSIERTEIDSEEDVERAIQGD"
FT   gene            407819..408778
FT                   /locus_tag="Bcell_0377"
FT   CDS_pept        407819..408778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0377"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tex:Teth514_0990 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28662"
FT                   /db_xref="GOA:E6TVV3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU28662.1"
FT                   /translation="MQSKVINIVKDFDWRQYIVYIAFVLLFIYFAVTLSNEGFLTTNNL
FT                   MNIARQTAMISIMGVAMTFVIASKEIDLSVGSVAALSAITTALTMQAGLGMITAVIVGL
FT                   ATGLLIGFINGYLVTKIAIPSFLVTLAMMMIARGLAMWISGTAPIPISSESYIFLFGSG
FT                   DILGIPILLVWTLIIAVLGHFVLRKTTFGRQTLAAGGNETAATFSGIRTMKIKMTVFMV
FT                   SGMAAALAGMLYAGRLHAGRFTFGQGDELSVIAAVILGGTSLFGGVGTVVGTIFGSIMI
FT                   GTINNALILQGLDVSQQQVIQGIIIILAVAFGRKKKKA"
FT   gene            408797..409765
FT                   /locus_tag="Bcell_0378"
FT   CDS_pept        408797..409765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0378"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; AP endonuclease 2 domain protein; KEGG:
FT                   gtn:GTNG_2013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28663"
FT                   /db_xref="GOA:E6TVV4"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADU28663.1"
FT                   /translation="MKVGTFTVLYQDKSFEETLDKLKGMGVEAVEIGTGNYPGSNHCKP
FT                   DDLLDKPERIGKFKKAISERGMIISGLSCQGNPLHPNKGISDENHKVWVNTVKLAKQME
FT                   VDTVNCFSGCPGDGPNATVPNWVTCAWPPEFAELRKWQWDEVVVPYWKEQSKFAQDHGI
FT                   KIAIEMHPGFVVYNTETLLELRKRAGDNIGANIDPSHLIWQGMDPVEIIKVLGDNDAIY
FT                   HFHAKDTYIDERNKAINGVLDTKNYGDFLNRSWSFRTIGYGMSLQKWKTIFSVLQATGF
FT                   DGVISIEHEDQLASRDEGLQRAIDTVKSAILKDKPDEMWWA"
FT   gene            410017..412065
FT                   /locus_tag="Bcell_0379"
FT   CDS_pept        410017..412065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0379"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tex:Teth514_0987 ABC-type sugar transport
FT                   system periplasmic component-like protein; PFAM: regulatory
FT                   protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28664"
FT                   /db_xref="GOA:E6TVV5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV5"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADU28664.1"
FT                   /translation="MATINDVALKAGVSVATVSHVVNKTRYVSPETVKRVEEAINALDE
FT                   VPNFIQKKRTAKEEYSNRFLVVFASDIFHPFQQSVIEQLNEQLKEQKKTNLIVVQADDN
FT                   FEILENYAILKPKLCIGKVILLNVPLKKLYKEHSSLKGLPTIVVSENTFQLKGAAASNI
FT                   NFIVSNLYQGTQDATQHLINFGHEKIALVLPESYRNEDQNINDVYKGYKDAFGNKKVPF
FT                   QKRMIIGKGVNENIDEEIRLLMNDNAPPTAVIVTDEHYLMLVLKYLNSRNLTCPEDLSI
FT                   ICINDLSWFEFFQPGITTVKQNYTLIAKKIIERMTDEKFLKYGLDIEERTVVIGTELKL
FT                   RSSTGGIARGPFGEKAANVDTIQLSTSEKNKIKENKYTAVISFHYSGAAWMNLHESGIR
FT                   DIFNELGISLLAVTDAHFDADMQNRQLQGLLSLDPDIFIAIPVDDNKTSDMFKKVAKSR
FT                   SNLILITNVPKGINPDEYVSCVSVNEWSHGRLAGSGLGSSMRDLGKRKIGMIRFDSDFY
FT                   ATNQRDTAAKQMIIEEYKDLEIVKEVFFKDESDVYDETVKLMRENPDIEGLYVSWEGPA
FT                   TKVISALSAIGRNDVIIGTADLDYELALNIAENGNVKKVSTQLPYEQGQALALVAANTL
FT                   LNKAVPKFIGVEPVEVTTDNLIKMWKKVFKEDAPEEIANAIKQNIQT"
FT   gene            412361..416946
FT                   /pseudo
FT                   /locus_tag="Bcell_0380"
FT                   /note="cell wall/surface repeat protein"
FT   gene            417243..417824
FT                   /locus_tag="Bcell_0382"
FT   CDS_pept        417243..417824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0382"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28665"
FT                   /db_xref="GOA:E6TVV6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU28665.1"
FT                   /translation="MTKKISSKEKIIETASRLFQEQGYHATGLNQITKESGAPKGSLYY
FT                   YFPDGKEQLASVAVNNTADNVAERIKNGLMEEDDPIKAIQTFIQQLASAFEEKDKRMGI
FT                   PVAAVALETANTSEVIRTACVDAYDSWHNIFAAKLITAGYEENQAQESALVINALIEGA
FT                   FINVIIRKDGEPLRQIAKYIPNILGDKAQY"
FT   gene            417890..418754
FT                   /pseudo
FT                   /locus_tag="Bcell_0383"
FT   gene            418783..419178
FT                   /locus_tag="Bcell_0384"
FT   CDS_pept        418783..419178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA1546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28666"
FT                   /db_xref="GOA:E6TVV7"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV7"
FT                   /inference="similar to AA sequence:KEGG:MA1546"
FT                   /protein_id="ADU28666.1"
FT                   /translation="MYKNNFSSYLKTGVLAAVIIAVIANVLFIVSSLLFGHEIGFIGQD
FT                   RDTLYIVFITFATVMALLIGTVLFYFLQKYTKNPVVWFGIIVLLGFLYNTYMAEVDLDR
FT                   DFKATAHLIHVIVSGLAIYLVPKLSKK"
FT   sig_peptide     418783..418893
FT                   /locus_tag="Bcell_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.898 at
FT                   residue 37"
FT   gene            419393..420811
FT                   /locus_tag="Bcell_0385"
FT   CDS_pept        419393..420811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0385"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: cce:Ccel_1011 glycoside hydrolase family 43;
FT                   PFAM: glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28667"
FT                   /db_xref="GOA:E6TVV8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV8"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADU28667.1"
FT                   /translation="MEKQRKQGFNPYLPSWEYIPDAEPYVFNDRVYIYGSHDRFNGHVF
FT                   CLNDYVCWSASVDNLADWRYEGVIYKKTDDPLNHAGNMCLYAPDVTVGPDGRYYLYYVL
FT                   DKVPIVSVAVCDTPAGKYEFYGYVRYKDGTRLGEREGDQPQFDPGLLTEGDITYLYTGF
FT                   CAKGDKSRKGAMATVLGPDMLTILEEPVFIAPSEPYSSGCSFEGHEFFEAPSMRKVGDT
FT                   YYFVYSSIAMHELCYATSKNPTSGFDYKGVIVSNNDLHIDSYKPADKPMYYGGNNHGSI
FT                   IELKGKWYIFYHRHTNGSSFSRQGCIEQIEILEDGTIPQVEMTSCGSNGGPLIGRGEYP
FT                   AYLACNLFCRDEAVYTGQLSMDSQFPKITQDGKDGDEETGYIANMQNSATAGFKYFDCH
FT                   DIETVKIKVRGYCKGVFEVKTSWDGLAFAEIPVDFTNVWTEYASDIVIPDGIHSLYFTY
FT                   KGEGIASLASFTLE"
FT   gene            421059..421166
FT                   /locus_tag="Bcell_0386"
FT   CDS_pept        421059..421166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28668"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU28668.1"
FT                   /translation="MSVSFIKDLLFLSRSRKIIIDYKTFYNKFSLLMAF"
FT   gene            421300..421701
FT                   /locus_tag="Bcell_0387"
FT   CDS_pept        421300..421701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0387"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   aeh:Mlg_0075 RDD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28669"
FT                   /db_xref="GOA:E6TVW0"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW0"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ADU28669.1"
FT                   /translation="MENSVKYVGFWRRSLAFLIDNGTLGLITLVLLTPFFGNEDAVAIA
FT                   FLLMMFIVFIYHIVMPCTPLQATFGKYILGFKIVDRYGNRISFWRSMGRFFSQFFSGFM
FT                   NIGYIMIAFMEKNTGLHDLMAGTYVIERA"
FT   gene            421826..422278
FT                   /locus_tag="Bcell_0388"
FT   CDS_pept        421826..422278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0388"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: dsy:DSY4198 hypothetical protein; PFAM:
FT                   regulatory protein MarR; SMART: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28670"
FT                   /db_xref="GOA:E6TVW1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU28670.1"
FT                   /translation="MDYKKYVLAESVGYRITVTARLVINRLNSNFKKRKLPVTHEQWSV
FT                   MIRLWEEDGLTQNKLSQLTGKDQPSVSRLINNMERNGLVMRAPHPVDKRTNLIFLTAKG
FT                   KKLQVGMIEQAQKTIEDISKNISEEDMNTFLTVLSQIDDNLTEEKD"
FT   gene            422479..422940
FT                   /locus_tag="Bcell_0389"
FT   CDS_pept        422479..422940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0389"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: dsy:DSY4198 hypothetical protein; PFAM:
FT                   regulatory protein MarR; SMART: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28671"
FT                   /db_xref="GOA:E6TVW2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU28671.1"
FT                   /translation="MEDYNKYILSNSIGYQISSTARLVNNRLNANFKENDYPVTNEQYS
FT                   IMIRLWVDEGLTQSRLATLTGRDQANVSKVISNLEKKDLVMRTPHPVDKRTNLIFLTSK
FT                   GKKMQLGLIEQAKKTIEEMSDGIDEDDLKSFMEILLKIKGNLIKHEVNT"
FT   gene            423249..424202
FT                   /locus_tag="Bcell_0390"
FT   CDS_pept        423249..424202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0390"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bpf:BpOF4_07410 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28672"
FT                   /db_xref="GOA:E6TVW3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW3"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADU28672.1"
FT                   /translation="MKLRYLFLALILLSITSLFIGVTGISPLDIFNLTEEQAQILWISR
FT                   FPRLVSIILAGVGMSICGLIMQQLTRNKFVSPTTAGTLDSARLGVLVSLMLFTSASAIV
FT                   QMLVAFIFALVGTLVFMKILEKVKHKDVIFIPLVGLMFGSIVGSVTTFFAYQNDLIQNM
FT                   SSWLQGNFSLIIRGRYELLYISIPLMIFAYLYANRFTVAGMGEEFSVNLGINYKRVVNI
FT                   GLIIVAAVASVVLLTVGMIPFLGLIIPNIVSIYNGDNLKRNLPHTALLGAVFVLICDIL
FT                   GRLIIYPYEIPIGTTVGVIGSAIFLYLLMRRKAYEQ"
FT   gene            424192..425139
FT                   /locus_tag="Bcell_0391"
FT   CDS_pept        424192..425139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0391"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bpf:BpOF4_07405 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28673"
FT                   /db_xref="GOA:E6TVW4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADU28673.1"
FT                   /translation="MSNKTKLIILFILSLVFTALFIFYNLNFSSNLGYILPRRGTKILA
FT                   IIVTGAAIAFSTVVFQTITNNRILTPSIIGFDSLYLLLQTFLIFVFGSASFLVVHKEIN
FT                   FLLSSAIMIVFAGLFYKLLFSKGRNIYFLLLVGIVLGTLFSSVSTFMQVLIDPNEFLIV
FT                   QDRMFASFNNVNTDILNVTIIIFVFVTIYFWKYLKYLDVLSLGRDTAVNLGVDYDRVVK
FT                   RLLILVAILISISTALVGPILFLGLLVANVTYEFLKTHKHSYIIPGAILISIVALVSGQ
FT                   FIVERLFSFSVPISVIINFIGGVYFIYLLLRGHK"
FT   sig_peptide     424192..424275
FT                   /locus_tag="Bcell_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.618) with cleavage site probability 0.227 at
FT                   residue 28"
FT   gene            425139..425894
FT                   /locus_tag="Bcell_0392"
FT   CDS_pept        425139..425894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0392"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bcy:Bcer98_0361 ABC transporter-related
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28674"
FT                   /db_xref="GOA:E6TVW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28674.1"
FT                   /translation="MVVVKGVSKKYGNKNVVEDISVEIEKGTITSFIGPNGAGKSTLIS
FT                   MISRLIAKDCGLISIDDKELSECKSEELAKKISILKQSNHLNIRLTVRDLVAFGRFPYC
FT                   KGNLTKEDKEHVDQAIDYMELRDMQHKFLDQLSGGQRQRAFIAMVIAQDTEYVLLDEPL
FT                   NNLDMKHSVQIMHVLRRLVDELGKTVVIVIHDINFASCYSDHIVALKDGKVVKKGTTPE
FT                   IINPEVLKEIYDMDIQIENINQNRICVYF"
FT   gene            426059..427060
FT                   /locus_tag="Bcell_0393"
FT   CDS_pept        426059..427060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0393"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: bha:BH1028
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28675"
FT                   /db_xref="GOA:E6TVW6"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW6"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADU28675.1"
FT                   /translation="MKKSLLLVILAFSMMMLLAACGSEDSEGSESSEPVVEEEQEGQEQ
FT                   QEEVEEETEEPSELTITHELGDITVPVNPEKVVVFDMNALETLDKMGVNVTGVPQANIP
FT                   AYLSQYEDASYENVGTLFEIDYEKLAEINPDLIITGGRQAEQYDDLSELAPVLHMSTDY
FT                   DNFYESFQSNMTTLGQVFNQEAFIAKELQAIDDAIAALNEKVSSEETALVVLANSGNVN
FT                   AYGTGSRFGIIHEKFGFTPVDESIEVTTHGMNISFEYIVDKDPDYIFVVDRDLVVTGEP
FT                   AAQDTIENELVQNTKAYQNGNIHYLNPDYWYIAGGGIVSVSEMVKAIEEALQ"
FT   sig_peptide     426059..426127
FT                   /locus_tag="Bcell_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.561 at
FT                   residue 23"
FT   gene            427331..427645
FT                   /locus_tag="Bcell_0394"
FT   CDS_pept        427331..427645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0394"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bsu:BSU07150 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28676"
FT                   /db_xref="GOA:E6TVW7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW7"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ADU28676.1"
FT                   /translation="MLIQTRTITVKPGYSDQVVDRFSGDSPIDTMDGLIDRTVVVNRKK
FT                   RDQEEVMVMIRWESLEAWKNWEKSDAHIQGHRNNKNKEKPEYILDINVNMYEVKAVKKR
FT                   "
FT   gene            complement(427907..428245)
FT                   /locus_tag="Bcell_0395"
FT   CDS_pept        complement(427907..428245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH2337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28677"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW8"
FT                   /inference="similar to AA sequence:KEGG:BH2337"
FT                   /protein_id="ADU28677.1"
FT                   /translation="MNKLISRTLLLLITITLTSCNLFDSNDLSFEMIAFNSLTVEESEL
FT                   IPVSPKDSFVEKVPVTSENKPLIDKNYDKSEVFSVTFHHTEVDSSGKLTVFIDLDEKTV
FT                   VGKGFTNK"
FT   gene            428443..429081
FT                   /locus_tag="Bcell_0396"
FT   CDS_pept        428443..429081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0396"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="KEGG: bpf:BpOF4_09735 hypothetical protein; PFAM:
FT                   Vitamin K epoxide reductase; SMART: Vitamin K epoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28678"
FT                   /db_xref="GOA:E6TVW9"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVW9"
FT                   /inference="protein motif:PFAM:PF07884"
FT                   /protein_id="ADU28678.1"
FT                   /translation="MNELLHEREINQETTNDTSYQYKPAVRKLFAIFTTVAAIGWAVSV
FT                   FLTGVHFWVLPLPTGFDVTGTPWAVMTSEWAYVLGIPLALLGAFYYLTVLLLAGLWYHS
FT                   GHPLVLKILTPISATGVIASAFFVYLQLFVIEAICPFCMVSAVASTTLFVIELLMLRMS
FT                   KLPPIRELLPNVRTLLDRRSLISLFLMLIVSVLPVLSFWFATIVPAPGG"
FT   gene            complement(429435..429602)
FT                   /locus_tag="Bcell_0397"
FT   CDS_pept        complement(429435..429602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0397"
FT                   /product="Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase"
FT                   /note="PFAM: Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase; KEGG: bpf:BpOF4_21414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28679"
FT                   /db_xref="GOA:E6TVX0"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX0"
FT                   /inference="protein motif:PFAM:PF09388"
FT                   /protein_id="ADU28679.1"
FT                   /translation="MSKLLNLINDIEVARSKLICAGMKKGLTHPETINCSKLLDELLNQ
FT                   YYQIGKRPSQ"
FT   gene            429940..430332
FT                   /locus_tag="Bcell_0398"
FT   CDS_pept        429940..430332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sca:Sca_2329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28680"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX1"
FT                   /inference="similar to AA sequence:KEGG:Sca_2329"
FT                   /protein_id="ADU28680.1"
FT                   /translation="MKKVSLVALLFLFIVSMMVGCSEAKSQQAIIGKWAITDFNEKETD
FT                   ADLGMLGNLQNSIFRMAFAPGTVIEFINEERMSIGVNSIDYKWVSDSKLEMGPSTDEAI
FT                   LFDVTLDDTNLILENQFFTIDLNRTE"
FT   sig_peptide     429940..430014
FT                   /locus_tag="Bcell_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 25"
FT   gene            complement(430442..432166)
FT                   /locus_tag="Bcell_0399"
FT   CDS_pept        complement(430442..432166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0399"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory
FT                   transducer; PFAM: chemotaxis sensory transducer; Cache
FT                   domain protein; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28681"
FT                   /db_xref="GOA:E6TVX2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADU28681.1"
FT                   /translation="MKNLQLAILLTLFIISLATHTILPLNYLSLSFATISLLIGVYMVW
FT                   QIHKSKRLLDFILGGIKKASLSDYIVIEKAITTTKSMYTSIQNHDFKNRDEVIKKLNIF
FT                   LNENKQYLGVWAAWEPNQFDNNDALNINKNGNTHGQMSPYVYRGDKGIEVTYLEDLQNE
FT                   KFYTRPLNEEKLTILEPFHFDIDGQETLMTTVAMPIRKNGKAVGVVGVDIHLKSAKNIH
FT                   LNLLDYSTSEELDLERLVYTLKKQGGQYAIIGQAIQVLKEERSEMIEYLVNTTTEVSKS
FT                   TAQFVNIAKQSSISANEVSSAIVDIASGASSQANETEQGTEKVELLGDIIEKDQLELQR
FT                   LNELIIEITVNKEAAERVTHDLIKSNDTTTETMSEVANKLLKSTESTKKIERATDGILT
FT                   ITEQTNLLALNASIEAARAGEYGKGFAVVANEIRKLAEQSKQFSEGITKDISELGKNSK
FT                   EASTTMKQLEEIIIYQSSNVNNVNDKLIDISKTVETMKDGITDLNHSGKQMTSNKGEIV
FT                   AIMQSLSAVAEENAAGTEEITASIEELTGHVDKSTHSSEQLTNIVEQLKKVTDRLKV"
FT   gene            432738..433718
FT                   /locus_tag="Bcell_0400"
FT   CDS_pept        432738..433718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0400"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: ATPase associated with various
FT                   cellular activities AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28682"
FT                   /db_xref="GOA:E6TVX3"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX3"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADU28682.1"
FT                   /translation="MFKNHHAEEIQLKEKNVEKMIGNVEKVVVGKRREIELSTIALLSG
FT                   GHVLLEDVPGVGKTMLVRAMAKSLGANFKRIQFTPDLLPSDVTGVSVFNQKTMEFQFRP
FT                   GPIMANIVLADEINRTSPKTQAALLEALEEGSVTTDGETRELQEPFFVMATQNPIEYGG
FT                   TYPLPEAQLDRFLFKFKIGYPTKAEELDVLNRVEKQHPIDQLEPVLSLDDLIQMQKNVL
FT                   DVYVDNTVKQYIIDLVNTTRIHYAVYLGASPRASIALMKASQAYAYIQGREYVVPDDVK
FT                   YLAPYVLRHRILLNSDSKLSNVTNEQVIKEIIDQIRIPVGKEAAK"
FT   gene            433715..434956
FT                   /locus_tag="Bcell_0401"
FT   CDS_pept        433715..434956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0401"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28683"
FT                   /db_xref="GOA:E6TVX4"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX4"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADU28683.1"
FT                   /translation="MKKRNQVIYWIKLVFKALLVLLLFISLFSYAMFQGGFVSWFLLYS
FT                   IMSLVILMLLYTLIPLGSFKVKRDLKKRAIPSGTDMTVTVNVKRKWPFPFLYLVVEDGI
FT                   ENKLEKQMRNVDYKIIFYPSFKKELKYSYTIPNMKRGEYFFYNVRLETSDMFGLFKKKK
FT                   YVTEQDSFLVYPNYHEIERWSAYEKNETETRLSSADFIEDVTSIAGAREYVPGDKLTSI
FT                   DWKVTARSNKLMTKEFEEYIGQNYMVILNNHIPNENSDTLEAYEKSVELVTSLIMHATR
FT                   KQLKVGLWTLGNKHRIFSLDTGEDHQKRLIYHLSKVEGENKGSFHTGLKQYDDNIQNGT
FT                   TLFFASTEITDEIIERVRIYLSRRIKVYFCLLKKHHAMDKLEEKRYRELLRIGTDAYLL
FT                   TGANIDHVIKAAGD"
FT   sig_peptide     433715..433810
FT                   /locus_tag="Bcell_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.980 at
FT                   residue 32"
FT   gene            434957..437233
FT                   /locus_tag="Bcell_0402"
FT   CDS_pept        434957..437233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0402"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: transglutaminase domain protein; PFAM:
FT                   transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28684"
FT                   /db_xref="GOA:E6TVX5"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX5"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU28684.1"
FT                   /translation="MKQKLGNQASTNLHLYIYVLAFLILWEWLRPIPIITNTGHIQVFV
FT                   FFALFSCILIYFKTPIYAMLPSMFIGSILGLNYIFNSQKLLDFQGFMETVQRFFTEAIY
FT                   NIHLIVSWNLASLTDFFRTFLLFLLLSLICYLLYFWIFHTKKIFFFLLSTVIYITVLDT
FT                   FTEVDASNAIIRIVVIGFFIMTLLHMLKIQEEVKEIGQKRIIPISITWMYTLIIMIVVA
FT                   LFIGIAAPKQEPRWADPVPTFRSLVLGENGIGDGTRRVGYGDNDEILGGGFVQDYSTVF
FT                   FAETTYAGYWRGESKDEYTGRGWIAETSEVQSETVFEQGEIDYWLFGQFSETVEHYVRI
FT                   TLAEDQSFDHLFYPGQLTGVNVDSLRVHVNGQLSDASDVDFFTDITSGKVSAKTNNVND
FT                   EVSLTSYSLSFEPAKFPIDALQNSEASDIDVDERYLQLPDTLPERVYDLAEEIVADHDN
FT                   LFDKVVAVEQYFSENDFEYETTNVPIPEEGQDYVDQFLFETQYGYCDNFSTAMAVLLRT
FT                   LDIPTRWVKGFTQGEVVDYIGESTQRYEVLNSNAHSWVEVYFPGVGWVPFEPTQGFNNN
FT                   VDFYEESEEASSNIEEEEFPEEEELDEQDQEIPSPEEDDLLEDEDENDTTTINNDRLFA
FT                   NPFTMKNILISMFVLLFVVYFYRKQNILQNKYFMMKYRISGKDEKYSDAYERLLWILAN
FT                   EGLPRQSGETLREYAKRVDRFIDCKAMTDLTNTYEKIYYGGKVAEGDWEKLHKEWERVV
FT                   KTITS"
FT   gene            437534..439072
FT                   /locus_tag="Bcell_0403"
FT   CDS_pept        437534..439072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0403"
FT                   /product="GMP synthase, large subunit"
FT                   /note="KEGG: bpf:BpOF4_09595 GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit; PFAM:
FT                   GMP synthase domain protein; glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28685"
FT                   /db_xref="GOA:E6TVX6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX6"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADU28685.1"
FT                   /translation="MQEIKEKIIVLDFGGQYNQLIARRIRDLGVYSELHSHKTSIEEIK
FT                   EMNPTGIIFSGGPGSVYAEDAPRCDERIFDLGIPVLGICYGMQLMTHHFEGKVEAANHR
FT                   EYGKAIIQVENKSKLYDGLEDKQSVWMSHGDLVVAPPAGFTVDATNVSCPVAAMSDESR
FT                   KLYGVQFHPEVRHSEFGNEMLSNFVYKVCECKGNWSMENFIDMEMDKVRELVGNKKVLC
FT                   ALSGGVDSSVVAALIHKAIGDQLICMFIDHGLLRKGEADSVMKTFSEGFDMNVIKIDAQ
FT                   ERFLSKLEGVKDPEQKRKIIGNEFIYVFEEEAGKLTDVDFLAQGTLYTDIIESGTDTAQ
FT                   TIKSHHNVGGLPEDMHFKLIEPLNTLFKDEVREVGTELGLPEEIVWRQPFPGPGLGIRV
FT                   LGEITEEKLEIVRESDAILREEIKKAGLDREIWQYFTALPDMRSVGVMGDARTYDYTVG
FT                   VRAVTSIDGMTSDWARIPYEVLEIISTRIVNEVKHVNRVVYDITSKPPSTIEWE"
FT   gene            439446..440753
FT                   /locus_tag="Bcell_0404"
FT   CDS_pept        439446..440753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0404"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28686"
FT                   /db_xref="GOA:E6TVX7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX7"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADU28686.1"
FT                   /translation="MEKYFRFDELGTNYKREIMGGLTTFLAMAYILFVNPDILSAAGMD
FT                   EGAVYVATALAAAIGTIMMGVVARYPIALAPGMGLNAFFTFSVVIGMGIPWQTALLGVF
FT                   ISGIIFIIITVVGIRELIINAIPAELKYAAAAGIGLFIAFIGLKNAGIVVPYESTAVTL
FT                   GDLTYGPTLLAVFGVVITVILMALKLRGGIFYGMIITAVVGLIFQVLPMPSQIIGPIPS
FT                   LEPTFGAFLQPFADQSFGEIFSISLIIVILTFLFVDFFDTAGTLYAVANQAGFVKDNKL
FT                   PRAQKALLADSSASVVGAVLGTSTTTAYIESSSGIAAGARSGFASIVTGILFLVALLFS
FT                   PLLVVVTSHVTAPALIIVGILMAGALGNIDFKKFEIAVPAFLTVIAMPLTYSIATGIAL
FT                   GFIFYPITMICTGKAKEVHPIMYALVPVFILYFVFH"
FT   gene            441098..441382
FT                   /locus_tag="Bcell_0405"
FT   CDS_pept        441098..441382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_25873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28687"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX8"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_25873"
FT                   /protein_id="ADU28687.1"
FT                   /translation="MRKIFKIIFVIILAVILLWVISGIIDFSLVNGFEKKPIFAIPTVT
FT                   ADDGGSGTYQGLGYSFEIEGDFMSVDEPPRVTYYEYYILGSLISKGNTD"
FT   gene            441508..442608
FT                   /locus_tag="Bcell_0406"
FT   CDS_pept        441508..442608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0406"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   KEGG: bpf:BpOF4_09625 naringenin-chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28688"
FT                   /db_xref="GOA:E6TVX9"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVX9"
FT                   /inference="protein motif:PFAM:PF00195"
FT                   /protein_id="ADU28688.1"
FT                   /translation="MPGILSVATKEPPYTMTQQETMEIVKNLFEQRYPNIDRLLTIFDN
FT                   GQIKKRNFVVPKEWFKEEHSFKDKNDIYIKEAIELSVDVIRKCLENSQHLKRNVSPAEI
FT                   AAIIFVSSTGIATPSIEARVMNRLPFSKSTKRIPIWGLGCAGGVAGIARAFEYCKAYPF
FT                   AKVLVINVELCSLTFMKDDMRKSNIIGTSLFADGVACTLVGGDEVLQKEKLSNKKLIPY
FT                   IVETESQLLRDSEQIMGWNVVNEGLQVVFSKDIPTVIKEWLKPNTLQFLEKQGYNINNI
FT                   AQFIAHPGGKKVLEAYEETLSISTEMTRHARKVLQEHGNMSSPTVIYVLQETMNQDVEK
FT                   GDVGLMVALGPGFCSELALLRWEEVE"
FT   gene            442605..443129
FT                   /locus_tag="Bcell_0407"
FT   CDS_pept        442605..443129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0407"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: gtn:GTNG_1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28689"
FT                   /db_xref="GOA:E6TVY0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY0"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ADU28689.1"
FT                   /translation="MIVYMFVLFIIVLQRIYELFIAKQNEIWMRERGAEEFGEDHYKWI
FT                   VLMHFCFFAALSIEVVLRGAELISWWPVVLSVFLTAQVARCWLIISLGRFWNTKIIVMP
FT                   GEKKVNKGLYKWIRHPNYVVVAVEILTLPLLFQAYVTAILFTLLNSAILIFVRIPVEEK
FT                   ALKFLSEGDHT"
FT   gene            443278..443478
FT                   /locus_tag="Bcell_0408"
FT   CDS_pept        443278..443478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28690"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY1"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0687"
FT                   /protein_id="ADU28690.1"
FT                   /translation="MTKKKKQKFYVEEGESISDCLERMDKEGYTPVRRMEEPILKEVKR
FT                   NGKTDIEVERQQIVFEGLLQK"
FT   gene            complement(443657..444244)
FT                   /locus_tag="Bcell_0409"
FT   CDS_pept        complement(443657..444244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0409"
FT                   /product="Coat F domain protein"
FT                   /note="PFAM: Coat F domain protein; KEGG: bld:BLi01950
FT                   YraD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28691"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY2"
FT                   /inference="protein motif:PFAM:PF07875"
FT                   /protein_id="ADU28691.1"
FT                   /translation="MNPNQMTEQSVATDLLLSAKTAVRNCAYALTECTSDNVRKTINQQ
FT                   LQQAIVFHENVADYMINKGYYHPYNMNEQIQVDQMAAQSTIQFTQMQQQQQPSQTMSST
FT                   TMGTMSQPTQPQQPDSLLPSTSLSMGVTDSQSSSPTSTGLSSYKSNTDSQTGYSSTMSS
FT                   IEDEYQQSGNQQSKSSQTPVDIDIDVSNEDDH"
FT   gene            complement(444260..444454)
FT                   /locus_tag="Bcell_0410"
FT   CDS_pept        complement(444260..444454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0410"
FT                   /product="spore coat protein"
FT                   /note="KEGG: spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28692"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY3"
FT                   /inference="similar to AA sequence:KEGG:GC56T3_1994"
FT                   /protein_id="ADU28692.1"
FT                   /translation="MNNQGLAIHEKAELHEMLVFKTNCLNKSQVAQNMVQDTQLKSLLQ
FT                   QDVQASKQSITTLQGLLNQ"
FT   gene            complement(444822..445193)
FT                   /locus_tag="Bcell_0411"
FT   CDS_pept        complement(444822..445193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0411"
FT                   /product="Protein of unknown function DUF2512"
FT                   /note="PFAM: Protein of unknown function DUF2512; KEGG:
FT                   baa:BA_3630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28693"
FT                   /db_xref="GOA:E6TVY4"
FT                   /db_xref="InterPro:IPR019649"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY4"
FT                   /inference="protein motif:PFAM:PF10710"
FT                   /protein_id="ADU28693.1"
FT                   /translation="MRHIIALAIKAMMVILVSVFVLSMFNGYPFLNTTLLALIITGAAY
FT                   IIGDIFILRATNNTVATISDIGLCTIAIWLIGPIVYGIAVPFSVALLTGVIIGAGEWFF
FT                   HKFMSNAVFEKDERLVGGH"
FT   gene            complement(445296..446750)
FT                   /locus_tag="Bcell_0412"
FT   CDS_pept        complement(445296..446750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0412"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: nth:Nther_1946 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28694"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY5"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADU28694.1"
FT                   /translation="MENPKLKKLAHSWLTSASLSEINHKLVREELTSRELVLMYLYRIA
FT                   TLDKDKINAIIEINPEALQTAEAMDKERAVKGPRGKLHGIPVLIKDNIATNDKMHTSAG
FT                   SVALADSFALKDAFIVKKLREAGAIILGKTNMTEWANFMGENMPTGYSSRGGQVTNPYG
FT                   SEFIVGGSSSGSGAAIAAGFATVAIGTETSGSILSPASQNSLVGIKPTVGLISRNGIIP
FT                   ISHTQDTAGPMTKTVEDAVLLLNGIVGVDENDPITKTNHKLQNIDFTTFLRSDGLKGAK
FT                   IGIAREVYFDYLSEDKAKVINGAIEKIKTLGADVVDITIPSTKSKWNIDVLKYEFKVGI
FT                   NTYLKEFTTCAKISSLTDIISFNENNRDVMLKYGQKMLLESNATSGTLTEKEYITSLEH
FT                   DQYHAKDNGIDAALKEVDAIVFPNNFGASIPAKAGYPSITIPAGFTDEGEPVGITFTSA
FT                   AFSEGILLSFAYAYEQATKERKAPNI"
FT   gene            447289..447774
FT                   /locus_tag="Bcell_0413"
FT   CDS_pept        447289..447774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0413"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: bcl:ABC1024
FT                   phosphoribosylaminoimidazole carboxylase catalytic subunit;
FT                   PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28695"
FT                   /db_xref="GOA:E6TVY6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E6TVY6"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADU28695.1"
FT                   /translation="MTAKVGVIMGSTSDWETMKHTTETLDELGVAYEKKVVSAHRTPDY
FT                   MFEYAEAAQGRGIQVIIAGAGGAAHLPGMVAAKTHLPVIGVPVQSKALNGMDSLLSIVQ
FT                   MPAGVPVATVAIGKAGATNAALLAAQQLAVHDEQLRQRLEERREAKRKDVLENGELI"
FT   gene            447771..448898
FT                   /locus_tag="Bcell_0414"
FT   CDS_pept        447771..448898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0414"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; KEGG: gwc:GWCH70_0254
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28696"
FT                   /db_xref="GOA:E6TWL3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL3"
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /protein_id="ADU28696.1"
FT                   /translation="MMANWIKPGSTVGILGGGQLGRMMALSAREMGYRVAVLEPTPDSP
FT                   CGQVADIQIKTAYNDHEGAKKLAENCDVLTYEFENIDASTANWLEENMYLPQGSKLLSI
FT                   TQDRITEKATIASFDIPVVPYRTVDTLVELKSAVEQLHLPAVLKTARGGYDGKGQRVIK
FT                   QMEDVSAAWEELAGKGPFVLESWLEFEKEISVIVTRSVHGETTTFPIAENIHQNNILHQ
FT                   SIVPARMNSKLEKEAVTIATHLADSLELVGTLAVEMFVGSDGLLYVNELAPRPHNSGHY
FT                   TINACVTSQFEQHIRAVCGWPLGSTELVKSVVMVNILGEHMPKVMENVTDLKGAKLHLY
FT                   GKSEAKIGRKMGHVNVLGDNVETILEQIERSPIWK"
FT   gene            448927..450222
FT                   /locus_tag="Bcell_0415"
FT   CDS_pept        448927..450222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0415"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28697"
FT                   /db_xref="GOA:E6TWL4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL4"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADU28697.1"
FT                   /translation="MIERYTRPEMGAIWTEENRFQAWLEVEIQACEAWAELGDIPKEDV
FT                   KKIRENAGFNVDRIKEIEEETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALSY
FT                   LLRQANEIIEKDLINFINILKDKAKEHKMTVMMGRTHGVHAEPTTFGLKLALWYEEMKR
FT                   NLERFRAAAETVRVGKISGAVGTYANIDPFVEKYVCEGLGLEASPISTQTLQRDRHAHY
FT                   VATLSLIASSIEKMAVEVRALQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVLRGHVVTAYENVALWHERDISHSSAERVILPDATIMINYMLNRFGNIVKNLTVFPDN
FT                   MKRNMDRTYGLIYSQRVLLTLIDKGMAREEAYDLVQPKAMEAWEKAVPFRSLVEANEQI
FT                   MSHLSKEELDDCFDYHHHLKHVDTIFDRLGLN"
FT   gene            450336..451049
FT                   /locus_tag="Bcell_0416"
FT   CDS_pept        450336..451049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0416"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28698"
FT                   /db_xref="GOA:E6TWL5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL5"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADU28698.1"
FT                   /translation="MQKGACLYEGKAKRIYKTETPGVLWVEYKDDATAFNGEKKDVLTG
FT                   KGRLNNEISSLIFTQLKQEGIDSHFIERLSSNEQLIKEVEIVPIEVVVRNVAAGSLVKR
FT                   LGIERATAFNPPIVEFYYKDDALGDPIITDEHVRVMNLASKEEVDQLKDMALQVNEHLK
FT                   QMFKKVGIQLVDFKLEFGRDQTGAILLADEISPDTCRLWDEETGESFDKDLFRFQLGNL
FT                   QDGYETILTRLGGLK"
FT   gene            451049..451303
FT                   /locus_tag="Bcell_0417"
FT   CDS_pept        451049..451303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0417"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: purS; phosphoribosylformylglycinamidine
FT                   synthase, PurS protein; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28699"
FT                   /db_xref="GOA:E6TWL6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL6"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADU28699.1"
FT                   /translation="MYEVKVFVSLKEAVLDPQGAAVKGSLHHLGFEGVEEVRIGKVMTL
FT                   RIESTADKIEAEVKEMCEKLLANPVIEDYRFEIEEVVSQ"
FT   gene            451300..451983
FT                   /locus_tag="Bcell_0418"
FT   CDS_pept        451300..451983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0418"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: bpu:BPUM_0601 phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28700"
FT                   /db_xref="GOA:E6TWL7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL7"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADU28700.1"
FT                   /translation="MKFAVIVFPGSNCDLDMYHAVKDELGVEAEYVWHDETSLEGFDGV
FT                   LLPGGFSYGDYLRCGAIARFSPIMDAVIQAANEGKPVLGVCNGFQILLEAGLLPGAMRR
FT                   NKNLKFICRPVQLVVENNETLFTNGYAKGQEITIPVAHGEGNYYCDDDLLQKLVANKQI
FT                   VFSYQSDVNGSVNDIAGITNEAGNVLGMMPHPERAVDSLLGSDDGLTLFKSILSHWRER
FT                   NAITS"
FT   gene            451967..454189
FT                   /locus_tag="Bcell_0419"
FT   CDS_pept        451967..454189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0419"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; KEGG: bha:BH0629 phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28701"
FT                   /db_xref="GOA:E6TWL8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL8"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADU28701.1"
FT                   /translation="MQLLHEPSPQMIKDERIYAEMGVTDEEFRMVENILGRLPNYTEIG
FT                   LFSVMWSEHCSYKNSKVVLKKFPTTGEKVLQGPGEGAGIIDIGDEQAVVFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDIFSMGARPVGLLNSLRFGELETPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEIQFDPCYDGNPLVNAMCVGLIDHKDIQKGQAKGVGNSVIYVGASTGRDG
FT                   IHGATFASEELSEASEAKRPAVQVGDPFMEKLLLEACLEAIQNDALVGIQDMGAAGLTS
FT                   SSAEMASKAGSGIEMDLDKVPQREKGMTAYEMMLSESQERMLLVVEAGREQEMIDIFER
FT                   WGLEAVVVGKVTDDKKLRLLHKGEVVADVPVDSLAEDAPVYHKPSKEPAYYSQFQNEAP
FT                   FKPAVADMKETLAQLLAQPTIASKEWVYDQYDYMVRTNTVVAPGSDAAVLRIRDTEKAI
FT                   AMTTDCNSRYIYLDPYVGGQIAIAEAARNLVCSGAKPLGVTDCLNYGSPEKPEIFWQLE
FT                   KSTDGLSNACEVLETPVIGGNVSLYNETNGVAVYPTPVIGMVGLVENVDHITKQQFQQA
FT                   GDLIYVIGEAGDDFGGSELQKLQKGAISGKAPAIDLSVEKARQDQVLAAIQAGTVSSAH
FT                   DLAEGGFLVALAECTFGTQLGAKVTLQGEDVVKESFAETPSRYIITVAKDNQSAFEALI
FT                   PDATLVGEVTKEATLTVQDQAGKSVLTEEVSKLEDTWRGAISCLLK"
FT   gene            454174..455586
FT                   /locus_tag="Bcell_0420"
FT   CDS_pept        454174..455586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0420"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: bpf:BpOF4_09680
FT                   amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28702"
FT                   /db_xref="GOA:E6TWL9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWL9"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADU28702.1"
FT                   /translation="MFAEIKGLNEECGVFGVWGHKDPAPIAYYGLHSLQHRGQEGAGIV
FT                   VSDGEKLKAHKGMGLVNDVFGKGEINDMHGKGAIGHVRYTTAGDSNLLNVQPFVFNSQT
FT                   GSLALAHNGNLVNANALKHQLERQGSIFQTTSDTEVVAHLIKRSGYDTIEERIKNALTM
FT                   IKGAYAFIFMIEGKMMAALDPNGLRPLSIARLGDGYAISSETCAFDIIGAEYLREVEPG
FT                   ELVIIDDDGLRSERFSSSPKRAICSMEYVYFARPDSNVDEINVHQARKNLGKQLAEEQP
FT                   VEADVVTGVPDSSISAAIGYAEQAGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSRRIVKLLREAGALEVHVRISAPPITNPCFYGIDTS
FT                   TKGELIASVKTVEEIREEIGADSLSFLSVEGLQKGIGRSPEMENHGQCLACFTGSYPTE
FT                   IYPETDHPQEKC"
FT   gene            455602..456639
FT                   /locus_tag="Bcell_0421"
FT   CDS_pept        455602..456639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0421"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28703"
FT                   /db_xref="GOA:E6TWM0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM0"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADU28703.1"
FT                   /translation="MSKAYESAGVNIEAGYEGVRRIKKHVESTKRPEVLGSLGSFGGLF
FT                   DLSSFTYKEPVLVSGTDGVGTKLLIAQEMGKHDTIGIDAVAMCVNDIIVQGASPLFFLD
FT                   YLALGVNDPEVVEQVVSGIAEGCRQSGAALIGGETAEMPGLYKPEEYDVAGFVVGIAEK
FT                   SQLFDPTNVAAGDVLIGITSSGVHSNGFSLVRKIVAEQGLSWSDPFGDSGKSIGEVFIE
FT                   PTRIYVKTLKPFLSNGLVKAAAHITGGGLIENVPRMLPEGLGAEINVDAWELPQVFQWL
FT                   KEKGNLTAIDLYETFNAGIGLVLTVKASDADEVIKTLTENGESPKVIGEVVTGTGVTFK
FT                   GEGVS"
FT   gene            456636..457214
FT                   /locus_tag="Bcell_0422"
FT   CDS_pept        456636..457214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0422"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: bcq:BCQ_0349 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28704"
FT                   /db_xref="GOA:E6TWM1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM1"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADU28704.1"
FT                   /translation="MNLGVFASGSGSNFEAIMEAVKSGAVAGKVQLLVCDKEDAYAIKR
FT                   AENHGVPVFTYQPKVFASKEAYETEILRQLQAYNVELIVLAGYMRLIGSTLLSAFEHRI
FT                   VNIHPSLLPAFPGLDAIGQAFDAKVKVSGVTVHYVDAGMDTGPIIAQEAIHIEDGDTKE
FT                   DVQRKIQQVEHQLYPKTIQGVIEQITRGV"
FT   gene            457218..458753
FT                   /locus_tag="Bcell_0423"
FT   CDS_pept        457218..458753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0423"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="SMART: AICARFT/IMPCHase bienzyme formylation region;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; KEGG:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28705"
FT                   /db_xref="GOA:E6TWM2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM2"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADU28705.1"
FT                   /translation="MKKRALVSVSDKTGIIPFVQKLESLGVEIISTGGTKKALAEAGVK
FT                   VIGIEDVTQFPEMMDGRVKTLHPNIHGGLLARRDVDAHMNAAKEHGIELIDFVIVNLYP
FT                   FQQTIEKPASTYADAIENIDIGGPSMIRSAAKNHASVSIIVDADDYDVVIEELEANGEV
FT                   SVERKRKLAAKAFRHTAAYDALIAEYLTKQVGEETPEKLTVTYNLKQTLRYGENPHQKA
FT                   SFYEKPLGNLTSIARAKQLHGKELSYNNINDADAALAVIRDFKEPAVSAIKHMNPCGVG
FT                   VGENVYEAYMKAFEADPVSIFGGIVASNREVDAMTAEKMKEIFLEIVIAPSFTEEALEI
FT                   LTEKKNLRLLTVDFAADQPVEQFVKSVAGGALLQDEDTLSYEDVTLKIATKREPTEDEL
FT                   KQLKMAWNVVKHVKSNAIVLGKADQTIGIGAGQMNRVGAAKIAIEQAGEQAKGAVLASD
FT                   AFFPMNDTVEAAAKAGITAIIQPGGSVKDQDSIDKADEYGITMVFTGVRHFKH"
FT   gene            458958..460232
FT                   /locus_tag="Bcell_0424"
FT   CDS_pept        458958..460232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0424"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28706"
FT                   /db_xref="GOA:E6TWM3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM3"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADU28706.1"
FT                   /translation="MKVLVVGSGGREHALCWKLKQSSKVTEVYAAPGSAGIAEDGIFNV
FT                   DINENDHEGLIAFAKEQSIALTVVGPEAPLVSGIVDFFQAEGLTVFGPTKAAATLEGSK
FT                   QFAKEIMKKYDIPTAAYEVFTDVEEAKAYVRKQGAPIVVKADGLAAGKGVIVAETEEQA
FT                   LVALDDIMGARTFGDAGASVVIEDCLRGEELSLMAFVHGETVLPMVPAQDHKRAFDGDA
FT                   GPNTGGMGAYSPVPHIDANLVAEAEATILRPMAKAMVAEGVPFTGILYAGLMMTEDGPK
FT                   VIEFNARFGDPETQVVLPRLETDLVDVIESTLSSKEIELEWTDKACAGVVLASEGYPGS
FT                   YPKGTPMSVPSDVVEGQKWFHAGTKKTADGWATNGGRVILLSSLGEDLHAALEKTYEVL
FT                   NAHEWEGLFYRSDIGSRAVNLSNKK"
FT   gene            460979..461302
FT                   /locus_tag="Bcell_0425"
FT   CDS_pept        460979..461302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcx:BCA_2187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28707"
FT                   /db_xref="GOA:E6TWM4"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM4"
FT                   /inference="similar to AA sequence:KEGG:BCA_2187"
FT                   /protein_id="ADU28707.1"
FT                   /translation="MSIKKLLWKLFFIIISLGAQFGITFLVYEQLNTHHFFDVMFFTAI
FT                   LFVVITIFFSSSGGFNMAHYKAERIYSQKSFKMERFSMNVNSFVISSVLFLIIYILLEV
FT                   FVR"
FT   sig_peptide     460979..461068
FT                   /locus_tag="Bcell_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.583 at
FT                   residue 30"
FT   gene            complement(461392..461673)
FT                   /locus_tag="Bcell_0426"
FT   CDS_pept        complement(461392..461673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_09710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28708"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM5"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_09710"
FT                   /protein_id="ADU28708.1"
FT                   /translation="MKQNIGTLNALIRITCGFSILAWATAKLVRRSNETMPLLLAMMGA
FT                   MKVAEGFTRFCPLTYIAEQSMDKNNDNTSYRSTHHTESANGSEPINPT"
FT   sig_peptide     complement(461599..461673)
FT                   /locus_tag="Bcell_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.649) with cleavage site probability 0.612 at
FT                   residue 25"
FT   gene            461783..463531
FT                   /locus_tag="Bcell_0427"
FT   CDS_pept        461783..463531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0427"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28709"
FT                   /db_xref="GOA:E6TWM6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM6"
FT                   /inference="protein motif:PRIAM:3.5.4.2"
FT                   /protein_id="ADU28709.1"
FT                   /translation="MVKGFSHYWTKREIRQQLEVIRGNLAPTKVITNAKWLNSVRKCWN
FT                   KGNIWIYNDRIVYVGDQLPKLMPHETEIFDASSKYAVPGYIEHHAHPFQLYNPLSLAQY
FT                   ASERGTTTLINDNLLFFLHLSKKKALTLLDNLQKTPATLLWWARYDSQTELHNEEEVFA
FT                   YSNMRTWINHPYVVQGGELTGWPSVLNGDDSILHWMQETKDVKKPIEGHFPGASEKTLT
FT                   QMALLGVDGDHESMTGEDVIRRLDMGMTASLRYSSIRPDLPNLLSELHEAGLDQYESLL
FT                   MTTDGSTPSFMKNGMMEHLIKIALDNGVPFMDAIAMCTYNVAKHYHMDDMLGMIAPGRI
FT                   ANINFLSSTEDPLPTDVLAKGQWVRKQDTPCFPNIDMSWNEYDLSPLNIDWDLQESDFH
FT                   FSLPVGVEMANDVILKPYRIISDLTRETLSEENDECFFILVDRSGKWILSTAIKGFGKS
FT                   LYGFASTFNHTGDIILIGKSKQGLLKAFDQLKKQQGGIVLLDEDKMVFSMNLPLNGMMS
FT                   EETMEKVMEQEATLKEALKGRGYRFNDPIYSLLFFASTHLPYVRVTQKGIFDVKKKKVL
FT                   FPSIMR"
FT   gene            463569..464651
FT                   /locus_tag="Bcell_0428"
FT   CDS_pept        463569..464651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28710"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM7"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0716"
FT                   /protein_id="ADU28710.1"
FT                   /translation="MKRLILTVFVISLFFLVACKSEEETAKEEPREEEKVEIIESEEPE
FT                   EEPLPPFPLTGLGSEEGEFEYRAFGVMIENSMSARPQSGLYQADVVYEVLSEGSITRLL
FT                   AIYHSQQPERIGPVRSARSYYVHLNKGFDAIYASAGGSPGGLQLAESDYVDNISGLVYD
FT                   GRFFSRSTDRVAPHNMYTTYDDLKAATDHLGYEWERQPPSLYFVDELEENAGEKVDYFE
FT                   VKYGSTNNDVQYEYDEQLKKYVRYNGGQPTEDLETGEAVAPKNVFIVEMSHRVIPKEEN
FT                   HIDAGSNRREIDVESGGRAYLMQEGTLQEVEWKNVDGIILPFKDDQQVPFLPGQTWVNI
FT                   VPTNGGGLESYVSLSNNTVD"
FT   gene            464711..465016
FT                   /locus_tag="Bcell_0429"
FT   CDS_pept        464711..465016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0429"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="KEGG: TrpR like protein, YerC/YecD; TIGRFAM: TrpR
FT                   like protein, YerC/YecD; PFAM: Trp repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28711"
FT                   /db_xref="GOA:E6TWM8"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM8"
FT                   /inference="protein motif:TFAM:TIGR02531"
FT                   /protein_id="ADU28711.1"
FT                   /translation="MQINKLRGKELDQLFEAILSLKDLEECYQFFDDLCTMNEIQSLAQ
FT                   RLEVARMLMEGYTYQRIEKDTGASTATISRVKRCINYGNDGYKFTLERVHGELKEK"
FT   gene            465781..466467
FT                   /locus_tag="Bcell_0430"
FT   CDS_pept        465781..466467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0430"
FT                   /product="geranylgeranylglyceryl phosphate synthase family
FT                   protein"
FT                   /EC_number="2.5.1.41"
FT                   /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; KEGG: bpf:BpOF4_09850
FT                   geranylgeranylglyceryl phosphate synthase-like protein;
FT                   PFAM: PcrB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28712"
FT                   /db_xref="GOA:E6TWM9"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWM9"
FT                   /inference="protein motif:TFAM:TIGR01768"
FT                   /protein_id="ADU28712.1"
FT                   /translation="MKQYKEWKHAFKLDPNKEISDEDLELLCESGTDGIIVGGSDGVTE
FT                   ENTIDLLMRIRRYSVACALEVSNLYSIVPGYDYYFIPSVVNTTNATWINGLHHRALKEY
FT                   GHLMNWDEVVTEGYCVLNQSSKVAQLTDANTELDSEDVIAYARMADKLFHMPVFYLEYS
FT                   GKYGDPDIVAEVKYVLEHCRLFYGGGIESFEQAKEMAQHADTIIVGNVIYTDIKEALKT
FT                   VNAVQE"
FT   gene            466537..468819
FT                   /locus_tag="Bcell_0431"
FT   CDS_pept        466537..468819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0431"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="KEGG: ATP-dependent DNA helicase PcrA; TIGRFAM:
FT                   ATP-dependent DNA helicase PcrA; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28713"
FT                   /db_xref="GOA:E6TWN0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN0"
FT                   /inference="protein motif:TFAM:TIGR01073"
FT                   /protein_id="ADU28713.1"
FT                   /translation="MERIKQQLLDGLNKEQGEAVKHGDGPLLIMAGAGSGKTRVLTHRI
FT                   AYLIGEKGVPPWSILAITFTNKAAREMKERVARIASTAEEIWISTFHSMCVRILRRDID
FT                   RIGTSRNFTILDSGDQLTVIKRILKELNIDVKRYEPRSILGTISSAKNELKTPKDYEKT
FT                   ASGPYELTVLKVYEAYTKELKKNQALDFDDLIMTTIKLFKQVPEVLEYYQRRFRYVMVD
FT                   EYQDTNRAQYVLVKMMADRHQNICVVGDSDQSIYRWRGADIQNILSFENDYPNVNVIML
FT                   EQNYRSTKKILQAANEVIENNSNRKPKKLWTQNDDGEKIKFYEADSEHDEAQYVVGKIK
FT                   EATDSGRYRASDISILYRTNAQSRVMEEMLVKSNIPYTIVGGTKFYDRKEIKDLLAYLR
FT                   LVANPDDDISFRRIINVPRRGIGATTLAKIDDYAARNDLSIFQALQEVRHIGLSPRFEK
FT                   TLTEFIEQINGWVQMQDYLPVTELVDELLDKTGYREMLKNEKNLEAEARLENINEFLTV
FT                   TQEFEKTSEDKTLVAFLTDLALIADIDKVDDDGNQEDQVLLMTLHSAKGLEFPLVFLIG
FT                   LEEGVFPHSRSLMEEAEMEEERRLAYVGITRAEQELCISRARMRTLYGRTNMNPPSRFL
FT                   NEIPDDCVEHVNPKEDNSMPDWMKTTRSHTSSGTGAHFSSSNRRGAARPTNTAAPRGTV
FT                   TQRSKTTVTGGQSFDWAVGDKASHNKWGVGTVVSMKGDGENIELDIAFPAVGVKRLFAK
FT                   FAPITKQ"
FT   gene            468832..470844
FT                   /locus_tag="Bcell_0432"
FT   CDS_pept        468832..470844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0432"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="SMART: NAD-dependent DNA ligase ;
FT                   Helix-hairpin-helix DNA-binding class 1; BRCT domain
FT                   protein; TIGRFAM: DNA ligase, NAD-dependent; KEGG: DNA
FT                   ligase, NAD-dependent; PFAM: NAD-dependent DNA ligase
FT                   adenylation; NAD-dependent DNA ligase OB-fold;
FT                   helix-hairpin-helix motif; BRCT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28714"
FT                   /db_xref="GOA:E6TWN1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN1"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ADU28714.1"
FT                   /translation="MAKDDIKQEIDRLTNILNDYAYHYYVLDQPKVSDAEYDQLLHELT
FT                   KLEEAYPEWKRDDSPSERVGGQPLEHFSKVQHDVPMLSLSNAFNEEELRDFDRRVRQGL
FT                   GHEPTYSCELKIDGLAVTLKYEQGRFVQGATRGDGTVGEDITSNLKTVPSIPLRLKEAV
FT                   TIEVRGEAFMPKRSFIRLNEAKEKNGEQLFANPRNAAAGSLRQLDPKIAAKRSLDIFIY
FT                   SVGKVEGEDIPSHHGALNYVKELGFKTNEHQKHCKTIDEVIDYCESWLSKRADLPYEID
FT                   GIVIKVDALADQEQLGFTAKSPRWATAYKFPAEEVVTTLLDIELSVGRTGVITPTAILE
FT                   PVSVAGTTVQRASLHNEDLIRELDLKLGDKVTIKKAGDIIPEVVNVLVEQRTGEERDFS
FT                   MPTQCPECHSELIRIEGEVALRCVNPKCPAQIREGLIHFVSRNAMNIDGLGERVITQLF
FT                   NHKLIEDVADLYKLERQLLLNLERMGEKSVDNLLRAIEASKENSLEKLLFGLGIRHVGA
FT                   KAAKTLAQHFNTIDQIQNATREDLEAINEVGEKMADAVVTYFETPEVKELISELEALDI
FT                   NLEYKGPNINVSDDANNAYFSGKTVVLTGTMEQMARGDAKKEIEARGGNVTGSVSSKTD
FT                   LLIAGEKSGSKLKKAQDLNIEIWDEARFLEELTKE"
FT   gene            470885..472063
FT                   /locus_tag="Bcell_0433"
FT   CDS_pept        470885..472063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0433"
FT                   /product="CamS sex pheromone cAM373 family protein"
FT                   /note="PFAM: CamS sex pheromone cAM373 family protein;
FT                   KEGG: CamS sex pheromone cAM373 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28715"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN2"
FT                   /inference="protein motif:PFAM:PF07537"
FT                   /protein_id="ADU28715.1"
FT                   /translation="MKRKLSIVCISFLLLLTGCIPTLDRGEEEIIVVEQTEETEEQHFV
FT                   ITPTIDTPENYYRNLLPDGIYHRSEARGTVAHTMNNRIDMNQFELGLMEIATARYSQED
FT                   FYFQEGELLTGNTINSWLRRYNPNEDRYRFGLNPPLGEGDDLEEQMRKSPIVLSHVMEH
FT                   NYVQRNDDGEIMLGGIVIGLSLNSVYYFRTEDEEGRYYFHEEPIEPEDAEAAGKEMAEQ
FT                   VVERIRARDGLENVPITIALYQEERRGAIVPGTFISMAHISGEDAFINDWEEINEQFFF
FT                   FPSSNARTVHPNLSNSFGQFKDEVEEFFGRSMGIVGKGRYKNDALDELTIEFNLQSHGK
FT                   AEIIALTQFVSGKVSSLFTFDAPINVYINSVNGPEAIIIQYPGEDPYIHVYK"
FT   gene            473080..473370
FT                   /locus_tag="Bcell_0434"
FT   CDS_pept        473080..473370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0434"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="KEGG: gtn:GTNG_0261 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit C; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28716"
FT                   /db_xref="GOA:E6TWN3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN3"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADU28716.1"
FT                   /translation="MARISKEQVEHVANLARLEFTNEEIDMFQQQLDDIIGYAEQLNEL
FT                   DTSNVKPTSHVLDIKNVLREDEVKPSLEREKVLKNAPDHEDGQFKVPSVLE"
FT   gene            473385..474842
FT                   /locus_tag="Bcell_0435"
FT   CDS_pept        473385..474842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0435"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="KEGG: bpu:BPUM_0645 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28717"
FT                   /db_xref="GOA:E6TWN4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN4"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADU28717.1"
FT                   /translation="MSLFDHKIADIHELLHKKELSVTDLVNESYNRINQVESKVDAFLH
FT                   LTEELARAKAKELDEQLGAIQTLEGTLFGLPIGIKDNIVTKGIRTTCASKLLENFEPQH
FT                   NATVVNKLADARAITIGKLNMDEFAMGSSNENSGYKLTRNPWDLNRVPGGSSGGSAASV
FT                   AAGEVLFSLGSDTGGSIREPASFCGVVGMKPTYGRVSRFGLVAFASSLDQIGPITRNVE
FT                   DNAYVLQAISGHDKMDSTSANVDVPSFTNGLNGDIKGLKVAVPSEYIGEGVSSEVREQV
FT                   MQALKTLESLGATWEEVSLPHSKYATAAYYLLASSEASANLARFDGIRYGVRVEEENLI
FT                   ETYRKSRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKQDFENVFEKYDVI
FT                   IGPTAPTTAFKIGEKTDDPLTMYATDILTIPVNLAGVPAISVPSGLAGGLPVGLQIIGK
FT                   HFDEATVYRVAYAFEQATNFNEQKPKL"
FT   gene            474856..476289
FT                   /locus_tag="Bcell_0436"
FT   CDS_pept        474856..476289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0436"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="KEGG: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; Asn/Gln amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28718"
FT                   /db_xref="GOA:E6TWN5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN5"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADU28718.1"
FT                   /translation="MKYETIVGLEVHVELKTKSKIFCGCSTEFGAPPNTHTCPICLGHP
FT                   GVLPVLNKQAVEFAMRAAMALNCEVAEVTKFDRKNYFYPDNPKAYQISQFDKPVGEHGW
FT                   IDIEVNGETKRIGITRLHLEEDAGKLTHVDGMGHSLVDFNRVGTPLIEIVSEPDIRTPE
FT                   EAYAYLEKLKAIMQYIEVSDCKMEEGSLRCDANISLRPVGQEEFGTKTELKNLNSFAFV
FT                   QKGLAYEQERQAEVLSSGGEILQETRRWDEKANKTLLMRVKEGSDDYRYFPDPDLVEFH
FT                   IDAAWREKVEKQIPELPDARRKRYINELDLPAYDASVLTQQKSVSDFFEACLAEGGPAK
FT                   PVSNWVMGEVSRYLNAEEKEIEDIPMTPKSLVNMISLIEKGTISSKIAKQVFSELMENG
FT                   GDPEEIVKDKGLVQISDEGEILKMVNDVLDQNPQSVDDFKAGKKKAVGFLVGQIMKASK
FT                   GKANPQLVNKMLVEEMNKR"
FT   gene            477022..478251
FT                   /locus_tag="Bcell_0437"
FT   CDS_pept        477022..478251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0437"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 5;
FT                   Carbohydrate-binding family V/XII; KEGG: pct:PC1_2337
FT                   glycoside hydrolase family 5; SMART: Carbohydrate-binding
FT                   family V/XII"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28719"
FT                   /db_xref="GOA:E6TWN6"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN6"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADU28719.1"
FT                   /translation="MKKITTIFVVLLMTLALFIIGNTTAADDYSVVEEHGQLSISNGEL
FT                   VNDRGEPVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGITVFRAAMYTSSGGYIEDPSV
FT                   KEKVKEAVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIA
FT                   NEPNGSDVTWDNQIKPYAEEVIPVIRNNDPNNIIIVGTGTWSQDVHHAADNQLTDPNVM
FT                   YAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDER
FT                   NLSWANWSLTHKDESSAALMPGASPTGGWTEAELSPSGTFVREKIRESATTPPSDPTPP
FT                   SDPDPGEPEPDPGEPDPTPPSDPGDYPAWDPNTIYTDEIVYHNGQLWQAKWWTQNQEPG
FT                   DPYGPWEPLN"
FT   sig_peptide     477022..477099
FT                   /locus_tag="Bcell_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 26"
FT   gene            478806..480272
FT                   /locus_tag="Bcell_0438"
FT   CDS_pept        478806..480272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0438"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 5;
FT                   Carbohydrate-binding family V/XII; KEGG: bsu:BSU18130
FT                   endo-1,4-beta-glucanase; SMART: Carbohydrate-binding family
FT                   V/XII"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28720"
FT                   /db_xref="GOA:E6TWN7"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN7"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADU28720.1"
FT                   /translation="MKKLTTIFIVFTLALLFVGNSTSANNGSVVEQNGQLSIQNGQLVN
FT                   EHGDPVQLKGMSSHGLQWYGQFVNYDSIKWLRDDWGITVFRAAMYTSSGGYIEDPSVKE
FT                   KVKEAVEAAIDLGIYVIIDWHILSDNDPNIYKEEAKEFFDEMSALYGDYPNVIYEIANE
FT                   PNGHNVRWDSHIKPYAEEVIPVIRANDPNNIVIVGTATWSQDVHEAADNQLDDPNVMYA
FT                   FHFYAGTHGQQLRNQVDYALSRGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNL
FT                   SWANWSLTHKDESSAALMPGANPTGGWTAAELSPSGAFVREKIRESASIPPSDPTPPSD
FT                   PDPGEPDPTPPSDPGEYPAWDPNQIYTNEIVYHNGQLWQAKWWTQNQEPGANQYGPWEP
FT                   LGDAPPSEPSDPPPPSEPEPDPGEPDPGEPDPGEPDPTPPSDPGEYPAWDPTQIYTNEI
FT                   VYHNGQLWQAKWWTQNQEPGYPYGPWEPLN"
FT   sig_peptide     478806..478877
FT                   /locus_tag="Bcell_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.570 at
FT                   residue 24"
FT   gene            complement(480332..481192)
FT                   /locus_tag="Bcell_0439"
FT   CDS_pept        complement(480332..481192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0439"
FT                   /product="amidinotransferase"
FT                   /note="PFAM: amidinotransferase; KEGG: bha:BH1779
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28721"
FT                   /db_xref="GOA:E6TWN8"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN8"
FT                   /inference="protein motif:PFAM:PF02274"
FT                   /protein_id="ADU28721.1"
FT                   /translation="MSILSKQTDKTYCRTEYDTLKRVVLCEPKHMHIREQINDTQKHFA
FT                   NEGLHIELAMEQHQHFVKALEKHGVEVILLPPNSKYPEQVFTRDIGFTLGQTTFVAEMA
FT                   HGARIGEENILKEWLESKEIPYYNLLGDMVEGGDVIINGHQIFIGLSNRTNQNAINHIQ
FT                   KLLHEYEVITVPFTEKYLHLDCVFNIISENEALYFPRAFDKKEEKILAKHFDLIEVNEE
FT                   EQFTLGTNVLSIGKKRIVSLPINREVNQQLRIRGYEVIEVDITEIIKSGGSFRCCTMPL
FT                   VRAKD"
FT   gene            complement(481415..481897)
FT                   /locus_tag="Bcell_0440"
FT   CDS_pept        complement(481415..481897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28722"
FT                   /db_xref="GOA:E6TWN9"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWN9"
FT                   /inference="similar to AA sequence:KEGG:OB0512"
FT                   /protein_id="ADU28722.1"
FT                   /translation="MSKFIHRFFISVLSVVIFSAILAGYTYLFSSGEQLGFGLLLGIYS
FT                   FYTAPVFILGGIPATYIVDFFVKNRNTEVRTKLEAYCRNFALYALAGIAVAMVYSAITS
FT                   LANGNFFFTLGDSLLSIVIGLAAAAVYYNISLLLQINWEKMKEQYEKEQQANESNF"
FT   sig_peptide     complement(481823..481897)
FT                   /locus_tag="Bcell_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.279 at
FT                   residue 25"
FT   gene            482149..483063
FT                   /locus_tag="Bcell_0441"
FT   CDS_pept        482149..483063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0441"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: diacylglycerol kinase catalytic region; PFAM:
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28723"
FT                   /db_xref="GOA:E6TWP0"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP0"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADU28723.1"
FT                   /translation="MKRCRLIYNPSSGREQVKKQLPYILEQLEITGYETSTHATTGKDC
FT                   AKKAARLAAERGFDLVIAAGGDGTINEVVNGLAEQPNRPMLGVIPAGTTNDFARALHIP
FT                   RDIREATDVLCNGTEQYVDVGKVGGQFFINIAGAGTLTELTYEVPSKLKTMIGQVAYYV
FT                   KGFEKLPRIRPTEVTIEYDGKWFEGEIMLFLVSNTNSVGGFEKLAPKAYLNDGLFDLLI
FT                   LKKTNLADVVRVVSAALRGEHIHDDCVIYVQASRIKIHSKTEMHLNLDGEYGGDLPGEF
FT                   TNLHNHIKMIVPNKKLAVFQDLY"
FT   gene            complement(483280..484182)
FT                   /locus_tag="Bcell_0442"
FT   CDS_pept        complement(483280..484182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28724"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP1"
FT                   /inference="similar to AA sequence:KEGG:BH1891"
FT                   /protein_id="ADU28724.1"
FT                   /translation="MIKLSQEKYALAVHYIHHYARPIDRALFEYHFNSGSSLEVMQQLQ
FT                   FYQNEDGGVGHGLEPDIRSKFSSPIVSTVALQYAREVKASWEHPFIQSVMKYFTDTYYS
FT                   FETWPLKLSHMNEFPHADWWKHSEDVTSFQANPGVEIVGYYHAYPQAIPEQLFHIFQES
FT                   VFQHLDNQHKTPEYHEVLCYLRLVEEMPDPGKTMIVEYLRDSIRDIATLDHTQWGGYCA
FT                   KPLSLAPSPNAAMFNALEDVIQKNLDYEINNQKEDGSWEPFWEWGQYKDEWETRVKQEW
FT                   KGYLTVQMLKTLKNYERIE"
FT   gene            484431..485366
FT                   /locus_tag="Bcell_0443"
FT   CDS_pept        484431..485366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0443"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: lin:lin1677 hypothetical protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28725"
FT                   /db_xref="GOA:E6TWP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28725.1"
FT                   /translation="MSSYALEVEGLTKIVGGNKRIVDEATFQMDKGEILGLLGPNGAGK
FT                   TTTIRMIVGLISKSEGKVIINGRDLDSEGQRCKEEIGAIIENPAFYDHMSGFKNLKQYA
FT                   RMARQEITDERIMDVVKLVKMDHAIHDKVKKYSLGMKQRLGVAQAILHKPAVLILDEPT
FT                   NGLDPQGIRDLRDYLKILAQQGTSTLVSSHLLSEMQLMCDRVAIMEHGKIIDVSSISAL
FT                   NDNGDEDELIVSFKVKQLDEASALVEKSELEVTNVADENNSLQLKMKSEMIPKINKLLV
FT                   ENNIDVYAIESAKTSLEEKFLKLTTVSEKG"
FT   gene            485381..486343
FT                   /locus_tag="Bcell_0444"
FT   CDS_pept        485381..486343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi00970 YhcI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28726"
FT                   /db_xref="GOA:E6TWP3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP3"
FT                   /inference="similar to AA sequence:KEGG:BLi00970"
FT                   /protein_id="ADU28726.1"
FT                   /translation="MWQLFKNEWIKLWSKKQNWFFIGALIIITIFVGIMHNQLMSDPYA
FT                   SETGDWQVGLEMEIAHQEEIIATTDEEWEKEWAQELINEHEAYLEAGVDPTATTNMTFI
FT                   NSTLLGIASFITLFSVIVSSTIVSSEVNSGTIKQLVIRPYERWQFLLSKFMIVVVYMLI
FT                   LIATLFITNFLIGTIFYEAGSFSDPIIERSFMGETAEWTVGPLIFAKIGLYILNTLVFI
FT                   VISFSLSTLFKNQALAVGIGIFTLFATSMLSQSLVFFLEDTAWFKFIFISHLNLPQYVA
FT                   QETLMEGVTLPFSLVVLSIYVIVFLAITTVFFQKRDIAY"
FT   gene            486543..486728
FT                   /locus_tag="Bcell_0445"
FT   CDS_pept        486543..486728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_22220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28727"
FT                   /db_xref="GOA:E6TWP4"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP4"
FT                   /inference="similar to AA sequence:KEGG:BBR47_22220"
FT                   /protein_id="ADU28727.1"
FT                   /translation="MTMLLFVALALGVVMITALELTESSTYGRGMKPFLREFKKALYFI
FT                   LPLFVLALIIYYIFLF"
FT   sig_peptide     486543..486599
FT                   /locus_tag="Bcell_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.371 at
FT                   residue 19"
FT   gene            486821..487063
FT                   /locus_tag="Bcell_0446"
FT   CDS_pept        486821..487063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_3449 putative GtrC"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28728"
FT                   /db_xref="GOA:E6TWP5"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP5"
FT                   /inference="similar to AA sequence:KEGG:CJA_3449"
FT                   /protein_id="ADU28728.1"
FT                   /translation="MKKLARWRDKYFLRMRPLLIMMATIILLGVIVEAIFPNDTTLRSY
FT                   IFTILGGAFIVVWFIFSYYVIFYLTPWGRRLTNKD"
FT   sig_peptide     486821..486925
FT                   /locus_tag="Bcell_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.530 at
FT                   residue 35"
FT   gene            complement(487207..488448)
FT                   /locus_tag="Bcell_0447"
FT   CDS_pept        complement(487207..488448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0447"
FT                   /product="protein of unknown function DUF418"
FT                   /note="PFAM: protein of unknown function DUF418; KEGG:
FT                   bpf:BpOF4_11085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28729"
FT                   /db_xref="GOA:E6TWP6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP6"
FT                   /inference="protein motif:PFAM:PF04235"
FT                   /protein_id="ADU28729.1"
FT                   /translation="MEQQTQQNKPKVEMTPLDSNKRLNHIDSLRGFALLGILLVNMFAF
FT                   QYGTFGMELIPPVLTSNIDQVTYTFISWFFQGSFYPIFSMLFGFGAIMIWERSQERERP
FT                   FYLLFVRRLLILMVMGFVHLYFIWDGDILLTYAITGFLFIFFVNRKAKTLLIWAIAIAA
FT                   LINLPGLLPGDDEAIVTFDSYVEYERDVLGNGTYGDIVHHRFTASPFEKIDYGIELSAL
FT                   EREIMAIVMTVFNFITMITQTLLLFLVGGYLAKKRWVHHPNDHKSTLMKIAFIAIILGL
FT                   IIKAGNVFTTNESLEYFGYILGGPLLGLGYIAAFCLLFNKIGETKIFKGFGYVGRMALS
FT                   NYLAQSIVMTTIFYGYGFGLLGKLGTFIGVLLALALFLIQMFISRLWLKRNQFGPMEWF
FT                   WRVGTYLSIPKMKK"
FT   gene            complement(488696..489466)
FT                   /locus_tag="Bcell_0448"
FT   CDS_pept        complement(488696..489466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_3246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28730"
FT                   /db_xref="GOA:E6TWP7"
FT                   /db_xref="InterPro:IPR025441"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP7"
FT                   /inference="similar to AA sequence:KEGG:Bsph_3246"
FT                   /protein_id="ADU28730.1"
FT                   /translation="MFYTLLSLLAIFITIFEKIAEKKLVKGEIKKLSETSGNYLSKIGE
FT                   LVIAITALLILFLVMDQTNYNDMMWFWVSFAIVLFTFRATLERIYLEGKKYVATVAIMI
FT                   FFVIGIINISFITSNMMYTTFTEEVLEKLNATEIDKVEFIRGADRAQVTFHAEDEIQNV
FT                   LHLFESVNLKRDRNIYIHYDEKYTLRIYGGYKQDDLDNLREAVFKIEFDDQAMWIHEAP
FT                   LGTRRNASHYYEAIHDDNNLLEKLKIDEFDWILE"
FT   gene            489662..490336
FT                   /locus_tag="Bcell_0449"
FT   CDS_pept        489662..490336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0449"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: oih:OB0932 L-2-haloalkanoic acid dehalogenase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28731"
FT                   /db_xref="GOA:E6TWP8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADU28731.1"
FT                   /translation="MMKAVLFDLDNTLLDRDASVRSFVSHQYDRLSNYLNHIPKETYIN
FT                   RFIHIEQRGYVWKDIVYQQLVEEFIIREISSDELLQDYIMEFRNHCIPFPNLNAMLDSL
FT                   KESQLLLGIITNGKGKFQMDNIKALKIEDYFDLILISEWENLKKPDPRIFQRALEQLNV
FT                   RAKSSFFVGDHPQNDIDGAHRVNMKTIWKRDHQWCDVHADFIIDDLIEIPAIIHKDNIS
FT                   QI"
FT   gene            490439..490837
FT                   /locus_tag="Bcell_0450"
FT   CDS_pept        490439..490837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0450"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ctc:CTC00144 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28732"
FT                   /db_xref="GOA:E6TWP9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWP9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU28732.1"
FT                   /translation="MRWVKEDFLISDDVSTIDLEIVVSLLSTTYWAAKRDRETIKKSIE
FT                   GSVVFGLYHSNNQIGFARVVTDKATFSWVMDVVIDEAYRERKLGTWLMECILDHPHIKH
FT                   TSFGLATKDAQSFYRKFNFYEEECMRRR"
FT   gene            490962..491570
FT                   /locus_tag="Bcell_0451"
FT   CDS_pept        490962..491570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0451"
FT                   /product="signal peptidase I"
FT                   /note="KEGG: bpf:BpOF4_12710 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28733"
FT                   /db_xref="GOA:E6TWQ0"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ0"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADU28733.1"
FT                   /translation="MTFIKEMISWVKSIAVALVLAVLISIFVVQPFKVDGSSMEPTLMG
FT                   ADNQHDSSADRLFVLKTPYLFGATPNFGDIVIVDSRLNNERSWKDVLLENQLISLFTDR
FT                   EESNDYMWVKRVIGEPGDVLEMNGGRLYRNGELLEEEYIKENIQGNFEKVVVPEDNVFV
FT                   MGDNRNNSMDSRSIGPIPTEHVIGRAFLRYFPFNKMGNF"
FT   gene            complement(491645..492505)
FT                   /locus_tag="Bcell_0452"
FT   CDS_pept        complement(491645..492505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0452"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="KEGG: bcb:BCB4264_A3110 metallo-beta-lactamase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28734"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ1"
FT                   /inference="similar to AA sequence:KEGG:BCB4264_A3110"
FT                   /protein_id="ADU28734.1"
FT                   /translation="MMDKEMSYGSDYKFIPATSINSGVGVEVQPDIYCYTIQVVNMCVI
FT                   GRQDDNEFVLVDAGMPESANRIIEMTEERFGKNSKPKAIILTHGHFDHVGAIIELVNHW
FT                   NVPVYAHQLEIPYLTGQKSYPEPDPTVEGGAIAKLSSLFPNEAVNLGDHVQPLPNDGIV
FT                   PALPEFHWVHTPGHTPGHVSLYRKKDHSLLVGDAFVTVKQEYLYKVFTQEFEISGPPRY
FT                   LTTDWQAAWNSVKKLASLHPALAVTGHGPPASGELLTNSLEKLVNDFEHIAIPDHGKYV
FT                   NKYKH"
FT   gene            492901..493191
FT                   /locus_tag="Bcell_0453"
FT   CDS_pept        492901..493191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28735"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ2"
FT                   /inference="similar to AA sequence:KEGG:BMD_0646"
FT                   /protein_id="ADU28735.1"
FT                   /translation="MSQCELCGRNHVETTIHHLVPKEMGGTFGATASLCIPCHKQIHAL
FT                   YTNDEIAARLTTVSDLRNDEKLMQFIKWIRKQPPTKVMKIRKSNDRKRKGK"
FT   gene            493368..493862
FT                   /locus_tag="Bcell_0454"
FT   CDS_pept        493368..493862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28736"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ3"
FT                   /inference="similar to AA sequence:KEGG:Mvol_1699"
FT                   /protein_id="ADU28736.1"
FT                   /translation="MKKSLLVLIVVLLSSFLLACSGETLGKGKAKEVEVNESINYHDEF
FT                   EYTVLSIVRTDSYEYESSFGAPATLEAEEGKEIVILNIEVTNISDEEQGAFQSLHLLDG
FT                   NQVNYQKVLFSKDSLSTTTPLLPGGKTSGPVIYEVTKGNELEFRIATLGGDPVEQTIIL
FT                   P"
FT   sig_peptide     493368..493427
FT                   /locus_tag="Bcell_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.895 at
FT                   residue 20"
FT   gene            495153..495347
FT                   /locus_tag="Bcell_0455"
FT   CDS_pept        495153..495347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aag:AaeL_AAEL011516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28737"
FT                   /db_xref="GOA:E6TWQ4"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ4"
FT                   /inference="similar to AA sequence:KEGG:AaeL_AAEL011516"
FT                   /protein_id="ADU28737.1"
FT                   /translation="MKKTLNDENIRTVKVMLLIVIVIAPLANAFGYFFIGLYILSFVSL
FT                   IFLFVFDMYFKRKDQRRKR"
FT   sig_peptide     495153..495242
FT                   /locus_tag="Bcell_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.952 at
FT                   residue 30"
FT   gene            complement(495411..495839)
FT                   /locus_tag="Bcell_0456"
FT   CDS_pept        complement(495411..495839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0456"
FT                   /product="protein of unknown function DUF948"
FT                   /note="PFAM: protein of unknown function DUF948; KEGG:
FT                   protein of unknown function DUF948"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28738"
FT                   /db_xref="GOA:E6TWQ5"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ5"
FT                   /inference="protein motif:PFAM:PF06103"
FT                   /protein_id="ADU28738.1"
FT                   /translation="MDWLGIGVFILSIGFAVLIIFLRPVLKRLEETLGATAKTINTTGA
FT                   SITELSKETVGVIHNSNETLADVNEKLAKLDPLFQIIHDTGESAHHLTSTLAKFSVDKA
FT                   ERAQAGMDILDKNKLEGLMRGAAFIYYLRQAKKASADN"
FT   gene            496159..496692
FT                   /locus_tag="Bcell_0457"
FT   CDS_pept        496159..496692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0457"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: aoe:Clos_0694 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28739"
FT                   /db_xref="GOA:E6TWQ6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU28739.1"
FT                   /translation="MEILSSNDAVSVNQEDVVFHLKEGDMQVLLHWIKERQDKFYRIGW
FT                   SFFKVQEDIEDALHNAIIIAYERIHTLRKIQFFGTWFTKIFLNECRKIYRTNKKTIRFE
FT                   QVNSIADREPDLQANKIELREALEKLEAETKEMIILKYVAGYSFKEIGELFDRRENTVK
FT                   TKVHRGLKAIRKYV"
FT   gene            496711..498297
FT                   /locus_tag="Bcell_0458"
FT   CDS_pept        496711..498297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_0695 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28740"
FT                   /db_xref="GOA:E6TWQ7"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ7"
FT                   /inference="similar to AA sequence:KEGG:Clos_0695"
FT                   /protein_id="ADU28740.1"
FT                   /translation="MTCKKVEDRLLDYLDGNLPSEQVSEIKNHVQTCSSCANELKKLVR
FT                   AKKTIELESDKCKVPNNFFSNVEARVNDHVLAEGEQGKRNWGINIAIALIGFIVISSFF
FT                   ITEGIVDMSGWWDKDREYHHLERAIEEGYGEQLNISVQDNGIEVTITEIIADELQTVLY
FT                   YEIRDVEEQNHLTPVYEKIVINNEKELWPESLSYYSGLEGFSAHAMNNTYYEDENFNRG
FT                   KLTYIPLEVDSGKIEISISELTFVDGDETEWYNTPSSTDLRTVEGDWSFDVPVKKHGMR
FT                   EYDLGEESFALFNNEIILKSLSVAPSNTILQLEHKIDRTNDEKEMQYFSIEAIKVNGKR
FT                   FERDKFSHMPMTMTSQGDVVIAFDTIYFEEITDVEIILDQVSFLVHENIEIPIDPQDPM
FT                   VEYNYNGTNISIIDVIEDENYTTIVLEEETHSTRQHEILFIEGFDQFGNRNTISSSLPI
FT                   IIDQDGNEYTSEYFFKMDELDGAKMFVKEYMLQFEKRDGVQPVINKLVINGHRETILVD
FT                   EVWKVENLLLK"
FT   gene            complement(498431..499294)
FT                   /locus_tag="Bcell_0459"
FT   CDS_pept        complement(498431..499294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_5536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28741"
FT                   /db_xref="GOA:E6TWQ8"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ8"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_5536"
FT                   /protein_id="ADU28741.1"
FT                   /translation="MRNRIYFLTLHFSSLLLFFFIIRNSPPKYKRFIAPLFISNIGLNY
FT                   IFEFFVLLIFRGYRYYPNLLKNKYFDNVVGANASQLFVLPTTGLFLTIFHLRKRWSLLF
FT                   ALMLTLVDKLFVEKRLYKHYWWKTGYTPIGVLIFYFIANKWKEQIIDKDHRLFKIFTVY
FT                   LTNFVAYSTLNFYHVALFKTCLFNIKIFKNFYRSHVVLSTIYSAFCAILFTIIIFLKRG
FT                   YFTISLIVTLLGLEYIFIKKKLITISTKYFYVISFITKVISIYAGNRIHKTLFCIKDDV
FT                   PSENLQ"
FT   gene            499644..500204
FT                   /locus_tag="Bcell_0460"
FT   CDS_pept        499644..500204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmq:BMQ_2729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28742"
FT                   /db_xref="GOA:E6TWQ9"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWQ9"
FT                   /inference="similar to AA sequence:KEGG:BMQ_2729"
FT                   /protein_id="ADU28742.1"
FT                   /translation="MNFDQYRTEIQEKSNQLNELFSSYWHDYSHMGTWQFWVTISLMVL
FT                   PLIILIFAIDRRRVFEVLFFGYTVHVLWTYIYIVINSEGYFTHLYFLTPMLPYALNMTA
FT                   SALPIGFLLLYQYCTNRGKNFYVFTIILSGIFAFGFGGTEVWLGLVELNKGMKLFYLFL
FT                   IDVTIAFTAYWFTRGLLKVKERA"
FT   gene            complement(500449..501465)
FT                   /locus_tag="Bcell_0461"
FT   CDS_pept        complement(500449..501465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0461"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: bsu:BSU02720
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28743"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR0"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADU28743.1"
FT                   /translation="MSKLGRNDKCPCGSGKKYKKCCMDKQVQPINIDPISQQQFQDFLP
FT                   KLLNYSKTFDEQLQPIYKRYSATYTKLNDADARAFSQILFHWLVFNAPVIENKRTIVEQ
FT                   FVDEYREEFDNSLHEVLDRWTQVTPSLLLIEKQGETATVKDSLNGHVIVPDQTAAFEKL
FT                   DSGDFLFGYIYPTITGSVLGTDALLIPDKLRAACLHEYNELYRMYKKDNETESAFVKRH
FT                   FPAIIGILVSVLEQKTTEIPKVGQDARAVYTTFYQSISLEDYSTDVLLTVKNKWLDYYA
FT                   KQAPRIQKPEVFAAALEYWASKQPNQWTTVTQKGLSEKYNVSATTISSRFKELDSYF"
FT   gene            501660..503033
FT                   /locus_tag="Bcell_0462"
FT   CDS_pept        501660..503033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0462"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: bpf:BpOF4_09920 RNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Methyltransferase
FT                   type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28744"
FT                   /db_xref="GOA:E6TWR1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR1"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADU28744.1"
FT                   /translation="MKTSVPVQKNDKLEVIFEDLTHDGAGVAKINGFPIFVPRALPGEE
FT                   STIKITKVKKNYAFGRLIETTKESEHRVEPPCPIFKECGGCQLQHLSYDGQLKHKQKHV
FT                   MDVLSRIGGMNDVHVHPTLGMEEPWRYRNKAQVPFGEEEGGLVAGFYAERSHKIIDMDR
FT                   CMIQQEENDEVVMLVKDIAKKYGVRGYDEEKHKGTLRHVVTRYGKNTGELMVVLVTKGK
FT                   ELPNKKNIVQDIRDSLPKVKSIVQNINPKRTNVIFGDKTEVLWGEEVIYDTIGDIKFAI
FT                   SARSFYQVNPTQTEVLYNKTLEFAGLSGNETVIDAYCGIGTISLFLAQRAKHVYGVEIV
FT                   PEAISDAKKNAQLNGIENVDFAVGEAEKVMPWWYAQGIRADVIVVDPPRKGCDEELLET
FT                   IVKMKPARVVYVSCNPATLARDLKYLEGRGYKTKEVQPVDMFPHTMHVETVTVIYREG"
FT   gene            complement(503245..503868)
FT                   /locus_tag="Bcell_0463"
FT   CDS_pept        complement(503245..503868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0463"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28745"
FT                   /db_xref="GOA:E6TWR2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU28745.1"
FT                   /translation="MSLGSNINNKRKSLNLSQEYVADQLGVSRQAVSKWENNLSKPSTQ
FT                   NLIKMATLFECDIKELVSSDKFMEKQKNLENQTESKKDIRMHMAAAFGRVFMLVGSLGF
FT                   MGAISDSADLGSLPNWYIQIWYSVLFVIGLVLTFVGSRDYFNRKSGSKNIIWLDLLFVL
FT                   SIFLYPFWPFGRNINTLITLLIGIVVMSIINIKFFIPTWRKPKL"
FT   gene            504223..505095
FT                   /locus_tag="Bcell_0464"
FT   CDS_pept        504223..505095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28746"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR3"
FT                   /inference="similar to AA sequence:KEGG:Bsel_0242"
FT                   /protein_id="ADU28746.1"
FT                   /translation="MYYLKNDRLKVEIQEPGTFYKGSRFDWTGFISQITLDGNIEYCVP
FT                   ERLEEGEGTGGLGFCNEFGIDSPIGYDAIEVGELFPKVGVGLLKKDEDAAYDFFRTYEV
FT                   SPIEVKINKEANSITFETTNASPKGYGYHLIKEVAIVDNRLIIDYRLTNVGKYPIHTNE
FT                   YSHNFIGINNEFIGEHYQLKMPRMKNIEVEVGSISSSHDQLTWPSTPDGDFYAHIDWEV
FT                   KNGTYNWDVFHDKIGAGVREISEFEPSKIALWGRNHVVCPEVFIDIKLKPNEVKSWKRV
FT                   YEFYQDKEV"
FT   gene            505277..508738
FT                   /locus_tag="Bcell_0465"
FT   CDS_pept        505277..508738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28747"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR4"
FT                   /inference="similar to AA sequence:KEGG:Bsel_1320"
FT                   /protein_id="ADU28747.1"
FT                   /translation="MKNISNLYFGNAALHDEAEKISLETVTVNEESYFKIENYNHMNPF
FT                   FMTVVSDVDHWMFISSTGGLTCGRKNAESSLFPYYTDDKIHDSIETTGSHTILIVNKEE
FT                   KNFLWKPFSLHNSNVYKITRNLYKNTTGNKIMFEEINHDLEVSYTYTWKNSDAFGFIKE
FT                   SRIVNLAEKEVDIKVLDGIRNILPYGVNTLLQTTKSTLVDGYKRCELVEQAGLAIYTLS
FT                   SILTDKAEPSESLKATTVWSKGLDNPSYLLSEQQINAFSQNEEIQTEDDIKGRRGSYYV
FT                   VDSIHLKASKSKDWQIVAELNQSASDVEKLIKEIMDNQSILEVLDADVSKGDYNLNKLV
FT                   FEADGFQCTANEKASYRHFSNTLYNIMRGGIYADGYEIDKEDFKVFVRNWNKEVYTKHL
FT                   DFMSQLPETINYNELIALAAELHCKDFERIVLEYLPLTFSRRHGDPSRPWNKFSIEVSK
FT                   EDGGKELKFEGNWRDIFQNWEALSISYPAYTESIISKFVNASTADGYNPYRITKDGIDW
FT                   EVLDPEDPWSNIGYWGDHQIIYLLKLMELSKAYNPKKLQDLLHKDIFVYANVPYRIKGF
FT                   DALVDDPRNSIVFDDKSEERIKNKTTSIGSDGKLVYNKGEIYKVNLMEKLLVTLLSKFS
FT                   NYVSEGGIWMNTQRPEWNDANNALVGNGLSMVTLYYMHRFQDYMSQIVEEMKEDTIEVS
FT                   VEVQQKFQDITAVLKDSKQYLGNKISDDTRFEIVKALGKIGENYRNSIYDNGFVGEKAS
FT                   ISLESLKEFIELSMIHLKDSIKKNKREDGLYHSYNLIRFDKENCSISNLYEMLEGQVSV
FT                   LSSKALDGKESIAVLEALKNSSIYREDQNSYMLYPNRELPKFLEKNVIPEEQVMSSTIL
FT                   KEELNQNRTLFIEKDINGKYHFNGRFRNGDEIEEALKATEAYKDEDIKTVKEIFSNLFN
FT                   HHAFTGRSGTFYKYEGLGSIYWHMVSKLVLATQENFEDVYSEKGMTEEARTLMNDYEAI
FT                   KEGIGVEKSPEEYGAFPTEAYSHTPGFAGVQQPGMTGQVKEDFISRLGELGVKVEDGLV
FT                   HFKPVLLEKAEFLKEKKAWSLPRNSNSAETETMLLDENSLGFTFCAVPVIYYLDDKKKI
FT                   IVYYKDGSESVFEDVDTLDLETSQNIFNREGKIEKIKVYVDGSNLK"
FT   gene            509111..510082
FT                   /locus_tag="Bcell_0466"
FT   CDS_pept        509111..510082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0466"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   bpu:BPUM_0657 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28748"
FT                   /db_xref="GOA:E6TWR5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR5"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADU28748.1"
FT                   /translation="MSENFWRELPRPFFILAPMEEVTDVVFRHVVSAAARPDVFFTEFA
FT                   NSESYCHPEGNKSVKGRLTFTDDEQPIVAHIWGDKPENFRKMSIGMAEQGFKGLDINMG
FT                   CPVPNVARHGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFTELDEWREWLTHILK
FT                   QDIANLSIHLRTREEMSKVDAHWELIPEIKKLRDEVAPDTLLTINGDILDRQTGLKLAN
FT                   QYGVDGVMIGRGIFHNPFAFEKEPREHSSKELLDLLRLHMDLHDKYSGLELRPFKALHR
FT                   FFKIYVKGFPGASGLRNHLMSTESTDEVREMLNKFELKNENK"
FT   gene            510395..511660
FT                   /locus_tag="Bcell_0467"
FT   CDS_pept        510395..511660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0467"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   lsp:Bsph_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28749"
FT                   /db_xref="GOA:E6TWR6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU28749.1"
FT                   /translation="MTKQSSKLRWVIFASVLFTYLFMSSQRTAPGLITDQLMRDFSVTA
FT                   TTIGLVASVQFFIYTALQIPMGLLADKYGPNLLLIIGASLAGIGNIIYSASTHEYFLFF
FT                   SRVLTGIGDATIWVNMILILNIWFSKKEFTRLIGVSGMTGSLGFLLATVPFSVMIGILG
FT                   WRGAFLLTGFILCCCSVVLYVLLLKKTKQSTVIRQHSRQEKTFVILKRVFKNRQAWALF
FT                   FCHFGIVGGYIGFVGSWAVPYMMDVHGMTRLGASQLTMLSLIGALIGAPLIGWFTSNLG
FT                   TIKRPYIVFHFIVLLCWSAFLLFPEHPPFYLLIVLFFIIGFGFGANSLTFAIVRQTVPM
FT                   SESGIITGFANTGGFLSAVLLPSTFGYILDFSQTSTNSIVDGYYFGFLIPVLFSIVGII
FT                   GVMCIMESNGNRGSDRNREGTQ"
FT   gene            complement(511697..513913)
FT                   /locus_tag="Bcell_0468"
FT   CDS_pept        complement(511697..513913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0468"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="KEGG: bha:BH0906 catalase; TIGRFAM:
FT                   catalase/peroxidase HPI; PFAM: Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28750"
FT                   /db_xref="GOA:E6TWR7"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR7"
FT                   /inference="protein motif:TFAM:TIGR00198"
FT                   /protein_id="ADU28750.1"
FT                   /translation="MDTKDNGNIGGCPFHGGATSNKSSGTSNRDWWPNALNLNILHQHD
FT                   RKSNPMGDDYDYAEEFNKLDYDALKQDLRNLMTDSQDWWPADYGHYGPFFIRMSWHAAG
FT                   TYRTGDGRGGGNTGNQRFAPLNSWPDNGNLDKARRLLWPIKQKYGNKISWADLLVMAGN
FT                   VAIEDMGGPIIGFGAGRPDIWHPEEDVYWGKETEWLTDKRYTGDRELENPLAAVEMGLI
FT                   YVNPEGPNGKPDPVKSAQDIRETFGRMGMNDEETVALIAGGHTFGKAHGAGDAAKVGPE
FT                   PEAAPIEAQGFGWQSTHGSGKGRDTITSGIEGAWTANPTQWDNGYFDLLFGYEWWLTKS
FT                   PAGAWQWAIVDPAEEHLAPDAEDSSKKVPTMMTTADMALRHDPEYEKISRRFHQNPDEF
FT                   ADAFGRAWFKLLHRDMGPKERYLGPEVPEEDFIWQDPVPVGSADLTDADVTALKEKLLN
FT                   SGLTVSELVTTAWASASTYRGSDHRGGANGARIRLAPQKDWEVNQPEQLEKVLHVLEGI
FT                   QKEAGIEVSLADLIVLGGNAAIEKAARDAGYEVTVPFAPGRGDATEEQTDAESFDVLEP
FT                   VADGFRNYQKKQYAVSPEELLIDKAQLLGLTAPEMTVLIGGMRVLGTNHGGTQHGAFTD
FT                   QVGKLTNDFFVNLLDMGVEWKPVGANEYVGRDRNTGEVLRTATRVDLVFGSNSVLRSLA
FT                   EVYAQNDNKEKFVNDFVAAWVKVMNADRFDLKESDLKKAQLSNN"
FT   gene            514848..515966
FT                   /locus_tag="Bcell_0469"
FT   CDS_pept        514848..515966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0469"
FT                   /product="putative sugar uptake ABC transporter periplasmic
FT                   solute-binding protein precursor"
FT                   /note="KEGG: pjd:Pjdr2_0977 putative sugar uptake ABC
FT                   transporter periplasmic solute-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28751"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR8"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_0977"
FT                   /protein_id="ADU28751.1"
FT                   /translation="MKAVLKFISLMFVVTVLAGLLVACNSDEGASGDGGLSVGIVLPTR
FT                   DEPRWVQDEQRFKDALEDSEYTTEILFSQGSSANEKENVDTLISKGIDVLIIAPHDGAA
FT                   AGSAVEAAKSEGITVISYDRLITETDAVDYYVTFDSIAVGAAQGQYLIDNSEGSNVPLY
FT                   LYAGASSDNNAFLFFEGAWSVLQPKIADGTFVIANSSEAEALQDKGDLSRDEMSRILSQ
FT                   VTTNWDPNEAINKAQTHLTAVGGDMKGDVAVLAPNDGTARAIADVFASDNEVSSYVVTG
FT                   QDAEMASIQYIIDGKQSMTVFKDVRTLVEDAMGMAITILDGGTPETTGTYDNGSVEVKA
FT                   KQTDVIVVEQSNVKSELIDSGYYDADEFSGLE"
FT   sig_peptide     514848..514919
FT                   /locus_tag="Bcell_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.626 at
FT                   residue 24"
FT   gene            515988..517574
FT                   /locus_tag="Bcell_0470"
FT   CDS_pept        515988..517574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0470"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pjd:Pjdr2_0978 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28752"
FT                   /db_xref="GOA:E6TWR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWR9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28752.1"
FT                   /translation="MVVDTIYHYFAIVFVVLRRGITMSEYILEMKQISKEFTGVKALSN
FT                   VNFKVEKGEIHCLVGENGAGKSTLMKVLSGVHPYGTYKGDIVFDGKVQQFKNISDSVHA
FT                   GIAIIYQELALFPDLTVYENIFVGNEVDKKGVLDWNRTIVEAKKILKKVNLEVNPETLI
FT                   KDLGVGKRQLIEIAKALSKDVKLLILDEPTAALNENDSENLLKLLNVLKEQGITCIMIS
FT                   HKLKEVISIADKATVIRDGQTICTLDSDNGEITESTIIKNMVGREIEDIYPKRLNKNFG
FT                   ENVLELYNWSAYDQKLGRHVVKDANLHVKQGEIIGLAGLMGAGRTELALSIYGNAKSYK
FT                   LQGDIVVNGEMRSLKHPSDAIKAGIAYVTEDRKGDGLFLIQDIKNNISAANLNGISTNG
FT                   IVNPNEEIKVADEYFKSLHIKAASLEQLVGNLSGGNQQKVSLAKWLFVGPKLLILDEPT
FT                   RGIDVGAKFEIYTVMNELIKQGLSIIMISSELGEVLGMSDRIYVMAQGEIKGELPIEEA
FT                   DQEKIMQLATQ"
FT   gene            517587..518762
FT                   /locus_tag="Bcell_0471"
FT   CDS_pept        517587..518762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0471"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pjd:Pjdr2_0979 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28753"
FT                   /db_xref="GOA:E6TWS0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU28753.1"
FT                   /translation="MNIFNEAKILINENIRDYGMYIALLIIIITFTFLTDGLFISSRNI
FT                   SNLLDSAGYIAVLAVGVMLVIVIRHIDLSIGFLAGFLGAIAAILLMQVGLPVYLVIPII
FT                   LILGTIAGLFTGFLVAKVGIPAFVATLAGWLIYRGAILQVTEKTGTIIVQNDSFNAIGN
FT                   GYIPSLMQVNGLHLLSLLLGGLSIVFYIYSAVSNRRKKIKYHFEVVSKQIFVLQLVFVS
FT                   AIIAYITWILAGYNGFSWTVIIMLLVVVVYHFFTTKTVVGRHIYAVGSNPEAAHLSGIN
FT                   VGKITLLVFGSMGLLSALSGILFTARLQAATTTAGTLFELDAIAAAYVGGVSAAGGVGK
FT                   VTGAIIGAIVMASLTSGMNLMGVGIAYQYMIRGGVLALAVIFDVTTRKKGK"
FT   gene            519002..519994
FT                   /locus_tag="Bcell_0472"
FT   CDS_pept        519002..519994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0472"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: pjd:Pjdr2_0973 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28754"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADU28754.1"
FT                   /translation="MNVFLKKVIFIILAFIFICLCYLTVVSAEKVLRTDWKIPSALEQN
FT                   KTQYRLVLITQDMETPFWDEVGNGALVQADKLSVSMEVWGSYGNNQEDFLKKVELAIHS
FT                   KVDGIIVQGLNTDEFKHLSKIKASFYGIPIVTIANDVPMDESLRRTYVGSDQYAAGKMI
FT                   ANELVADMGTSGKVVLMYDNREEYYQVQRLHGIHDVLKEYPDIEMIDAETTDMRDQVIA
FT                   TTQEVLNQSPDADAFIAVNANIVGAMLQEISKRFQIEPYYIYSFDDGPESLSLLTQGKL
FT                   DAIIKQSPEEMGKKGVQLIVEWLDDETVPLEINGYYTDIDILRALEFHE"
FT   sig_peptide     519002..519088
FT                   /locus_tag="Bcell_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.456 at
FT                   residue 29"
FT   gene            519987..521420
FT                   /locus_tag="Bcell_0473"
FT   CDS_pept        519987..521420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0473"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: pjd:Pjdr2_0974 histidine kinase; PFAM:
FT                   histidine kinase internal region; histidine kinase HAMP
FT                   region domain protein; ATP-binding region ATPase domain
FT                   protein; SMART: histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28755"
FT                   /db_xref="GOA:E6TWS2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS2"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADU28755.1"
FT                   /translation="MNSIQKKILLLTTVVVIIMSIIWVALTYYNYKTQNQYNDILQRYL
FT                   TMNEVSNTSQQVITDINNYMIKPAPDTLSQLNQSKEHVEEVKYEVYKLRNEENDFTLTN
FT                   YIHLIDSLIETTDRIIMFHSQDNTEASTKEFAEATRIANYISEITLALLDSDLKTYDVF
FT                   YRGIIEQSEELNKLGIWLLLLITFLLLVVTYWFSLSITRPVQKLTKAANEFSRGRFDTQ
FT                   VKVDTNDEIAFLAKTFERMRININNLISEIKYKAQLERELQQNKILLHESQFRSLQSQI
FT                   NPHFLFNTLNTLSKKAYLEGSEETSDLLVSVAGLLRYNLKRLDRSVTLQDEVNVLQQYM
FT                   DIQKARFTERLNLYMEVDSSCLDVKIPALTLQPIIENAVIHAVEPEEEGGSIYFRVIDE
FT                   GESVRVEIEDSGRGMDKGKIKQILEETHIDSEGHSTGIGFSNVVKRLRLFYGYNDVIDI
FT                   ESVVGRGTKVMINIQKNKG"
FT   gene            521427..522965
FT                   /locus_tag="Bcell_0474"
FT   CDS_pept        521427..522965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0474"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: pjd:Pjdr2_0975 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28756"
FT                   /db_xref="GOA:E6TWS3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU28756.1"
FT                   /translation="MIKLLIVDDEQIERDGMQVILSHAFPGVTIKQAKNGKEAILIADR
FT                   FQPHLVLMDIKMPGMNGLESVQHLSNEYPLMKFIMVTAYDTFDYLKRAIKLGVKDYILK
FT                   PSRASEIVTTVGKVLREVEEEQKKREMIEQQQYTLEKTLSIAETDVVTQLLFDHVHEIH
FT                   LEMLLEMLDIRSINEMYVMVVLISTGSENMYSTIKEKVRKAGNSLIGALYGNQLPIIMF
FT                   RDQDKSFRSQAVFMAREILSVAKVNKKTNCFIGIGEVCCSLEEIRKSYSESLVATMDTT
FT                   LPVKYRFYCDVKSINVVGSEQRVKQREKEFAELIRLGEWEQIHKSIMNLIQSYENEGAD
FT                   TLQTQQRILELLWIVSRLMNEMGVETVSPFYSFQANDYRQLRSETNELLQQMRQLYTKH
FT                   YDQLELDSIFLMKRYILEHSHEDISLDKLAKKVGLSPIYMSKLFKEKLGVNYIDFLTEC
FT                   RIEKAKQLLKRPDKSIKEITFDVGYHEPNYFSKVFKKMCGVSPKEYRKSIFNRN"
FT   gene            522998..524095
FT                   /locus_tag="Bcell_0475"
FT   CDS_pept        522998..524095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0475"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="TIGRFAM: D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein; KEGG: pjd:Pjdr2_0976 D-xylose
FT                   ABC transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28757"
FT                   /db_xref="GOA:E6TWS4"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS4"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ADU28757.1"
FT                   /translation="MGRRYVRILLFVFIVLYMWALVACEDSEETLISEVTSKSSGADTD
FT                   HEIEFLGEKVKIGFSMDTLEEDRWVRDRDLFKEAVESLGAEVEIMAANGDDALQLLQAE
FT                   TLISQEIDVLVIVPHNAEATAAIVNKAQLAGVKVLSYDRLIKNADIDLYISFDNEQVGE
FT                   LKARAITSRVPTGKYVYIGGAITDNNAHLFKSGVFNVLKPLIDNGDISIVYDQWTKDWT
FT                   PTNAFANMEAALIANNNEIDAVIAANDATAGGVIEALEAQGLAGEIPVAGQDADLAAIQ
FT                   RIIEGTQTMTVYKPIKPLAEEAAILAVKLARGEKIETNTTVNNGKIDVPSVLLSPVSVE
FT                   LENISETIIADGFHTREEIYNQKEQ"
FT   gene            524518..524988
FT                   /locus_tag="Bcell_0476"
FT   CDS_pept        524518..524988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0476"
FT                   /product="acid phosphatase/vanadium-dependent
FT                   haloperoxidase related protein"
FT                   /note="PFAM: acid phosphatase/vanadium-dependent
FT                   haloperoxidase related; KEGG: bpf:BpOF4_18835 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28758"
FT                   /db_xref="GOA:E6TWS5"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS5"
FT                   /inference="protein motif:PFAM:PF02681"
FT                   /protein_id="ADU28758.1"
FT                   /translation="MSRGIFTALLAIGLAQFLKIPIKQLKTKKWNWKTFFESGGMPSSH
FT                   SAGVASLATYIGLRLGGRTLDFALSVIFGLIVMYDAQGIRRYAGETSMKVNELEAKVEK
FT                   LAGESSGSFHEQKKRQLKEQLGHQPEEVVAGASLGVIVGSISYMLGKMKGKN"
FT   gene            525004..526467
FT                   /locus_tag="Bcell_0477"
FT   CDS_pept        525004..526467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0477"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   amt:Amet_2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28759"
FT                   /db_xref="GOA:E6TWS6"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS6"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ADU28759.1"
FT                   /translation="MDNKIGWNLENSYTKLPDTFYSTLNPTTVSSPKLVIFNEKLATSL
FT                   GLNGEELKGTSGVEVFAGNNLPPASKPLAQAYAGHQFGHFTMLGDGRAILLGEQITPNN
FT                   ERIDIQLKGAGRTPYSRGGDGRASLGPMLREYIISEAMDALNIPTTRSLAVVTTGEDVY
FT                   RETVLPGAILTRTAASHLRVGTFEYAAKWATDDELKQLADYAINRHYSEIVAKEDQYRL
FT                   FLQEVIKRQAELIAKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDEYDPKTVFSSID
FT                   REGRYAYGNQPYIGAWNVSRLAEAILPLLHDDQEEAVNIAQEEIGKYKDLYLSYWHTGM
FT                   KAKLGIINDEADDERLIEELLMLMQQHSADFTNTFRALTLDKIEGMALFETDAFKKWYE
FT                   RWKARIGRQEEPISASIALMKKSNPAVIPRNHLVEEALDAAVEDGDYAVMERLLHVLEK
FT                   PFDYTLEKEKFTAPAPPEVSCNYKTFCGT"
FT   gene            526644..529019
FT                   /locus_tag="Bcell_0478"
FT   CDS_pept        526644..529019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0478"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: glycosyltransferase 36; KEGG: sde:Sde_0906
FT                   NdvB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28760"
FT                   /db_xref="GOA:E6TWS7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037814"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS7"
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /protein_id="ADU28760.1"
FT                   /translation="MIRSTENNEYYELTSPTKIPKASGFLWNDNMMIHMNCRGYAVAQF
FT                   MQPEPAKYSHSPNLEAKTFMQPEQPYYAHHPGRFVFVKDEENGDIFSAPYEPVRVLPDN
FT                   YTFAVGKNNIIWKVESNGVLIEMKLSLPKDDPYELWEVKVKNLSNKKRKLSIYPYYTVG
FT                   YMSWMNQSGEYLEDIQAIVCSSITPYQKYQDYAKIKELNDKTFLLAEKKPFSWEVSQEV
FT                   FEGEGGITLPTGIQEEALSKSDSRYEMPTAVFQYKLEMDVNEEQSYRFVFGPAKYDEDV
FT                   TAVRNKYFEAENEAGEDGFVLAEKEYAKYIAEGSGCLQIKTPDAHLDNFVNHWLPRQIY
FT                   YHGITNRLSTDPQTRNYLQDNMGMSYIKPSIARHAFVHALSQQESSGAMPDGITIHEDA
FT                   ELKYINQVPHTDHCVWLPICLSTYLDETNDYAILDEVVPFADGNEEATVMEHINRAMYW
FT                   LINDRDERGLNYINQGDWCDPMNMVGYKGKGVSGWLTTASAYAFMIWADICEKNGLQDN
FT                   SEKFRQEADKSNEVINKYLWDGEWYARGITDDNVVFGISKDKEGRIFLNSQGWALLSGA
FT                   ADEVKKEKLLKSVVDQLESPYGVEMLGPAYTAMREDVGRVTQKHPGSAENGSVYNHAAV
FT                   FYIYALYTAGETENAYRLLRKMIPGPDLDDIIQRGQLPVFIPNYYRGAYRTIPRTAGRS
FT                   SHLFNTGTVSWVYRCIVDGLFGVQGAKDGLRIQPQLPADWQEASVTRSFRGADIEIDIR
FT                   REAGIRETELYVNGDLVEGNVMKDLKSGEKYKVLVKVQ"
FT   gene            529179..529631
FT                   /locus_tag="Bcell_0479"
FT   CDS_pept        529179..529631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB1817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28761"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS8"
FT                   /inference="similar to AA sequence:KEGG:OB1817"
FT                   /protein_id="ADU28761.1"
FT                   /translation="MKLTKLLLALFVAMALLLVGCNQDDSEENTTPITNDPVNNTASED
FT                   ANENASANESDEVKVTIVNMRDETDAEEYLFAIDEGDTVMDVMESNFAIDNNNGFIEAI
FT                   DGIYNAEGETYAWMYSVNGEQPTVGAEEYDLEAGDEVLFEFLNWDE"
FT   sig_peptide     529179..529250
FT                   /locus_tag="Bcell_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.375 at
FT                   residue 24"
FT   gene            529781..530251
FT                   /locus_tag="Bcell_0480"
FT   CDS_pept        529781..530251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0480"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="KEGG: bha:BH2543 lipoprotein signal peptidase;
FT                   TIGRFAM: lipoprotein signal peptidase; PFAM: peptidase A8
FT                   signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28762"
FT                   /db_xref="GOA:E6TWS9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWS9"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ADU28762.1"
FT                   /translation="MRYYIVALLILLLDQVTKWLVVQNMNIGESIPIINGLFYITSHRN
FT                   AGAAFGILQGQLWLFIIITIGVSCVLIYLIQTIKKGMNWYGVSLALLLGGAIGNFTDRL
FT                   FRGGEVVDFINVYIFSYNFPIFNVADMALNVGVVMMLIHLFKEEKRNKKIAK"
FT   gene            530771..532663
FT                   /locus_tag="Bcell_0481"
FT   CDS_pept        530771..532663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0481"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; PFAM: glycoside hydrolase family 18; Gram-positive
FT                   anchor; KEGG: bha:BH0916 chitinase; SMART: chitinase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28763"
FT                   /db_xref="GOA:E6TWT0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWT0"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU28763.1"
FT                   /translation="MKKLMVLGLATFLLFSMFVNTAFSNEHHDNDDFKSVVYYISWAAQ
FT                   EYDNEGNEARDFFVHDMDATNVTHINYAFAKIVGDDRPESDLVNGNCLPPEEIAEYDGD
FT                   DRVDHLNCDDVHRVTFGDPDVDIGENVSAEDAWEGNFEGNFRDLIAFKEDNPHVQTLIS
FT                   IGGWTMSNYFSDMALTEESREIFIDSVIEFIRVFEFDGVDLDWEYPGYGGEWHNDPYPE
FT                   DKENFTHLLRELREALDEAGEEDDTYYPLTIAVAANVGNYAANTEMPEIMEYLDWINLM
FT                   TYDMSGPWDRHDFDGEGLPWGEQPFISGFNAPLYQDPLDPWGSWLTVEGTVDAYLEVGI
FT                   DPKDMVLGLAFYGRTWASCEAERNNGMFDKCFEDEDGIVAGPGTWERGVLDYWDIKENY
FT                   VDQNGFVRYWSEDALVPWLYNEETGEVITYDDEESIGYKMQFVLERGLGGSMVWEITQD
FT                   RDGAMMETIGSYLFAGDPGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGEG
FT                   PGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGEGPGEGE
FT                   DPGEDEESAGDKEGDKLPETATTMYNWLLIGAMLLIVGFTFLFISRKRKLQTTD"
FT   sig_peptide     530771..530845
FT                   /locus_tag="Bcell_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.606 at
FT                   residue 25"
FT   gene            complement(532872..533924)
FT                   /locus_tag="Bcell_0482"
FT   CDS_pept        complement(532872..533924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0482"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28764"
FT                   /db_xref="GOA:E6TWT1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWT1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADU28764.1"
FT                   /translation="MTSNSYTFALVGYGGMGKQHKKVLQTIDRAHIAGTFDINKQRQED
FT                   ANNDGLHTYTSFNELVSDDSIDIVLIATPNDSHKDIAIDAMKAGKHVICEKPVTLNSKE
FT                   LEEILDAAKQYDKVFAVHQNRRWDEDYLVMKKLYDEGVLGDVFHVESRVHGSRGIPGDW
FT                   RHEKAYGGGMLLDWGVHLLDRLVLLIPEKIKSIYCHLSYVLGNEVDDGFRMQVSFESGK
FT                   TALVEVGTSNYISLPLWYMTGTNGAATIHDWSMNGKVVTVTKHEDHDATPIEAGAGLTK
FT                   TMAPRGELSTQDTPLPRIKTDIRDFYDNVMKVIEGKEDPIVKNEEVMRIMKLMEAAFLS
FT                   HKTNSVIDFE"
FT   gene            534340..535614
FT                   /locus_tag="Bcell_0483"
FT   CDS_pept        534340..535614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0483"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oih:OB2570 multiple sugar-binding transport system
FT                   multiple sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28765"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWT2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADU28765.1"
FT                   /translation="MKKFFTAVSLAVVGSMLAVGCSSDTNSDEDQVSLEIFQFKVEFRQ
FT                   QFEDLVAMYEEENPHVSINVRTLGGGSDYGATLRTNMSSGDEPDIFNFGGPTDRDEYRE
FT                   YLADLSDTEAAQLALDGTLDAATDGDEVLGLPYNQEGYGLIYNKRIFEEAGIDPQSILS
FT                   LDDLENAVQTLDSQKDDLGIDAVFALPGSEAWVLGNHLSNVYLAPEFNHSIIDAYESDT
FT                   VSFERGDEMHRFLDLQADYSVQPVASLDYSQQVEELFSLQRVAMIQQGNWVYPTVYDMD
FT                   PDFAVDGIGFIPIPLEGYEDHLPVGIPQYWAVNKNSDDEVVQAAKDFLDWMYTSDAGKD
FT                   AVINDFNFIPAYEGYDASEIVDPLSKQIYEYSEAGRTIGWVFMGAPTAWSDDELGTNMQ
FT                   RYLSGNATWEETLEDSKKAWESARQ"
FT   sig_peptide     534340..534402
FT                   /locus_tag="Bcell_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.520 at
FT                   residue 21"
FT   gene            535646..536605
FT                   /locus_tag="Bcell_0484"
FT   CDS_pept        535646..536605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0484"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB2569 multiple
FT                   sugar-binding transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28766"
FT                   /db_xref="GOA:E6TWT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWT3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28766.1"
FT                   /translation="MKERPSLVTLISNSKQLFTRHLKIIYLQQEAEEMRNRDLSFWLFI
FT                   APVLLALGIVVLLPLAFGVFYSFTDWNGFRITEFLGLQNYLNLFQDRLFLNSLRFTTLF
FT                   AIVSVITLNVLGLALALIVTQKLRSSNLLRTVFFMPNLIGGLILGFIWQFIFIRVFAAV
FT                   GNAIGVEALTGWLSTTTTGFWGLVILSSWQMAGYIMIIYIAYLQNIPNELIEAAKIDGA
FT                   NKWHRFKSITFPLIAPAFTVSMFLTLSFGFKMYDQNLALTNGGPYNSTQMVAMDIVRTA
FT                   FTRNELAYAQSKAIIFFILVAVIALTQVYYNKKREVEM"
FT   gene            536605..537414
FT                   /locus_tag="Bcell_0485"
FT   CDS_pept        536605..537414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0485"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB2568 multiple
FT                   sugar-binding transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28767"
FT                   /db_xref="GOA:E6TWT4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWT4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28767.1"
FT                   /translation="MKKRISWVEILGLILAVIWIAPFYLMIVNAFKSRNEIFSGVLGLP
FT                   ESLSLDNFVQAWQDLDFLNSLMNSVIITVGSVAIIIFFSSMAGYALARNKSKLSGVILL
FT                   LFVAAMLIPFQSVMIPLVSLFNQAGMLNQAGLIFMYLGFGCSLSIFLYHGAMTGISASL
FT                   DEAALIDGANKWQIFFYIIFPLLKPISVTVGILNTIWIWNDYLLPSLVLSESTATIPLK
FT                   MFFFFGQYTTQWHLALAGLVLAVIPVIIGYFLAQRHIIEGVAEGAVK"
FT   gene            537457..538176
FT                   /locus_tag="Bcell_0486"
FT   CDS_pept        537457..538176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28768"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6TWT5"
FT                   /inference="similar to AA sequence:KEGG:BMD_2103"
FT                   /protein_id="ADU28768.1"
FT                   /translation="MNVLVWNENRHEKKNPVVSEIYPKGIHGAIANFLQEEHVTVNTAT
FT                   LDEDEHGLTEELLNKTDVLIWWGHIAHDEVQDEIVERVHKRVLDGMGLIVLHSGHFSKI
FT                   FKKLMGTTCDLKWREADEKERLWVVDPSHPITEGLGEYIELEKEEMYGEHFDIPSPDEL
FT                   VFLSWFEGGEVFRSGAAYQRGKGKVFYFRPGHETYPTYYNQDIQRVIKNAVRWVNNANT
FT                   PTPVYGNAKPLEAISKK"
FT   gene            538198..539223
FT                   /locus_tag="Bcell_0487"
FT   CDS_pept        538198..539223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0487"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: oih:OB2565 NADH-dependent dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28769"
FT                   /db_xref="GOA:E6TXF5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXF5"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADU28769.1"
FT                   /translation="MTTLKIAVIGCGSIAKHRHLVEYANHPEANVVAVCDIVDERAQEM
FT                   AELYDANAYTNYETLLQEEEIDAISVCLPNYLHGPVTIAALKAGCHVLCEKPMATSQEE
FT                   ADEMIQVAKEKGKKLMIAHNQRFVASHEKAKKLIESGEVGRVYSFRSTFGHGGPETWSA
FT                   DGKESWFFKKDEAFIGAMGDLGVHKADLLRYILGEEFVEVASFIEGNAKENSDVDDNAV
FT                   CILRTESGVIGTLAASWAYTAKEDNSTIIYAEKALLRLEDDPTYSLIVEYANGESVYYQ
FT                   LGQIQSNEDGGQNNTHVIENFIESIKNNTESVISGTEGMKSLKVILKALESSAENKIVR
FT                   F"
FT   gene            539324..540292
FT                   /locus_tag="Bcell_0488"
FT   CDS_pept        539324..540292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0488"
FT                   /product="Xylose isomerase domain-containing protein TIM
FT                   barrel"
FT                   /note="PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; AP endonuclease 2 domain protein; KEGG: oih:OB2563
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28770"
FT                   /db_xref="GOA:E6TXF6"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXF6"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADU28770.1"
FT                   /translation="MKLGVFTVLFAEKSFEDMLDHVKASGLKAVEIGTGGYPGNSHCNV
FT                   DELLESEEKRKQYLEKVHSRGLEISAFSCHGNPISPDKAFAKESHESFLKTVKLAQMLD
FT                   VPVVNTFSGTPGDSEDGKFPNWPVAPWPNEYADILEWQWEKKLIPYWKEQGHFAKEHGV
FT                   KIGLELHAGFLVHTPYTMLKLREATNEAIGANLDPSHLWWQGIDPVAAIKILGKENAIH
FT                   HFHAKDTYIDQDNVNMYGLTDMQPYSSIQTRAWNFRSVGYGHSIQEWSNIVSALRTFGY
FT                   DYVISIEHEDPIMSIDEGFSRAVKNLKSVIIEEAPTEMWWA"
FT   gene            540323..541012
FT                   /locus_tag="Bcell_0489"
FT   CDS_pept        540323..541012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0489"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   oih:OB2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28771"
FT                   /db_xref="GOA:E6TXF7"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXF7"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADU28771.1"
FT                   /translation="MDKRGFVGGVYALFEWIMRFSVINLLWLLFNLPILFFIVNLIFAQ
FT                   TIADFILLLIPIIILIPILFFPATTAMFASARSWIVDSEDLPLIRTYWRFYKSNYKKSC
FT                   LGGIMLTILWVICVVDVYYFAQYNMPLMYVFIAMGLILFVYTINFFSLLSHYEMKLFAL
FT                   LKNTLLVTVASPLLFLTVVLSSALILYMSFEVFPFLIPFFTGAIIAFLSFSAFYRFYLK
FT                   IEALKEA"
FT   gene            541076..542158
FT                   /locus_tag="Bcell_0490"
FT   CDS_pept        541076..542158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0490"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bpf:BpOF4_02325 transcriptional regulator
FT                   involved in carbon catabolite control; PFAM: regulatory
FT                   protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28772"
FT                   /db_xref="GOA:E6TXF8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXF8"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADU28772.1"
FT                   /translation="MIQSTRDNKKRKVGGTAMVTIKDVAKRVNVSPSTVSRVIANSSRI
FT                   SEKTKERVRRAMDELGYHPNLNARSLSNKATQTIGVIMPITAQYSFQNPFFPEVIRGIS
FT                   MKAYQDNYGLYLSTGQKEEEIFEEVKQMVYGGRVDGILLLYSSINDKIMPFLQEKNFPF
FT                   VLIGRPHNIDENDITFVNNDNVKKTKTLTEYLLLLGHKKIGFISGSLDYVVTIDNLEGY
FT                   KTALNNANISIREEYIVLEENYQKEIMETGQDAVIELMSLEERPTALVVTDDIMTFGVL
FT                   SMLGEMGIRVPEDLSIVSSNNVMISELSSPPMTTADINIYDLGYKGVEYLINKIKEPEL
FT                   PEKKLIVPYKLIKRQSCKKI"
FT   gene            542290..543951
FT                   /locus_tag="Bcell_0491"
FT   CDS_pept        542290..543951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0491"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: oih:OB2556 oligo-1,6-glucosidase; PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28773"
FT                   /db_xref="GOA:E6TXF9"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXF9"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADU28773.1"
FT                   /translation="MKQTWWKEAVAYQIYPRSFMDANGDGIGDIKGIISKLDYLRELGI
FT                   DVIWVCPIFESPNDDNGYDISDYKGIMKDFGTMDDFDLLLKEVHQRGMKIILDLVINHT
FT                   SDEHPWFIESRSAKNNPYRDYYLWHPGKDGKEPNNWESIFGGSAWEFDETTEEYYMHVF
FT                   SKKQPDLNWENENVRKDLYEMVNWWLDKGIDGFRVDAISHIKKVPGFPDLQNPDNKRYV
FT                   PSFEGHMNRPGIHSFLDELKRETFHKYDIMTVGEANGVKVDEAEKWVGEKEGCFNMIFQ
FT                   FEHLDLWGKSTEGRLDLPALKETLTRWQKGLDGLGWNALFLENHDQPRSVSTWGNSGEY
FT                   RERSAKALATMYFLMQGTPFIYQGQEIGMTNVQFESIDDYNDVAIKNLYKNEMDDGKTH
FT                   EEVMEIIWKTGRDNSRTPMQWSNESHAGFSTSDPWIKVNPNYKEINVEQSIKNRDSIYH
FT                   YYKKLIKLRKQEKALVYGSYDLVLESHSKVYAYTRTLYDDKFLIIANLFPEVVTSEFPS
FT                   HIKEKNMKLMLSNYGDVPSVGKEVTLQPYEARVYRV"
FT   gene            complement(543990..544691)
FT                   /locus_tag="Bcell_0492"
FT   CDS_pept        complement(543990..544691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0492"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   bha:BH1970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28774"
FT                   /db_xref="GOA:E6TXG0"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG0"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ADU28774.1"
FT                   /translation="MLDYIFLVKALISFFYLFLLTRLMGKKQLAQLTYFDYIVGITIGN
FT                   FAASMVVEPEIHTIEAMIAVTVWGVLPVAMSILSRQRFFLRRLFEDQPVVVIENGKLCT
FT                   DILNKENMTVHNVMLMLRKAGHFKLKDIELAILETTGDLSVKTKKNASNVTVNDLKQQN
FT                   QQQSQEPKILIIEGHILKETMKTLNVTKEWLLAEVKKKGATNLNQVLIAQLQSDGSLYV
FT                   DIWHEKKEDAL"
FT   gene            544767..545132
FT                   /locus_tag="Bcell_0493"
FT   CDS_pept        544767..545132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lif:LinJ31.1750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28775"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG1"
FT                   /inference="similar to AA sequence:KEGG:LinJ31.1750"
FT                   /protein_id="ADU28775.1"
FT                   /translation="MLKLFRSKLFKMIVVGVLIFGISWLHTNMKTVDNPVSRQVDEVRA
FT                   AVYENDWELVQKEIEKMKDLFDERRGRIELFGPIEHVNDTRVNMTTLVEVARHGEKHDV
FT                   LRLLAKIEARLDDFIIF"
FT   gene            545596..546039
FT                   /locus_tag="Bcell_0494"
FT   CDS_pept        545596..546039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0494"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: bce:BC3128 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28776"
FT                   /db_xref="GOA:E6TXG2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU28776.1"
FT                   /translation="MDNNNDEELSLKLFIVLSRAFQSIKKRVEEDIRSYGLNPTEFAVL
FT                   ELVYHKGDQPIQRIGDKVLIASSSITYVVDKLEKKQLIKRRPCPSDRRITYATITSKGE
FT                   NFMNEVFPKHKTAIDEICAGLDSKERDFMIHQLKKLGYFAQKL"
FT   gene            546305..546916
FT                   /locus_tag="Bcell_0495"
FT   CDS_pept        546305..546916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0495"
FT                   /product="flavoprotein WrbA"
FT                   /note="KEGG: bpf:BpOF4_18640 multimeric flavodoxin WrbA;
FT                   TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric oxide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28777"
FT                   /db_xref="GOA:E6TXG3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG3"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ADU28777.1"
FT                   /translation="MANIKLAVIYYSSTGTNYTLAKWAEAGAKEAGAEVKVLKAPELAP
FT                   QAAIDSNPAWKAHVEEAKDVPEVTLDDLEWADAIIFSTPTRFGNMPSQMKQFLDTTGGL
FT                   WANGKLANKIVSGMSSASNAHGGQEATILSLYTTMYHWGAIVVTPGYTDPVQFASGGNP
FT                   YGVSVTVDQEGNMQEDVQEAAKYQAKRTVQVAEAFKKGNL"
FT   gene            547031..548014
FT                   /locus_tag="Bcell_0496"
FT   CDS_pept        547031..548014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0496"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bmq:BMQ_2308 glyoxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28778"
FT                   /db_xref="GOA:E6TXG4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADU28778.1"
FT                   /translation="MNELKGLHHVTAITSSAEKNYEFFTYVLGMRLVKKTVNQDDIQTY
FT                   HLFFADDKGSPGTDMTFFDFPGIRKGTHGTNEISKTSFRVPSDAALDYWVKRFNRLNVK
FT                   HEGIIDQFGKKTLSFVDFDDQHYQLISDENNIGVESGTPWEQGPIPLEYAITGLGPLFI
FT                   RIANFDYFKEMMEKVLLFKEIAKEENIHLFEVGEGGNGAQVIVEHNAELPQAQQGFGTV
FT                   HHAAFRIDDRKVLEEWDSRLRQFGFQTSGYVDRFFFKSLYARVAPQILFEFATDGPGFM
FT                   GDEPYETLGEKLSLPPFLEDKREQIEKMVRPIDTVRSTKEIKKEYE"
FT   gene            complement(548233..549501)
FT                   /locus_tag="Bcell_0497"
FT   CDS_pept        complement(548233..549501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0497"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: bca:BCE_1455 sporulation kinase B; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; 5TM Receptors of the LytS-YhcK type
FT                   transmembrane region; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28779"
FT                   /db_xref="GOA:E6TXG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU28779.1"
FT                   /translation="MDSVLFDYIQLVLLNLSFIFILFFIYHKFLEDKYKHSTALKVLVS
FT                   GISIVLCMTFSINLVNEGYYFDMRLVPFIIGALYGGRRIGLILFIILLSYRYLLGGEGF
FT                   YVTMFEYTTIYVLLWFLIPLFSRVNKIKQKVKIAVIISAVDMIGLIIMVGFININEGFS
FT                   ILPFVLASSLYIIQILGVILFVIFIEKAREENEIVSEVKRLEKLRIVGDIAASISHEIR
FT                   NPLTVTRGFLQFMKRNDITPDKRTQYIDFSLGELSRAEDIINDYLTFAKPTLENVMKLD
FT                   VLEELKYVKNVVTPFALINNVEILFKNTAEVFVIGEKQKLHQCLINIVKNGVEAMPDGG
FT                   ILTIDLQMINKHAHIAIQDTGIGMNREQIERLGSPYYSTKDKGTGLGTMVVYSIVKAMN
FT                   GKMNVASELNKGTTITLVFPVVV"
FT   gene            549907..551721
FT                   /locus_tag="Bcell_0498"
FT   CDS_pept        549907..551721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0498"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   Glycerophosphoryl diester phosphodiesterase, membrane
FT                   domain; KEGG: amt:Amet_3115 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28780"
FT                   /db_xref="GOA:E6TXG6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG6"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADU28780.1"
FT                   /translation="MLRMLRSSIHDFSISYKKYLSFAFIYMLLTSFLFVPLISYIFNRM
FT                   IKLMGTGSLLNAEVYKIGSSFPGLMGMLLISFLVSLILFLEFGVMILIAQQGYFRKRIY
FT                   VSQALITTMRKFPKILGFGLFQIILITLLFIPFIELSVFPALLDFNIAIFLTSQLYGSS
FT                   DLAIFIYLLIVILAIYLFIRFLFTLHYIFIEECSVWKSMQLSWKLTKKNNLKTIFYLIL
FT                   LNVLIFIVGFLFITMISYIPSLVETVAVGTFIQNYLVTFSSFMAIIFSLLLVPINVIIV
FT                   TRLFYRYRKRNGEDIEDALNIYGSKSLITVEKRVKRFFSKRFTISAAVFIYVTSMFFIN
FT                   FTINDNLVYLNWNVQVAAHRGDLHSAPENSLSSIRSAIDKGVDAVEIDVMLTKDGEIIL
FT                   NHDYTFQRVAGVPDRVIEMTYEEVAEVDIGRLFSDEFIGEPVPTLEEAIIEVMDENVTF
FT                   IIDVKIDSTGEDRRDELAKGIVDLVEQYDMVDVTYVQSFDYDVLQEVRQRNSDIKIGQI
FT                   LYLSAGNLSSLDVDFYTIRQTMLSERFIENARRLDREVWVWTVNLERNMREVLKYDIDG
FT                   IITDYPERAQRVIGIDFAGEEELPMEGS"
FT   gene            complement(551981..553558)
FT                   /locus_tag="Bcell_0499"
FT   CDS_pept        complement(551981..553558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0499"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_1567 ATP binding protein VgA; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28781"
FT                   /db_xref="GOA:E6TXG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28781.1"
FT                   /translation="MLLLEANDVEVCVQDRLLVKTERLEIHTKDRIGLVGKNGSGKTSL
FT                   LSVLNGDTHPDKGSVTSHYTCALLPQLKRTDTTKSGGEITQQYIRNCLLRNDEILLADE
FT                   PTTHLDMEHIDWLEKSLLHWQGAFVIVSHDRTFLDAVCNKIWEIDEQQQLQDYTGNYSA
FT                   FTTQKQLKEQQHEMAYDKYVKKKKQLESALELKEKKAQKATKKPKSVSTSEAKLTGAKP
FT                   YFAKKQKKLQKTSKAIETRLSKLDKIEKPREITKIKMNIPNESTIKNRAIIRLENVSGF
FT                   VGNRKIWEQTSFHVNGGDKLAILGRNGSGKTTLIKKIMHADENVYVSPAVKIGYFSQNI
FT                   DILDSNKSILENVSSTSIQDETFIRTVLARLHFFRDDVYKLVNVLSGGERVKVALAKIF
FT                   VSNCNTLLLDEPTNFLDIEAVEALESLLQEYEGTVLFISHDRRFIKNIATKTLTIENKK
FT                   IDFFNGSYKEYKQQKPLEVRNSLEDELLMIDTKITDILSRLSIEPTEELEVQFQELLAI
FT                   KRALTENE"
FT   gene            554162..555091
FT                   /locus_tag="Bcell_0500"
FT   CDS_pept        554162..555091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC1094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28782"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG8"
FT                   /inference="similar to AA sequence:KEGG:ABC1094"
FT                   /protein_id="ADU28782.1"
FT                   /translation="MMRFFIAKLLFLFVMMMIIAGCGQGEGNIGSGGLNDESNWEIGQG
FT                   DLPSSIGDIEKKVDMMDEQAIPPFHSLEYLWDKTPFDEPTGKWFMHNGQGVLGYGLTTG
FT                   TKKGGDEFAVTFIGHKDEGEPMNRDVRIQLSELDGYDIKEVIVEEIVYIDTVGSNEQIF
FT                   SGELPHKENVLYMLSAEILNENEEVEDSFISLIFVPKPEMNAALQTDKSLYEQSDNDLT
FT                   LILQNAGPTVLFYGTYYTIEKKVEDDWRVVPLDMAFHDIGLYSKFGETYEQKVDISQLN
FT                   AGQYRVIKDISVEGLDITQTLAAEFIIE"
FT   sig_peptide     554162..554239
FT                   /locus_tag="Bcell_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.660 at
FT                   residue 26"
FT   gene            555258..557054
FT                   /locus_tag="Bcell_0501"
FT   CDS_pept        555258..557054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0501"
FT                   /product="oligoendopeptidase F"
FT                   /note="KEGG: bcg:BCG9842_B5368 putative oligoendopeptidase
FT                   F; TIGRFAM: oligoendopeptidase F; PFAM: peptidase M3A and
FT                   M3B thimet/oligopeptidase F; Oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28783"
FT                   /db_xref="GOA:E6TXG9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXG9"
FT                   /inference="protein motif:TFAM:TIGR00181"
FT                   /protein_id="ADU28783.1"
FT                   /translation="MKKTLTRSEVPIEETWNLKDLFETEEAWERELGAVQNDVKSVTHY
FT                   KGRISKDARDMLDCLIANDALNERVMRVMTYAHLQQSEDGTNPINQARAARVSSVMSEL
FT                   KSQTAFIESEILELNNETITSFLNEEPRLEEFLKTLNDLLELKPYRLSSDAEEILAAFG
FT                   EVHSAPYMIYERSKTSDMKFTSFKTDDGKEHHLTFNSFPTYEGSAHTDLRRKAYDAFVS
FT                   TLNQYKNTYAATYATEIKKQVVEARLRNYESATQMLLHEQQVTEEMYNNQLNIILTELA
FT                   PHMRRYAKLKQHVLGLEKMTFADLKAPLDPNFDPSTTYEEASQLMLDSLKVMGNEYMDI
FT                   IEKGVQDRWVDRADNTGKRSGAFCSSPYGVHPYILMTWNDSMRNAFTLAHELGHAAHFV
FT                   LSGRYQRISNTRPSRYFIEAPSTMNEMLLSQHILEKSTDVRMRRWVVLQSLGTYYHNFV
FT                   THILEGELQRRVYELAHNGTPITANLLCEQKKELLQQFWGDAVEIDEGASLTWMRQPHY
FT                   YMGLYPYTYSAGLTASTAAAQMIKEEGQPAVDRWLSALKAGGTLKPLDLMKLAGVDMTT
FT                   SEPIKKAVAYVGTLVDELETSF"
FT   gene            557376..557735
FT                   /locus_tag="Bcell_0502"
FT   CDS_pept        557376..557735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28784"
FT                   /db_xref="GOA:E6TXH0"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH0"
FT                   /inference="similar to AA sequence:KEGG:Tfu_0836"
FT                   /protein_id="ADU28784.1"
FT                   /translation="MTEVENKGEVELQPTSDEKTMATLIHVLGIFFGVFSTLIIWLIQK
FT                   DKSKYVDHHGKQNMNWQLTLIIGYFASFILMFVLIGFLTIIAIGVLDLVFSILAAVAAN
FT                   KGERYKFPVAIPFIR"
FT   gene            557893..558366
FT                   /locus_tag="Bcell_0503"
FT   CDS_pept        557893..558366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28785"
FT                   /db_xref="GOA:E6TXH1"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH1"
FT                   /inference="similar to AA sequence:KEGG:Bmur_0901"
FT                   /protein_id="ADU28785.1"
FT                   /translation="MSFDSIFAAIFILLLLGFLSIMLIKKVKNKKVLLLVPFILVFTFA
FT                   LTYIPHSVVSMNPSGVSKITIFDGNTGSETVITEKDHIEYIITDLSDVTFQKGKSSFGY
FT                   MGYSFNTKIYNEKGKVVKELIINSEDTIRYKGFFYTAKDELIDYDYIKNLVDN"
FT   gene            complement(558640..561246)
FT                   /locus_tag="Bcell_0504"
FT   CDS_pept        complement(558640..561246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0504"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gym:GYMC10_3383 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28786"
FT                   /db_xref="GOA:E6TXH2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU28786.1"
FT                   /translation="MNIVNKLTLRHLKENKRRTLVTIIGTIISVAMITAVSTLSVSFLD
FT                   LMQRHQIANNGEWHVQYENVNPEQVETMKNDDNTKDVFLTRDKGYAYLESSENEFKPYL
FT                   FISEFNREGFEYFPISLVEGVLPSSNNEIIISEHIESNANVRFSIGDELILEVGKRVNE
FT                   ADNLTDMGQTQSFVKMDDESLEKIVNTTKETYTVVGIMERPMWEPLWAPGYTVISYLNE
FT                   DTLTANDRVNASVLLKDVNQSLYENAELFAEENNISLDSIDYNRHLLRYLGVTTFDTFR
FT                   ATLFSLSAIIIAIIIIGSVALIYNAFSISVSERSRHLGMLSSVGATKKQKRNAVFFEGA
FT                   VIGLISIPLGLLAGIGGIGITFIFINSFIEDALSIQAKLTVTVTPLSILTACIVSIITI
FT                   FISAYIPAQRASKVTPIEAIRQTSDIKVTRKKVKTSNIVRKLFGIEGEIGLKNLKRNKR
FT                   KYQVTVFSLIISIMLFLTVSFFTESIERSVELSNQGVNYDIELYTGEELTSEVGTIFEE
FT                   LKRLDGVTDYTHTTEIQSLRTWINERNLSDSLLEMVTDHPDILTDGKYQYFINIYGLHE
FT                   DSFHKYTEEIGVSAEQIIWSQGLSAIVVDTHTYQDWETGAFIETKAVKTSVGETIPLFY
FT                   EDWETNEELHVFDIEVAALTDTLPMGIRSSNMGGLNIIVHASILEQYMTEDFPYYPIHN
FT                   LYLTSDHPMETQQQIEEIKTDSMSVYNYYQTRQQDKQAMLIISIFIYGFIVLITAISIA
FT                   NILNTISTSISLRKREFAMLKSVGMTPKSFNKMIRYESIFYGIKSLLYGLPISIGFMYL
FT                   IHLAITQSFVYSFQLPWGSIMIVIVAVFIIVSATMLYSTSKVRKENIIETLKQENI"
FT   gene            complement(561243..561926)
FT                   /locus_tag="Bcell_0505"
FT   CDS_pept        complement(561243..561926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0505"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: oih:OB0359 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28787"
FT                   /db_xref="GOA:E6TXH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28787.1"
FT                   /translation="MEIVKVENLSKVYGKGDTAVKALDNVSLTINKGEFVAIIGPSGSG
FT                   KSTLLHLLGGVDRPSSGKVFIDNTDIYSLNETQLAIFRRRQIGLIYQFYNLIPILTVEE
FT                   NITLPILLDEHKVDKDHFSKIVDVLSLNDRLNHLPNQLSGGQQQRVSIGRALISNPAIM
FT                   LADEPTGNLDSKNSSEIIDLLKLFNKTYYQTLVVITHDERIALQADRVISIEDGRIAKD
FT                   EVIRK"
FT   gene            complement(562026..563027)
FT                   /locus_tag="Bcell_0506"
FT   CDS_pept        complement(562026..563027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0506"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: gym:GYMC10_3386 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28788"
FT                   /db_xref="GOA:E6TXH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU28788.1"
FT                   /translation="MLRNKEFQILLVIMIFISIAATAATLYFSVEAAIIVAITTILLIV
FT                   STIAFTIWRYREIRKLSSYLRKISSGDYSLDVRDNKEGELSILKNDIYKVTLMLSEQRA
FT                   VLMTDKSKLTDAISDISHQLKTPITSMMVMSDLLSDSKLTAEKKKEFTRNIRVQLERIE
FT                   WLVSSLLKLSKIDARTIQFKRDTVQVKQLIDKAVDPIRIPMDIQEQTLSIVGEETVSFI
FT                   GDLNWSAEALLNILKNCVEHTKSGGNIHITFSENALFTEIIIRDNGVGIAKEDVPYIFK
FT                   RFYKGKNASDESVGIGLAMAHSIITSQNGTIEVQSECNSGTTFNVKFYKQVI"
FT   sig_peptide     complement(562956..563027)
FT                   /locus_tag="Bcell_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.920 at
FT                   residue 24"
FT   gene            complement(563029..563703)
FT                   /locus_tag="Bcell_0507"
FT   CDS_pept        complement(563029..563703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0507"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: gym:GYMC10_3387 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28789"
FT                   /db_xref="GOA:E6TXH5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU28789.1"
FT                   /translation="MKILLVEDDKTIASGLEYSLQQDHFDTVLCYDIQSAQKIINHEIS
FT                   SIDLCLFDLSLPDGSGYELCKLVKQKSDTPVIFLTAYDDEVNVVMGLDMGADDYITKPF
FT                   RIRELLSRIKSVLRRYNKQTTIIKLHNIQINTLEGKVYKNGEEIIITALEYRLLLIFAN
FT                   HVGQVLTREQLLERIWDVAGDYVNDNTLTVYIKRLREKLEDNPQKPTLIKTVRGLGYKV
FT                   GD"
FT   gene            563888..564370
FT                   /locus_tag="Bcell_0508"
FT   CDS_pept        563888..564370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP3868A ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28790"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH6"
FT                   /inference="similar to AA sequence:KEGG:NP3868A"
FT                   /protein_id="ADU28790.1"
FT                   /translation="MKKVLLFCLVSVLIVLSTGCFGTGEESSTKEIDDPVEAAVYYYYD
FT                   SLQKENYDEALSYLASDYLTYLNISERDYVNIFKDMRTLEDWRIEEISVRSIDEIDDDI
FT                   TVPFALEPLLVTSGDNYIVIVDISISIHGETSGVVDNVLVAEDNNGEWKIFGIVSF"
FT   sig_peptide     563888..563956
FT                   /locus_tag="Bcell_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.941 at
FT                   residue 23"
FT   gene            564539..566119
FT                   /locus_tag="Bcell_0509"
FT   CDS_pept        564539..566119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0509"
FT                   /product="peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: bha:BH0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28791"
FT                   /db_xref="GOA:E6TXH7"
FT                   /db_xref="InterPro:IPR001548"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH7"
FT                   /inference="protein motif:PFAM:PF01432"
FT                   /protein_id="ADU28791.1"
FT                   /translation="MAVEQFLQTQNEKIRELYRGITNASWKAQTTGDKEWAQKVGEAQT
FT                   QFRTYFSDKELYETVTSYLKMDNLSALQKRQLEALQKTLRENQLPKDILKELSQLSAEL
FT                   NHMFNTYAPEVDGKKLSANDIRNILLNSDDVQERENAWKASKEVGQVVEGKLLTLVRKR
FT                   NEAAKAVGFDNYHQMSFKNQELDREEIFSIFQKLIDDSDKAFRALKAELDEEIASKFNI
FT                   TVEEIRPWHYVDPFFQEAPASEETNLDPYFKNEDLNKLTADTFSAMGIPIDDLYAKSDL
FT                   LPREGKNPTAFCTDMDREGDTRVLCNNEPNAYWMGTMLHEFGHAAYFKYLDRELPFILR
FT                   SPAHTLTTEAIAMLFGKMTQNKEWLKTFLKLEDSKLDELAPALEKHEQLMMLIAGRWII
FT                   TFVFFEKELYENPEQDLNGLWWKLVSEIQLVNPPEGRDLPDWAAKIHFTLAPVYYQNYL
FT                   LGELTSAQLHHYINKQVSDQFFTPEVGQVLNEQFFKLGSKYHWNEKIERVTGEKLNPEY
FT                   FSEAYCKIK"
FT   gene            complement(566449..567189)
FT                   /locus_tag="Bcell_0510"
FT   CDS_pept        complement(566449..567189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0510"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: bcy:Bcer98_3564 MerR family transcriptional
FT                   regulator; PFAM: TipAS antibiotic-recognition
FT                   domain-containing protein; regulatory protein MerR;
FT                   Transcription regulator MerR DNA binding; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28792"
FT                   /db_xref="GOA:E6TXH8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH8"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ADU28792.1"
FT                   /translation="MGMKVKEVANLVGISIRTLHHYDEINLLTPDEITNSGYRLYSDKD
FT                   LEKLQQILFFKELGFPLKKVKEIIDCPTFDRERALELQRKSLLEKRSRLDKMIKTIDKT
FT                   MRHAKGEINMSNKEKFEGFDFHNNRYEQEARERWGDQAVDESKAKIANMPGDPEAIVTE
FT                   IYSKLAALRHQSPQSAEAQSAIKEWFDCLNKNFGNYSLEAFKGLGQMYVDDERFTQNID
FT                   KMGEGLAQFMCDAMVHFADTTKNK"
FT   gene            complement(567484..567993)
FT                   /locus_tag="Bcell_0511"
FT   CDS_pept        complement(567484..567993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0511"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="KEGG: lsp:Bsph_0266 spore protein YkuD-like protein;
FT                   PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28793"
FT                   /db_xref="GOA:E6TXH9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXH9"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADU28793.1"
FT                   /translation="MEVIPFFHTVLPGETLNQIAIDYRTPLTTIINANPNLDPNVIYPG
FT                   QSIVIPGFPPLNTIPYVIDVSIRGRSLILLKDGVQQKQYSIAVGRILHETPTGKFIIIN
FT                   KAPNPGGAFGTMWMSLSKQHYGIHGTNDPSSIGNAVSKGCIRMHNQDVEELASIVPIGT
FT                   PVVIRP"
FT   gene            complement(568779..570953)
FT                   /locus_tag="Bcell_0512"
FT   CDS_pept        complement(568779..570953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0512"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="TIGRFAM: Polyphosphate kinase; KEGG: afl:Aflv_1913
FT                   polyphosphate kinase; PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28794"
FT                   /db_xref="GOA:E6TXI0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI0"
FT                   /inference="protein motif:TFAM:TIGR03705"
FT                   /protein_id="ADU28794.1"
FT                   /translation="MKISTLVNTTHYNNRELSWLAFNYRVLEEAIDERNLLMERFKFLS
FT                   IFSSNLDEFFMVRVAGLTDQVKAGFTKPENKAGLTPKEQLTLIAEKTQPLVKKQYETYE
FT                   MLLSLLSKQGISLTQINSLSREELFFLEQYFDEQIYPVLTPRAIDAYRPFPMLLNKSLN
FT                   LAIVIDGQDNEHEQITDLSGKLAIVQVPSVLDRYVLIPSFTNERKYILLEDLITTFIHK
FT                   LFFGRSIKSVTSFRITRNADLTIHEDEAIDLLIEIEKELKKRKWGAAVRLEIKENEYDH
FT                   NVLKYLKQRLGIHEKDTYIVNGPLDLTFLFTFYEEIGRFNPSLIDLPMVSQQPVDLEDN
FT                   KKIFDVALKKDILLHHPYDSFQTVVDFISLAANDPNVQAIKQTLYRVSGNSPIIHALKR
FT                   AAINGKQVTVLIELKARFDEENNVSWAKELEKEGCHVIYGMTRLKTHSKITLIVRRMEG
FT                   KIERFVHLGTGNYNDKTAKLYTDIGLITSEEEIANDATRFFNYISGYCDKPEYHHFSLA
FT                   PLDIRDDFIRLIEKEIRNHEGYGNGRIIAKMNSLSDKKIIDKFYEASSKGVKIDLIIRG
FT                   ICCLRPGIKGVSENITVRSIVGQYLEHSRIYYFYHNGEEKTFISSADLMTRNMENRIEI
FT                   LFPLLSTEIKDRVVSWLLLYLSDNTKARTQDRNGNYHYVTPLEGEPLINSQLAVSNRGF
FT                   TPPIQKGFTHYFYTFKENIIKKFIKTNKHH"
FT   gene            complement(571314..575771)
FT                   /locus_tag="Bcell_0513"
FT   CDS_pept        complement(571314..575771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0513"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="KEGG: bha:BH1015 hypothetical protein; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   5'-Nucleotidase domain-containing protein;
FT                   metallophosphoesterase; Gram-positive anchor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28795"
FT                   /db_xref="GOA:E6TXI1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI1"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU28795.1"
FT                   /translation="MFLKKTWSKGIIYWMILALVFSIVTPIQTVSASSNDDIVTLESTT
FT                   EDNVTTGNEDLLDLTILHTNDIHSRIDELGKAAAFINAEREAAENSLYLDAGDIFGGSP
FT                   VNDINLGEPIIEILNEMNLDALTIGNHEFDYGQDAFADRVIQSDFPWISANMTVSPEIP
FT                   IEQPDPYTIFEFDDFDVAVFGLTQNPPATAPSGIVGIEFHNYVETALQYQDEMEAQADI
FT                   IIALTHIGNSADRRLAESVDYFDVIIGGHSHSVINSPQVVNGTPITQAGGYASHVGKLN
FT                   LSIDPETKEVVDVTGHLQSIDQLTETEENIQSIIDSWNIQMEDILQITIGESDTGLTRD
FT                   GRNSRDIALGNFWTDAMVWATEADMAFTNNGGVRDSIEPGAITIGDIYRVEPFDNQVML
FT                   YEMTGQAIKDVIQYSYSRFRNVDLQTSGLHYTILTDENRYYSDAILELNGEPLNMEQTY
FT                   IVALPDFIGTGGSGYHFVGEVIYPEVMPVTTAMIQYAEFLTEQGKRLNYESEGRISIIL
FT                   HSELEPTNPEPNDPPNSEVLDLTILHTNDIHSRIDELGKAAAFINAEREAAENSLYLDA
FT                   GDIFSGSPVNDINLGEPIIEILNEMNLDALVIGNHEFDYGQDVFAERVIQSDFPWISAN
FT                   MTVSPEIPIEQPDPYTIFEFDDFDVAVFGLTQNPPATAPSGIVGIEFHDYVETALQYQD
FT                   EMEAQADIIIALTHIGYGADRSLAEEVDYFDAIIGGHTHTTLSTPQVVNGTPITQAGGY
FT                   ASHVGKLNLSIDPETKQVIEVSGGLQEISSLSEVDEDVQAIVDHWNEQMDEILSIVIGE
FT                   TETGLSRNERYETDAPLGNFWTDAMAFAASADIAFTNNGGIRDSISPGDVTIGDIYRIE
FT                   PFDNQVMLLEMTGEAIKNVIEYSYTRDGRNQIDLQSSGLHYTILTNSSGQYIDAILEIN
FT                   NEPINMNASYLVAVPDYIGTGGSGYHFEGEVLYNEVTPMTTAMIDYAEYLGLQGQKLNY
FT                   HIEGRINIKIDPNADTPDGNTIGATTNGLYSDNKSAMDVGLGNLYADAVRSIANADIGL
FT                   LNGSSVSGNIPAGDITIEQIEQLDRFGNEIVLVETTGAQLKEMILSQSNFHRNVDLQAS
FT                   GIHYILVKGDGPQTFSDVSIYLEDGTPIIEDAVYTVAYNDFMHNGGHYTLSNETIEIEP
FT                   ITVWEAVVEYVKAQEGPIDYVEGSRIYVEILAHPRVEEETIFISDDIVDKITKNSVLAI
FT                   NLHSDEFSSISKITFSQSQIDALRENNVNVYITTDFFTISFPAAMFSSGEVEFSFENVN
FT                   EEEIDLTKIDEIGHLLSKVYNFTFLHNGQPFTQFGEYDVTLKLPLVHEFDNEENVSVYF
FT                   YDKSEEQWTSIGGTLDNGVIQAQTNHFSMFAAFEFFEGTEQEPIDPVDPVDPIDPVDPI
FT                   DPIDPIDHVDSTDSVDQNPEQDGSKESDKEDDIEKKIVEDEKKGSNKTLPDTATDVYQW
FT                   LLAGLLLIFLGISLTLIRNRHKTV"
FT   gene            576112..577095
FT                   /locus_tag="Bcell_0514"
FT   CDS_pept        576112..577095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0514"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   gwc:GWCH70_3164 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28796"
FT                   /db_xref="GOA:E6TXI2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI2"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADU28796.1"
FT                   /translation="MVRFAVIGTNWITESFIQAGAQVDDFQLVAVYSRTKERAEEFAEK
FT                   YNLKHTYTDIQALAKSPEVDAVYIASPNAFHAEQAITCMEHGKHVLCEKALASNSKEAK
FT                   EMVKVAKQNQVLLMEAVKSTLLPNFFTVKEHLHKIGKIRRYVASYNQYSSRYDAYLNGT
FT                   VLNAFNPKFSNGSLMDIGIYCIYPMVVLFGKPLHVKASAVLLESGVDGEGSIVMSYVDM
FT                   EAVVMYSKITNSSQPSEMQGEKGNIILNNIHTPTKVEINYKDGTTEDVSLPQKETEMYY
FT                   EVKEFVELIKAGKTESAVNSHENSIIVSEVVEEARKQTGVIYPADE"
FT   gene            complement(577238..577969)
FT                   /locus_tag="Bcell_0515"
FT   CDS_pept        complement(577238..577969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28797"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI3"
FT                   /inference="similar to AA sequence:KEGG:Nther_1851"
FT                   /protein_id="ADU28797.1"
FT                   /translation="MIFQAQKGQVYYGHKIGILMLDTFIPLIPGDVGNATTYDYPVLYR
FT                   TLHKITAHKMVNKAPGVLEEIISKGKELVDNGAEAITGGCGFLLLYQDELRKALNVPVF
FT                   LSSLLQIPFMLLMLNTNEKVGLITADSSLLKASLLREIGIAEIDRVEIVGLEKTEHFRE
FT                   CCMNESGTLNSDVLEAEVVTTAEKMVHTNPNIKSILLECSLLPPYAKAVQEAVHLPVFD
FT                   YVTMINYVQASLNKTNFSGFL"
FT   gene            578159..579325
FT                   /locus_tag="Bcell_0516"
FT   CDS_pept        578159..579325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0516"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="KEGG: gka:GK2102 tryptophan synthase subunit beta;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28798"
FT                   /db_xref="GOA:E6TXI4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI4"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADU28798.1"
FT                   /translation="MSMREDEKRGYFGEFGGSFIPEELQKVMDILEENFENYRNDPEFI
FT                   EEYKYYLKEFVGRENPLTYAKNISEKFGGAKIYLKREDLNHTGAHKINNVIGQILLAKR
FT                   MGAKRIIAETGAGQHGVATATACAMFNMDCTVYMGKLDTERQALNVFRMELLGAKVISV
FT                   DAGQGRLKDAVDAALGDLVENYENTFYLLGSAVGPHPFPSMVKHFQSIISEESKQQILE
FT                   KEGKLPTAVVACAGGGSNAIGAFAHYIDEKDVRLIGVEPAEAPTLTEGVPAVIHGFKCL
FT                   TLLDEDGNPRPTYSISAGLDYPGIGPEHSYLKESGRAEYVAVTGDEALEAFQLLSKEEG
FT                   IIPALESSHAIAHAVKLAKELSKDDILIVNLSGRGDKDVEQVFKMINQ"
FT   gene            579507..579914
FT                   /locus_tag="Bcell_0517"
FT   CDS_pept        579507..579914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0517"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: bcu:BCAH820_2824
FT                   BtrG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28799"
FT                   /db_xref="GOA:E6TXI5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI5"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADU28799.1"
FT                   /translation="MKKKHFVFCYGTLRKNESNHHLLKDANCICEHSLTEGKMFDTGYG
FT                   YPVIIQDAISKVHGELYEITDEELDMLDRLEGYESRSAQHNLYERIRQKVITHKGEYEA
FT                   FVYIEGVNQNLCTTYIEHGDWKVYRKNREDD"
FT   gene            complement(580189..580893)
FT                   /locus_tag="Bcell_0518"
FT   CDS_pept        complement(580189..580893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0518"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bcx:BCA_0334
FT                   protein disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28800"
FT                   /db_xref="GOA:E6TXI6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI6"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADU28800.1"
FT                   /translation="MKIEIWSDFVCPFCYIGKRRLEIALDHFSNKHAVDVSFRSFELDR
FT                   NAAPYSGKSIHEMLAEKYGMSIEDAIKANQGVAEQADSIGLTFQFENMKPTNTFDAHRL
FT                   AKYAKSQEKEGELTEKLLSAYFTESKNVGDVETLTNIATSVGLDKGTVVEILDNKSSFA
FT                   DDVRADEELAKEYGVSGVPFFLIDEKYAINGAQPLENFIGALEKIWEEEHNKPKIRDLS
FT                   LTKGNACSDDSC"
FT   gene            581256..581954
FT                   /locus_tag="Bcell_0519"
FT   CDS_pept        581256..581954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0519"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbe:BBR47_15640 probable ABC transporter ATP
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28801"
FT                   /db_xref="GOA:E6TXI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28801.1"
FT                   /translation="MKPIVSVENVERSFGKGNKKVQVLNGINLTIDPYSVTALRGRSGS
FT                   GKTTLLNLIGGLDKPTNGEIYFQEAPISEYSDTQSAEFRRKNLGIIFQSFGLVPLMTVE
FT                   ENVEFGLRIAGVPRKEWSERIKETIALVGLTKRAKHRQYELSGGEQQRVAIARALAPRP
FT                   KLILADEPTAELDSKMAFHIIRVFQELTKNKETTIMMTTHDPGILEILDHVYTLEDGKI
FT                   ESAKQEQETK"
FT   gene            581920..582966
FT                   /locus_tag="Bcell_0520"
FT   CDS_pept        581920..582966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0520"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: pjd:Pjdr2_4258 efflux transporter, RND family,
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28802"
FT                   /db_xref="GOA:E6TXI8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADU28802.1"
FT                   /translation="MNLQNKSKKLNNTRILLSCLIALPLLLSGCSLLPQEEEMIAPPLV
FT                   EPASVDYDLVEVQRGDITKKVTGTAYFVPVHSKNLFYEQSGGRLQHVEVKEGDIVEEGQ
FT                   LLAEIDTGNLVHDIEQLEIELAKADIRLKQVKGSGADSYSIELAELDKEGIELRLSQLR
FT                   RQLATAQITSPIDGIITFVTAHKPGDYVDAYESIIQVADLSNLQLIYIASAANNISDVK
FT                   VGMQVALQMNGEDMRGEVVQTPETVPEDVLENNSTQYSRSLLIDFPDGAPEDVQVGDSV
FT                   SIEIVTERKEDTLVIPTNALREGFGRTYVHVLVDNRRRELDVEIGIESSTEVEILQGIE
FT                   EGDEVILR"
FT   sig_peptide     581920..582030
FT                   /locus_tag="Bcell_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.537 at
FT                   residue 37"
FT   gene            582981..585842
FT                   /locus_tag="Bcell_0521"
FT   CDS_pept        582981..585842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0521"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bbe:BBR47_15660 probable ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28803"
FT                   /db_xref="GOA:E6TXI9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXI9"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU28803.1"
FT                   /translation="MTIFKIIARKMLNNRWLTFSLFLGLLITVSLVSSIPTYTTAVMDK
FT                   MLVSGFEEFYEKEETFPSTFSYSINLARDESIDRTEMLEEMEVLQESLIESTNIPTARD
FT                   VTILSTSRLRVILAGDTEEEILTSGRVIALTDIEDHITITDGTLPSNRMEDGVIEAIVP
FT                   ERALTTRQMVLGNTFTIGEGEDAFKIKPVGTFTADSPRDPYWIVSAERYNSDFIILEDV
FT                   YREEIVHNRELVETVRFVSAFDYTAIQSEHIPTLLSLDPIVKREVNRMMDTILLIDFEV
FT                   EEILKTYNTQSAQLETVLWSLIAPVLIMLAIYLFMVSRLIINRQLNEIAVFASRGAKRI
FT                   QILFIYFIEITILGTIAFFVGPYLGLLYANILGATNGFLEFVQRTALPTQVLPESFLYG
FT                   FYAILASIMMVMIPVFVASKKSIVNHKQNLAASVNQYKWYSIFIDLSLIGVSIYGLYTF
FT                   QRGQAVSGSSGEIYIDPTLFFLPAIFIIGFGLLLLRIYPLILKAIYKLGEKIWSISLYS
FT                   TFLQVSRSSKQYQFFMMFLIMTIAIGVFSASAARTINTNLEEQILYETGADVALEVLWD
FT                   YEVRDPDPMNVNARAPVSESNDEEEEGFEREGTTGVREVMYTEPPFEPFENLIGVEQAT
FT                   RVFQKEDVRAEGNGQRMPSVQLMGIEPKQFGETAWFKGNILPHHWYEYLNLLSAEPSSV
FT                   LISSSVARSLGVQEGDYITLSWSESDTGQFVVYGIIDYWPSFNPNAQGGDNTPALVVAN
FT                   LPYVQNVMALEPYHVWLSVDENTSRSDLYQNIRDERLRVFRMHDVQPQIVELKNSGFLL
FT                   GLNGTLSLGFIISIVITFIGFLLYWIVTIKSRTMQYGIYRAMGIPMRDLIGIIIWEQVM
FT                   TSGVACFLGIIIGGITSQLFVPLLQYSFDSHTLAPPFRVVFDSSDEMKIYAFVGFMFIV
FT                   GLSILVALLRKIKVHQAIKLGED"
FT   gene            585842..586753
FT                   /locus_tag="Bcell_0522"
FT   CDS_pept        585842..586753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0522"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pjd:Pjdr2_4256 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28804"
FT                   /db_xref="GOA:E6TXJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28804.1"
FT                   /translation="MMISCENLVKIYKIDDEHEVMALQGLDLEVQEGEMMGIIGNSGSG
FT                   KSTLLNMLGALDRPTAGKLFVNGKDLLRISDKEQVKYKRDTVGFIWQNNARNLIPYLTA
FT                   VENVELPMLLKGRYKKQRAKELLEMVGLGHRINSKLDMLSGGEQQRVAIAISLANNPSL
FT                   LLADEPTGSVDTKTADIILDVFRNLNRELGVTIVIVTHDMQLSRKMDRVVNIRDGKTSS
FT                   EILRKSVYQDALNEDGTLKDGGLFGEEEEDTHVEYAVLDRAGRIQVPREYLDSIEIGDS
FT                   NKLEVVLEDGKIVLLNPKEQNK"
FT   gene            587289..588512
FT                   /locus_tag="Bcell_0523"
FT   CDS_pept        587289..588512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0523"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="KEGG: amt:Amet_2165 proteinase inhibitor I4, serpin;
FT                   PFAM: proteinase inhibitor I4 serpin; SMART: proteinase
FT                   inhibitor I4 serpin"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28805"
FT                   /db_xref="GOA:E6TXJ1"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ1"
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /protein_id="ADU28805.1"
FT                   /translation="MKKIITITIMLIYVVILLVGCGSNEDKSNFRTTPERKSDISDGQQ
FT                   KFAFDLISELENDLKENENMFISPMSISIALAMVVNGAEGETKEEILQTLHLNELSDEV
FT                   RNEYYKQLIMYLENHNEDFLMSIANSIWSDDKFEAKEPFITENKEMLFSEVREQPLLTQ
FT                   QTVDDINEWASENTNGNIEKIFDSVNDMHPEVVMYLINAIYLKGNWELPFNEEMTKKGT
FT                   FYNVDNTESTIDFMWQSAKYSYTETRELQAVRLPYANSNAFMTIVLPKHIDKFEINESK
FT                   WKKINHSFDEEMIDIKMPKFTLEYENEMSNYLKNLGIEKAFNKAQSDFSRITDDPRFVI
FT                   SRVLHNTFVEVDEKGSEAAAVTAIEAVAESSIVTKIPEMVINRPFYIFIHDEEFDVILF
FT                   AGRINTIY"
FT   gene            588775..592227
FT                   /locus_tag="Bcell_0524"
FT   CDS_pept        588775..592227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0524"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="KEGG: cth:Cthe_2809 glycoside hydrolase family
FT                   protein; TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; PFAM: glycoside hydrolase family 16;
FT                   Carbohydrate-binding CenC domain protein; Gram-positive
FT                   anchor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28806"
FT                   /db_xref="GOA:E6TXJ2"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR008264"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ2"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU28806.1"
FT                   /translation="MVRNKVIVLFSVFTLLFSVFAPGLSPQNVKAVGTEEVEDVVETKG
FT                   DRSPNPEDDGWELTFADEFDGDEINMDNWSFDEPTNGRWNGEIQSYTENNAKVEDGNLI
FT                   IWADKEDITEPDGQVYNYSSSKLWTKDKQTLTYGRVDVKAKLPEGQGMWPAIWMMPNDE
FT                   PFYGTWPVSGEIDIMELLGHEPDTVHGAIHFGRPHQERQGTFILEDGTTFADDYHVFSI
FT                   EWEPGEIRWYVNDIHFHTANDWFTKHPDNADAYTYPAPFDQPFMLILNISVGGGWPGNP
FT                   DETTVFPQQMKVDYVRFYEKDEYPVHEKPESAEEREGRAPLEDGNYVYNGSFDSNDPEV
FT                   EGIEGVPYTDYWTFLKAGGGNASLQVNDGALDIQIDSGGDVEHGIQVLQAPIHLIEGAT
FT                   YRASFSAKAENERPLKVKIGGDGDAGWADYAGKDPITLSTSWEDYEFEFKMENLTDVKA
FT                   RYEFNMGLNNSNVSLKDVRLEKIADPDPADMIRGPLPTGNYIFNGTFDQGEGRMGFWEF
FT                   NTDETAEATHYIGSAINERRFDALISNGGNNVDSVQLSQSGFTLENGREYELTFDASAE
FT                   AERDIQVALTNLNSEVVYEETISLTTSTEKHTIEFSVDSETDNNSELQFNLGGNNNNVY
FT                   IDNVFLKKLPLDIEVGNLLKNGIFDGLASWRAEAFNPGQATFSVEDGMAKAAITNIGTA
FT                   DWNIQLFQEGVNIEQDVTYEVSFDAKSTVDRPLHVQIQRNGEHHGDDDWTVYFEETASL
FT                   TDTLQTFTYSFTMNEDSDPVSKFGFPLGKDAEGLIPSEAHDVFIDNVSVRKVDGEVEDP
FT                   GTEDPGTEDPGTEDPDAPEERPMGEEFFEDFASHDEDRWSMAGVWTNGDMFNTTWYPEQ
FT                   VTFNDGKMQLTLDHDENASETGIPYKSGELRTNDFYHFGLYEVSMKPVASEGTVSSFFT
FT                   YTGEWDWDGDPWDEIDIEFLGKDTTRIQFNYFTDGVGGNEYYHDLGFDASESFNTYAFE
FT                   WREDSITWFVNGEAVYTATENIPQTPQKIMMNLWPGIGVDGWTGVFDDADIPLVAEYDW
FT                   VRFTPLEELSHDPIIVEPETPETPETPETPETPETPETPESDDDSKDESDEDGDSEETS
FT                   KEGSKDGDALPSTATNAYNYLLVGMLLLVIGGVSFFIRRKQLG"
FT   gene            592727..593788
FT                   /locus_tag="Bcell_0525"
FT   CDS_pept        592727..593788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0525"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bha:BH3230 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28807"
FT                   /db_xref="GOA:E6TXJ3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ3"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADU28807.1"
FT                   /translation="MRSEDLAKLIGVSRSTITRVINNYPDIPQATRDKVLKAIEEYNYA
FT                   PNASARKLAGATNKMIAIIVLDVKDDGVTHHVKTTDDTLIYNNPFFSPVINAVSDQANK
FT                   MDYYALISIAYSKEDLKKVESIFNQKMIEGAIFVGTQEAENELIFKLIKQNHKIALIDT
FT                   NEIYSKKHDAIYINPDNFEGSVKAINYLVELGHKNIGIITGNLNKLSAQERLDGFKETL
FT                   SRHGLVLNCDHFYHGDFTENSGYDGVNHILRAHSKPTAIFVSNDTMAIGAYKAIAEIGL
FT                   KIPEDISIIGFDNSFISSYLTPPLTTVDISFADIAKRATTLLIDSVENNKKVGIVEKIH
FT                   ATLIERESCKRIN"
FT   gene            complement(593924..594376)
FT                   /locus_tag="Bcell_0526"
FT   CDS_pept        complement(593924..594376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_5538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28808"
FT                   /db_xref="GOA:E6TXJ4"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ4"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_5538"
FT                   /protein_id="ADU28808.1"
FT                   /translation="MIIVGTFEQSIELEQTISVLEKRVVAREKILVVFMDQKPLINEFT
FT                   GRTRNIHSNAFEVGMATGTGTAVIGASIGFVLKWGPIIWGLITVVIGFILGYVIYFLLK
FT                   RKFYQTRRILKIPEATVIIDCEEHQEKLIKDILWKGQALTVGKNGS"
FT   gene            complement(594373..595140)
FT                   /locus_tag="Bcell_0527"
FT   CDS_pept        complement(594373..595140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_5537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28809"
FT                   /db_xref="GOA:E6TXJ5"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ5"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_5537"
FT                   /protein_id="ADU28809.1"
FT                   /translation="MTSISHAKISIFGITQLQRHDPLMVAWFSALFPGFGHYLLNRYFR
FT                   ATLLTLFEFTINTLAHINEAMVYSFTGQFELATSVLEPRWAFGYLIIYLITIWDSYRSA
FT                   ISQNKMAELAEFENNPIHRVEILASDIQHLERKKPMVAAFYSFFFPGLGQIYNHRFCLG
FT                   FYAMLWWWFYLTITGLHESLLYLMLGDFQASHALLHPQWLLFMPSVMGGATVEAYVTAI
FT                   EHNKLYRLSQRQHLCNRYGNTKLKIINQEGVMK"
FT   gene            595260..596552
FT                   /locus_tag="Bcell_0528"
FT   CDS_pept        595260..596552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0528"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: csc:Csac_0642
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28810"
FT                   /db_xref="GOA:E6TXJ6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ6"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADU28810.1"
FT                   /translation="MSIVEEDTLLLFNYDKRIYGVEVCYLLSWIDGLSILEAGALVFII
FT                   GAVNVLYIIGIKNRIEKYYKKTQSRELTLNRMRLLTQYVYLIFIAVSSFFTVLLFMFLL
FT                   EAPFGDSKLHSIVSLVCTFIFLGMVLTINQLILSKTTQKIRGTEETVKDELKSTIAGLL
FT                   LIFAPITFFIGILSIIPDGLLGDIGYVLILLAFLISVPFFSALLLRRMLKAYDMPSSEL
FT                   KDDLLQFLKQIYMEDVKLYLWPTKKKKVANAVVTGVSKRKQVLLSDYLLENMSRKEIEA
FT                   ILAHEVGHLKHNHIWKRVILLAFFPILTYGLGKGLDMFETSYGELPYWLGIGIILIFVV
FT                   GYLGIVFLFVSRIQEREADKYVLSVGIDYRDYASGLMKLAKLNDMVTNMNKLDESFQTH
FT                   PSIAKRVRWIIEEANGSTEEFLEYQVRENTD"
FT   gene            596793..598280
FT                   /locus_tag="Bcell_0529"
FT   CDS_pept        596793..598280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0529"
FT                   /product="peptidase M17 leucyl aminopeptidase domain
FT                   protein"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: bcy:Bcer98_3532 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28811"
FT                   /db_xref="GOA:E6TXJ7"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ7"
FT                   /inference="protein motif:PFAM:PF02789"
FT                   /protein_id="ADU28811.1"
FT                   /translation="MYQFIQENILNYETEAILYGVFQEESSSFHPFEEAFSNELSNLIE
FT                   LGELSPEAGHVCKLHPFNKAKARRIYFVGLGYKADITKDGIRKAFSKAFKQLAKDKVSN
FT                   IALALDSLVQLPMSDTDAFEAIGEAQALAPFQLNTYHTKKLETTKLKEFTIIAERNHRE
FT                   KEVVDALKVGFALGEGANVARNLVNAPGNLMNATHLADYAKSLAEKHKLEIDILEKEDM
FT                   EQLQMGALLAVNQGSTERQKFIVIRYQGKETWEDPVAIIGKGITFDTGGYSLKGKDGII
FT                   GMKMDMGGAASTLGAVDVIGKLKPNANVMAVIPATDNMISGSAFKPDDVIFSMSGKTIE
FT                   VRNTDEEGRLVLADAITYAKKEGASEIIDIATLTGGVVVALGNEVTGVMTNNEGLLADV
FT                   QRAANETGELMWQLPYFDLYKKQVRTSHIADLNNSPGRAGHAIMAGVFVGEFAGSTPWV
FT                   HIDIAGTAMASSEHELGPKGPTGVMTRTLAKFVMNKK"
FT   gene            598502..599698
FT                   /locus_tag="Bcell_0530"
FT   CDS_pept        598502..599698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0530"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: bha:BH0784 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28812"
FT                   /db_xref="GOA:E6TXJ8"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU28812.1"
FT                   /translation="MTDRQSRLINSILFFVIFGTWFILINDNPNNTILLTILIYSYALI
FT                   QYFRYLKYRLPIKNPLSIILIMTQLCIAFTVQAVDGWFLAQTYFFILIVEVSYRSSRAN
FT                   SILFMVISYVAYVTAVALHFQFPPFHEISHVVPRFLEYVLFWAFSYIASYAVDQKREME
FT                   LLNEELRQAAEELEEKTLLQERLRLSKEIHDTVGHTLTTAYIGVETSKHIIQNGKNTEG
FT                   LEMLEKAKFQIKRSLEDVRSIVHTVSENPNFIDMKKSLIKLIDQTEDHSNITIDYEITE
FT                   SLPDLGPAQQLAIYRALQEGVTNGIRHGGSTHFHYRLLNKGDTLQITLEDNGKFKNNST
FT                   YGFGLKAMQQRFQLVGGMVETLKNDKGGCTLKITLPIQYRENINQPNTLQKEGNTYVG"
FT   gene            599688..600356
FT                   /locus_tag="Bcell_0531"
FT   CDS_pept        599688..600356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0531"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: bha:BH2123 two-component response regulator;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28813"
FT                   /db_xref="GOA:E6TXJ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXJ9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU28813.1"
FT                   /translation="MSDKLKVVIADDHPIVRDGFKVLLSTTDSIEVVGTAQNGVEVVEL
FT                   VTQLHPDVVLLDMYMPNKNGLEALADIKIKHPETKVLMISSMINDDVVIDCLSLGANGV
FT                   LLKDWPTDKIIHAMKESVAGQMIIPECYSTKLIGAWKKQNKPQHKDWHEVINKLPISLY
FT                   EREKEILAKIMDGKKNSEIARELYLSIGTIKNYTSSIYKKIGVSKRKELVEYVKTVKLG
FT                   "
FT   gene            complement(600371..600496)
FT                   /locus_tag="Bcell_0532"
FT   CDS_pept        complement(600371..600496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0532"
FT                   /product="SinR repressor domain protein dimerization"
FT                   /note="PFAM: SinR repressor domain protein dimerisation;
FT                   KEGG: bld:BLi04042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28814"
FT                   /db_xref="GOA:E6TXK0"
FT                   /db_xref="InterPro:IPR010981"
FT                   /db_xref="InterPro:IPR036281"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK0"
FT                   /inference="protein motif:PFAM:PF08671"
FT                   /protein_id="ADU28814.1"
FT                   /translation="MVSVKTNDRILDKEWIQLMKEAKQMGLSPSDIKQFLNKKKC"
FT   gene            600747..601295
FT                   /locus_tag="Bcell_0533"
FT   CDS_pept        600747..601295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_4403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28815"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK1"
FT                   /inference="similar to AA sequence:KEGG:Bsph_4403"
FT                   /protein_id="ADU28815.1"
FT                   /translation="MDNGIVEYFEKLHAHDKQEQFEAFQYLLKAMEGEVDWSYEVWDRL
FT                   KEEVESGNNHERSRAAQFLAALASWSDPEKRVLGDFPILWKVTYDEKFVTARHSLQSVW
FT                   KVALAGNEQRELVLNHFIERFYTCEDERNNKLMRFDIIQGLKNIFDNTKEAAVKEAALK
FT                   LIESENDEKYKKKYKNVWK"
FT   gene            601311..601607
FT                   /locus_tag="Bcell_0534"
FT   CDS_pept        601311..601607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU01870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28816"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK2"
FT                   /inference="similar to AA sequence:KEGG:BSU01870"
FT                   /protein_id="ADU28816.1"
FT                   /translation="MSGKLSINEFVINVTKDRETFNSSDMEQIKEILRLAMSYYELRSK
FT                   EVNELHEGNHSSVLYLDSIMEENILLKVVEIASHSDDQLSLEQIYESKVVRRH"
FT   gene            602093..603262
FT                   /locus_tag="Bcell_0535"
FT   CDS_pept        602093..603262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0535"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   afl:Aflv_2036 permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28817"
FT                   /db_xref="GOA:E6TXK3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU28817.1"
FT                   /translation="MENKKALPILFAVMFFVMVGFGIIIPVLPFYAEELGASPTQLGLL
FT                   MASYSFMQLVFAPFWGRVSDKIGRKPVMMVGILGLAFSFFFMASATELWMLFAARIIGG
FT                   FLSSANMPTVMAYVADITSDEDRGKGMGIVGAAVGLGFIFGPAIGGIFSEQSLNMPFYI
FT                   AGLSSLVTFLFVLFVLKESLPAGGNAAKEKKSVFQSLKGPVSILYFMQLFISLSLAGLE
FT                   ATFAYFAAERAGLGTVELGYIFMIMGFAGALVQGGLVGRLTKRFGEGIVIQIGIVISAI
FT                   GFALILLVDNFMTAAIFLSIFGIGNGLIRPSVSSLLTKRSTSGYGSVTGLLSSFDSLGR
FT                   IIGPPLGGILFSLSVGMPYISGIVLSLIALFLYRVYRIQTKGSLEEYRA"
FT   gene            complement(603594..605327)
FT                   /locus_tag="Bcell_0536"
FT   CDS_pept        complement(603594..605327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0536"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bha:BH0713 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28818"
FT                   /db_xref="GOA:E6TXK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU28818.1"
FT                   /translation="MEQQQTSLKPFIKLILSTKIPKLAFGIGLIGSFITTIVGLSIPLL
FT                   TREMVDGFSMDALNIYLIIAIILVFILQAITDGISMYALAYVGQKIVARLRERMWFKLL
FT                   RLPVSYFDKNTSGQTVSRVVNDTGIVKDLISQHFPQFISGIITIIGAVIILFIMDWKMT
FT                   LLMFLAVPITIAFMVPLGMRMSKISRGLQDETANFTGNVQQTLSEIRLMKASNAERTEE
FT                   KKGIAGINKLFSYGLREGKIFALISPLMYLVVMVVIVIIIGYGGIRVADGTMTTGSLVA
FT                   FLLYLFQIIFPITSFTMFFTQLQKAKGATERIIDILEVDEEAGQEGIDMDISNKAIYVK
FT                   NVSFSYSEEEQVIKNVSFDVQPGTLVAFAGPSGGGKTTLFGLLEQFYEPTTGQIFIGDT
FT                   PIQDISMYSWRNQIGYVSQDSPMMVGTIRENLCYGLEDRANINDEKLWEVAKMAYADQF
FT                   IKDFPNALNTEVGERGVKLSGGQRQRIAIARAFLRDPKILMMDEATASLDSQSEGIVQQ
FT                   ALFRLMEGRTTFVIAHRLSTIVNADKIIFIENGEITGVGTHEELVQTHELYREFAEQQL
FT                   T"
FT   gene            complement(605987..607126)
FT                   /locus_tag="Bcell_0537"
FT   CDS_pept        complement(605987..607126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0537"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG: bha:BH2105
FT                   xylanase Y"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28819"
FT                   /db_xref="GOA:E6TXK5"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK5"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ADU28819.1"
FT                   /translation="MTVKNGAFNTGDYRNIFKEIGYDNLEINRKIEDTWDKLFGDHEET
FT                   KIYYEVGEDLAYMLDTGNIDVRTEGMSYGMMMAVQLNKKEVFDRLWKWTVTYMFMTEGE
FT                   NAGYFAWSCLPDGSRNSNGPAPDGEEYFALALLFASHCWGDGEEPFNYSQQAKSLLHTV
FT                   LHKGEGGHGYPMWNLENKLIKFIPNCEFSDPSYHLPHFYELFSLWSNPEDRPFWKEAAS
FT                   ASREYLKIACHPETGLAPEYAFYDGKPNHIRGFGHFYSDSYRVAANIGLDYEWFRGDEW
FT                   EVENANRIQAFFADKKPADYRRYTVDGKPFEEKSLHPVGLLATNAMASLAADGEYAHDC
FT                   VKLFWNTPVRTGKRRYYDNCLYMFSLLALSGNFKIWFPE"
FT   gene            complement(607140..608660)
FT                   /locus_tag="Bcell_0538"
FT   CDS_pept        complement(607140..608660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0538"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: bha:BH1068 beta-xylosidase; PFAM: glycoside
FT                   hydrolase family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28820"
FT                   /db_xref="GOA:E6TXK6"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK6"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADU28820.1"
FT                   /translation="MKIINDKDNQYFSNNWNYCIGTGRLGLALQKEYWDHLKLVQEKIS
FT                   FQFIRGHGLLHDDIGIYRELNLPDGSTKPFYNFTYINRIFDSYLQLGLRPFIEFGFMPQ
FT                   ALASGDQTIFAWEGNVTPPNDYDKWYNLIHAVVSHFIDRYGLEEVKKWPFEVWNEPNLV
FT                   NFWKDANKEEYFKLYKITASAVKDVCPDLKVGGPAICGGSDEWITDFLTFCKNENVPVD
FT                   FVSRHAYTSAKPHKVTPEYYYQELFDCDHMLDELKEVRELIHSSPFPHLPFHITEYNTS
FT                   YSPINPVHDTPLNAAYLARVLSEAGDYVDSFSYWTFSDVFEEADVPKAQFHGGFGLVAL
FT                   NGIPKPTYHLFSFFNKLGEIILHRDTECIVTKRGDDSITIVVWNVVMKKGHDFNKDMSI
FT                   DLPFPYKEAFIKRQTIDENHANPWKVWKQMGRPRFPKQNEIETLIEVAKPQIRTERKLV
FT                   IDGRLPLTITLTKNEVSFIEISRVKDETETYIELDDSLIPSYSKEWSS"
FT   gene            608853..609401
FT                   /locus_tag="Bcell_0539"
FT   CDS_pept        608853..609401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH2107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28821"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK7"
FT                   /inference="similar to AA sequence:KEGG:BH2107"
FT                   /protein_id="ADU28821.1"
FT                   /translation="MKIRAMIMVLISLFLLAGCGSEASDGSGKLQIMFLSEVPNSYEAN
FT                   FIPYIEDIIRRADEDPDNIEIIVQIYPISHEKLTLEIVARDVDIFIIDESLRHVLLDPY
FT                   GLHPLEELRNNFGDEAEIEEFVLDDHETGDPHLYAVPLDNDSTLITDLGLELPAPLIGA
FT                   VVRSSYYKELAEQILAEFL"
FT   sig_peptide     608853..608924
FT                   /locus_tag="Bcell_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.854 at
FT                   residue 24"
FT   gene            609434..610156
FT                   /locus_tag="Bcell_0540"
FT   CDS_pept        609434..610156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0540"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   bha:BH2108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28822"
FT                   /db_xref="GOA:E6TXK8"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK8"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADU28822.1"
FT                   /translation="MNVSWMASPFYRSCDWIWKMAYVNLLWLGFTVLGFGILGFLPATL
FT                   AMLTVMRKWLMGEPDIAIFKTFLNAYKEGFIRINLIGLLFAFGAYVIVFNYMYLGTIEG
FT                   PVHTILSLGWYIGLIVYTVTLVFLIPTYVHYELKLMQYLKASFIVGLVNPLAMITLIIG
FT                   LLLMYQLFTYIPGLIPFFGPSMLGMMVMWCAHMAFTRLERKKEKLENEKNDVSQSPSTN
FT                   TKSAITHKKPRRRTRVIW"
FT   gene            610559..614059
FT                   /locus_tag="Bcell_0541"
FT   CDS_pept        610559..614059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0541"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /EC_number="3.2.1.8"
FT                   /note="SMART: glycoside hydrolase family 10; TIGRFAM:
FT                   LPXTG-motif cell wall anchor domain protein; KEGG:
FT                   gym:GYMC10_0901 endo-1,4-beta-xylanase; PFAM: glycoside
FT                   hydrolase family 10; Carbohydrate-binding CenC domain
FT                   protein; Gram-positive anchor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28823"
FT                   /db_xref="GOA:E6TXK9"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXK9"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU28823.1"
FT                   /translation="MKRRHVKLFFIQLLVILLVLPPGIMTAQSSVEAIGSFEREIIAEY
FT                   HFDDGTTQGWFGREANLEVVDNEAHSGEYSLFVDGRTEGWNSPALDLQGMLEIGATYEI
FT                   AGYMKRAEATSEEKLVMAMIDQSVGEDAQYNWINSRETSQTDWVELRGEYTITDEKEDL
FT                   VLYFEIENNTENFYIDSISITKISPADDSFVPEIVAEFDFEDGTTQGWFGRGITPKVVQ
FT                   GNGQSGEHSIFVEGRTENWHSPALNVRELFEIGATYEITGHMKRATTTEEDGNLVMAMI
FT                   DQSIGGDANYNWIDNKRVTHDNWVALSGEYSITEEKGELTLYFEIEGNTEDFYINTITI
FT                   TMISPPTETGDDDIIDVPVEERVAAFTDFEDGTTQGWEPREGPEELTVTTDTAKNGERS
FT                   LLISNRQGSFHSAKLDFLDHMYAGHTYDISVWVKLAPGETPTSLQISRAETISGSTNYY
FT                   PPVINPTEVTADEWVLLQGTYTLTGNVSDLYFYVEEPYDENQETGVSFYIDDFKAEVRV
FT                   PDELEDIAPLKDVFADHFDIGAAVEPRHTAGQHGKMLEKHYNMLVAENIMKPESIQPTE
FT                   GEFNWVNADAMFDYAEENGLKVRFHTLVWHSQSPSWMFLDANGDPMVVDGVVADPDNLE
FT                   ANKALLLQRIEDHVHAVVGRYGDRVDSWDVVNEVIVPTEEDGFRKSEYYLITGTEFIHK
FT                   AFEATAEALAALGDDVHPNAKLYYNDYNTHNPQKREFIYEMVKEMQNEGIPIDGIGHQT
FT                   HLNINSSIELVIASIERFTELGLDNQITELDISIYTGNNEAFFSYADIPASKHEEVAMA
FT                   YGELFKQLRGVSDQVSSVVFWGIADDHTWLHGRGVANRVDAPFVFDQDLKAKEAYYTVI
FT                   DDNYVAPERPSIPEPKSEIAYYGTPTINGELDDIWQIATVFETDTWVEGESGSTASVRA
FT                   LWDDEYLYVFAEVTDSQLSNVSNNEWEQDSVEIFVDQNNEKTNYYQLDDGQFRVNFENE
FT                   VSINGFGSDTFRSATAITEEGYIVEAAIKLEAIEPVEGTVIGFDIQVNNDENGDGVRNS
FT                   VVTWNDPTGESYQSTSQFGELQFVLEPETDQEKPVDDPLKPGDQERKPSTPGEEDSLVI
FT                   GGEGGSERQHETEEGSKGDELPRTATNNYNMIALGSLLLLLGTTILIVFRRKNKVTIRE
FT                   "
FT   gene            614319..615896
FT                   /locus_tag="Bcell_0542"
FT   CDS_pept        614319..615896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0542"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: bha:BH2109 hypothetical protein; PFAM:
FT                   response regulator receiver; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: response regulator
FT                   receiver; Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28824"
FT                   /db_xref="GOA:E6TXL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU28824.1"
FT                   /translation="MYKVLLVDDEVFVRKGLRSLIEWEKCGYDVVSEADDGEDAFEVIK
FT                   QISPDVVITDIKMPIVDGLELIKKVRETLDHDTKFIIISGYNDFSYAQRAVKYGVVDFV
FT                   LKPIDKEEFEGILTDLHRRLEMERTARKAKDKLYLSQLIVNVFDEAVKEGEISKWSRAL
FT                   KMDQSQFFYYVIFEKNNVTPNKVTPDKERKCLSNIIVDALSDIEKNNQPLAIYEHEENA
FT                   IGILIAAHHLIEFDHDIVQFVSRISKEVNRKANQPITAFIGTKVSKLFSIKHSYETANR
FT                   IRSYKYIVEDKDVISYENVMNIPITFNDINKSLYVKLIEQMEEKNINELEKVIALIFSE
FT                   FQSRRFAPWAIRTSINRCVHGIIETINSMDGNVKSMSTIEAMTNWEKYHLTLDELKKVF
FT                   REFIIEGTDMIQELRKENMKGDIYKVKAYVESNYHKNISLKSIARQFYMNPVYMGQLFK
FT                   KTFGMYFKEFVLKLRMDEAKKLLRQTDMLVYEIAENVGFGSTDYFVTQFEKKCKMTPTE
FT                   YRNELLKK"
FT   gene            615914..617659
FT                   /locus_tag="Bcell_0543"
FT   CDS_pept        615914..617659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0543"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; KEGG: bha:BH2110 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28825"
FT                   /db_xref="GOA:E6TXL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL1"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADU28825.1"
FT                   /translation="MLPSKYNFNNMKLRNKLLLLYIFCVFLPIVITNIVFFNVTSNNIK
FT                   NQKMHDVELVLDQITNDFTDVVDQAVGLTSRLYVDYSLYEYFEADYESTLDYVEAYGVF
FT                   LRNFHRYSSMYYTIQSITFYTDNENIIYAGGVRPINDETKKEEWYTYLNEVDHPIVIRT
FT                   NPLEDSDRFSVFREYDFYKNLDEKEKIIRVDINSSTINQIFHNVTLQGNIYLLNENNEI
FT                   EFSTDENIQWQTEQIGFDSVNMPEDTIFLEERNLPHNYFEDWKIVGVISENEILEELYN
FT                   SRQFIVILASINIILPTLLIILISKSIHTRLLRLLKHMKMMKRQKFDLIAFADDKDEIG
FT                   EVMTEFNKMSKTINKLINEVYVANLEKKDSQLREKQAQLSALQSQINPHFLFNALETIR
FT                   MRSVIKEEKETAQIIQNMASIFRNSLTWGKDWVSVREEVDLIISFLEIQKYRFGNKLEY
FT                   ELEIEDSAYECIVPNLIFLPFVENASMHGIELKKQKGKIQIVIKNINQQLVFKIEDDGV
FT                   GIEKEELAKILKNLKDEDSMGDSVGIKNVYYRLKLYYKNNFEFSIKSASHKGTIVEMKL
FT                   PFQKD"
FT   gene            617881..619578
FT                   /locus_tag="Bcell_0544"
FT   CDS_pept        617881..619578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH2111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28826"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL2"
FT                   /inference="similar to AA sequence:KEGG:BH2111"
FT                   /protein_id="ADU28826.1"
FT                   /translation="MFKRRYLFILLSLLLLLAFVACSSDDEASSNDPDTSDVDETGDDD
FT                   ADEIDKTPITYSLFNAGVSRRDIDTNETRIGKIFEEETGVNFKIEHLVGDIDTKIGVMV
FT                   ASGSYPDVIVPDSAIDVLLDAEAFIPLNDLLEEHGPNLLEAYGDYLDLFTMDDGNIYYI
FT                   PFGATINEYKPNPNIDQGAFWIQRGILKEYGFPEINTLDEYFDVIERYAAENPEIDGMT
FT                   TIPFTGLTYDWRFFAFSNIPNHLAGYPNDGGVMIDMETHEASVYADSEYAKDFLWKMNE
FT                   IYHKGLLDRELFVANYDEYISKLSSGRVLGFFDYGWQFGDARNALRDAGNPDREFMALP
FT                   VVFEGVEYDQYLDPPSFTANRGIGISRDAESPERIIQYWDNMIKEENQKLIMWGFEGEH
FT                   YSVDDDGLFYRTQEQLDLTRNQDEREEVGMTHFEWYWPRLNGTFSDGINAVEPARQPEV
FT                   ALADYNDDDREYLDAYGINMFSELFAPPDDRPWYPAWGANIEQGSPEQIFEERQDELLK
FT                   RHYPRIVLADDEEEFEEEWEAFVEAYRSLDVDGYEAFFEEYVQSRLED"
FT   sig_peptide     617881..617952
FT                   /locus_tag="Bcell_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.626 at
FT                   residue 24"
FT   gene            619749..620726
FT                   /locus_tag="Bcell_0545"
FT   CDS_pept        619749..620726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0545"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH2112 transmembrane
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28827"
FT                   /db_xref="GOA:E6TXL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28827.1"
FT                   /translation="MLQPTPTPVTPKSPIPRKKKTGFKNFIKKCKEQKVLLLMSIPFVL
FT                   WLFVFRYVPLYGWTMAFQDFRPARPVFEQEWAGFEHFIFLFTEPRFYEVLRNTLAMSLI
FT                   NLVLGFITAITLAILLNELRNMTFKRVVQTVSYMPYFLSWVVAAGLVSYALSLENGIVN
FT                   IVLVNLRIISEPIVWLGIGEIFWGIIGAADVWKNVGWNSIIYLAAIAMIDTQQYEAAQI
FT                   DGASRLQRIWHITLPGMKPVIIILLIMNLGYILESGFEAQYLLMNPQNRDFAENLDIYV
FT                   LRYGISMGNFSLATAAGIFKTIVSFIFLFSANAIAKKMGEARLF"
FT   gene            620739..621662
FT                   /locus_tag="Bcell_0546"
FT   CDS_pept        620739..621662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0546"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH2113 ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28828"
FT                   /db_xref="GOA:E6TXL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28828.1"
FT                   /translation="MKLSKLAGRRRSADDLIFDSLNTVFLLLLCLVMLYPMVNTLAVSL
FT                   NDATDSLRGGIYLLPREFTFFNYKHVFGQSELLQAGLISVLRTVIGTATSVFCTAMVAY
FT                   TISRQYFVLRRFVTIAFVLTMYLNGGLIPTYLLMRELHLIGTFWIYIIPGLIGVFNLIV
FT                   VRSFIEGLPETIFESARMDGAGEFTQFFRIALPLCLPVIATVSLFVAVFQWNQWFDVFL
FT                   YNSSQQHLSTLQYELMKVLQSSNASLTTRSAADAFANAPGQMQEIVTPTSVRAAITIIV
FT                   SVPIICVYPFLQKYFVKGLTLGGVKG"
FT   gene            621681..622688
FT                   /locus_tag="Bcell_0547"
FT   CDS_pept        621681..622688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0547"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PFAM: glycoside hydrolase family 10; KEGG:
FT                   gtn:GTNG_1774 intra-cellular xylanase; SMART: glycoside
FT                   hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28829"
FT                   /db_xref="GOA:E6TXL5"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL5"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADU28829.1"
FT                   /translation="MKQKLEETIPSLCGVYRDYFNIGAAVNKYTIESNKHLLEKHFNSL
FT                   TAENEMKFENLQREEGVFTFEETDRMISFAEANGMKVRGHTLVWHNQTPDWVFAHPDGK
FT                   LVNRDMLLNRMEAHILAVVGRYKGKIESWDVVNEAISDDATEYLRKSKWLEIVGEDFIA
FT                   KAFEKAHLVDPDASLFYNDYNESSPEKREKIYRLVKSLKEKDVPIHGIGLQAHWNIAEP
FT                   KIDDIRAAIERYASLGLQIQVTEMDVSVFEWNDKRKNVTEPTASMLELQEKRYEQFFNL
FT                   FREYRQVITSVTFWGISDAYTWLNDFPVKGRRNWPFVFDEAGKPKGAYWNITRF"
FT   gene            622866..624899
FT                   /locus_tag="Bcell_0548"
FT   CDS_pept        622866..624899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0548"
FT                   /product="Alpha-glucuronidase"
FT                   /EC_number="3.2.1.139"
FT                   /note="KEGG: bha:BH1061 alpha-glucuronidase; PFAM: Glycosyl
FT                   hydrolase 67 middle domain protein; glycosyl hydrolase 67
FT                   C-teriminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28830"
FT                   /db_xref="GOA:E6TXL6"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL6"
FT                   /inference="protein motif:PRIAM:3.2.1.139"
FT                   /protein_id="ADU28830.1"
FT                   /translation="MDRGYKMWLRYNQITNQEVLEEYQSCLQHLHFSVNTATILAAVDE
FT                   LQAGLSSMINHSLHVLKTKDQRATLLLTIEESIAKEENVQVEIEDEGYVIKSIKNNRLI
FT                   IFGKTDIGVLYGVFHLLRLMQTQCSLKHIYIVEQPKNSLRMLNEWDNMDGSIERGYAGV
FT                   SIFFENNQFTKDWERVKDYARLLASVGINGIAFNNVNVHEQETKLITPEYLPTVAKVAN
FT                   IFRMYGIKTFLSINYASPISLGGMDTADPLNEEVRQWWKDKAKEIYRFIPDFGGVLVKA
FT                   DSEHRPGPFTYNRTHADGANMLAGAFAPFDGIVLWRCFVYDCMQDWRDRSTDRARAAYD
FT                   HFKPIDGKFHKNVVLQIKNGPMDFQVREAVSPLFGAMPNTNQMLELQITQEYTGQQKHL
FT                   CYLVPQWKEILDFDTYANGVNTPIKSIVDGSQYKYDHCGITAVSNVGNDDNWTGHTLAQ
FT                   ANLYGYARLAWNPDLSAELITDEWAKLTFGVDEQVVQVVSNMLLQSWHIYEKYTSPLGV
FT                   GWMVNPGHHYGPNVDGYEYSVWGTYHFADSKGIGVDRTVATGTGFTNQYFKENKELYET
FT                   LNNCPDELLLFFHHVPYTHQLKSGDTVIQHIYNTHFEGVEEAIGLKKSWLSLEAKISPS
FT                   IFNGVSERLQHQIEHAKEWRDVINTYFYRKSGIEDEKNRKIY"
FT   gene            624993..625841
FT                   /locus_tag="Bcell_0549"
FT   CDS_pept        624993..625841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0549"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pjd:Pjdr2_0334 D-mannonate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28831"
FT                   /db_xref="GOA:E6TXL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU28831.1"
FT                   /translation="MIPLNENLKGKVAVITGGGGVLCSEMAKELARHGVKVAILNRTLE
FT                   KGEKVADTIRKAGGTAIAIRCDVVDEESVKKAEKTVSKEFGTCNILINGAGGNHPKGST
FT                   TNEVFASDDTVNPNVTSFFDLSYEGFNHVFQLNIIGTVIPTQVFTKGMVDGNGGSVINI
FT                   SSMAAPSPMTKVPAYGAAKAGIDNFTQWLAVHMAPANIRVNAIAPGFFLTDQNRSLLTY
FT                   EDGSFTDRAKKILQNTPMKRFGKPEDLLGTLLWLVDDQASRFVTGISVPVDGGFMAYPG
FT                   V"
FT   gene            625846..627255
FT                   /locus_tag="Bcell_0550"
FT   CDS_pept        625846..627255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0550"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="KEGG: glucuronate isomerase; PFAM: Glucuronate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28832"
FT                   /db_xref="GOA:E6TXL8"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL8"
FT                   /inference="protein motif:PRIAM:5.3.1.12"
FT                   /protein_id="ADU28832.1"
FT                   /translation="MGGFITENYLLTSESAKILYHDYAKKMPIYDYHCHLSPKEIAENK
FT                   TFRNMTEIWLDGDHYKWRVMRALGVEEKYITGNASDYEKFRAWAKTVPQIIGNPLYQWT
FT                   HMELKRYFHTDLLLNEDTCDIVWEHCNSLLQTAALSAQKIIEQSQVKMIGTTDDPVDDL
FT                   IYHQAIMKNERFKTKVLPTFRPDQAYEIRKQGYNEYVDKLSTVTSTRIDSFQSFLQALE
FT                   SRIQYFHKMGCRISDHGLETLPYEDASTEEVESIFSSARQGEKVTLLEEYKFKTYVLSF
FT                   LGRLYHSLGWAMQLHIGPLRDNNEKMFARIGANTGFDSINDYFLAKPLNAFLNRLEKSS
FT                   ELPKMIIYSLNPNHNEVIASACGNFHSASMKGKIQFGAGWWYNDHKDGMIRQMTDLANT
FT                   GVLSTFIGMLTDSRSFLSYTRHEYFRRVLCEMVGKWIESGEAPRDYKLLGEMIQNISYN
FT                   NAANYFEVQTH"
FT   gene            627528..628853
FT                   /locus_tag="Bcell_0551"
FT   CDS_pept        627528..628853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0551"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="TIGRFAM: xylose isomerase; KEGG: gtn:GTNG_1757
FT                   xylose isomerase; PFAM: Xylose isomerase domain-containing
FT                   protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28833"
FT                   /db_xref="GOA:E6TXL9"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXL9"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ADU28833.1"
FT                   /translation="MSYFKNVQQVKFEGSQSSNPFAYKYYNPEEKINGKSMEELLRFAV
FT                   SYWHTFTGEGTDPFGAGTAVRPYNHLSGMDLAKARVEASFEFFEKLDVPFFCFHDIDVA
FT                   PESDSLSETLKNIDEIVAMIKDYLKTSKVKLLWNTANMFTHPRWLHGAATAPNADIFAY
FT                   AAAKVKKGLEVGKELGAENYVFWGGREGYETLLNTDMGLELDNLARFFHMAKDYAKEIG
FT                   FDAQFLIEPKPKEPTKHQYDFDVATGLAFLQKYDLQDTFKFNIEANHATLAGHTFEHEL
FT                   RTARVNGMLGSVDANQGDTLLGWDTDEFPTDLYSTTLAMYEILKNDGLGSGGLNFDAKV
FT                   RRPSFDTDDLFHAHIAGMDAFAIGTKVAQRLIEDKVLDDFVADRYKSYTEGIGLDIVEG
FT                   KTDFHKLEKHALSLTEINNKSGRQELLKATINKYLLETFAQK"
FT   gene            629073..631076
FT                   /locus_tag="Bcell_0552"
FT   CDS_pept        629073..631076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0552"
FT                   /product="transketolase"
FT                   /note="KEGG: bha:BH2352 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain-containing
FT                   protein; Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28834"
FT                   /db_xref="GOA:E6TXM0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM0"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADU28834.1"
FT                   /translation="MSTEQLTVKQQAINTIRTLSIDGIEKANSGHPGLPMGAAPMGFAL
FT                   FAEQMKHNPKNPSWFNRDRFVLSAGHGSMLLYSLLHLSGYDVTMDDLKNFRQWGSNTPG
FT                   HPEYGHTSGVDATTGPLGQGFAMAVGMAMTERHLAAKFNREDFNIIDHYTYSICGDGDL
FT                   MEGVSAEAASLAGHLKLGRLIVLYDSNDISLDGDLHLAFSESVEDRFKAYNWHYIRVED
FT                   GNNLHEINKAIQHAKEDERPSIIEVKTTIGYGSPNKAGKSASHGAPLGKDEVKLTKESY
FT                   DWTHHEEFYVPSEVAQLFAKVIENGKELEESWNQLVARYEQRFPELGIKLTEAINGKLP
FT                   VGWDNQLPSYKEGDKVATRSSSGEAINAFAANIPAIIGGSADLASSNKTMLKGEANFSS
FT                   QDYSGRNVWFGVREFAMAAMINGMALHGGVKPFGATFFVFSDYLRPAVRLSALMKLPVT
FT                   YVFTHDSVAVGEDGPTHEPVEQLASFRAMPGITVIRPADGNESVAAWKLALESTNRPTL
FT                   LVLSRQDLMTHTKSVEEAYDGVKRGAYIISEAKGNTEGVLIATGSEVQLAVAAQRKLEE
FT                   EGVNVSVVSMPSWDLFEKQNTAYKNKVLPPNVKARVAIEMGSSLGWKEYVGNEGKVISI
FT                   DQFGASAPANEILQEYGFTVENVVNTMKEALK"
FT   gene            631114..632169
FT                   /locus_tag="Bcell_0553"
FT   CDS_pept        631114..632169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0553"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="KEGG: bca:BCE_2212 aldose 1-epimerase; PFAM: Aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28835"
FT                   /db_xref="GOA:E6TXM1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM1"
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /protein_id="ADU28835.1"
FT                   /translation="MKITEQLYGKLEGETVTSFLLKNDNGMEVTCINYGCIITEINVPD
FT                   KSGTVENVVLGFDSLDEYITSSPFFGSAVGRVAGRIAGAQFELDGNTYHLLKNDGENNL
FT                   HGGDNGNAGFDKVVWKASTEEGPEEVKVTFTHESPDGAAGFPGNLKVKITYSLNNKNEL
FT                   VISYYATTDKKTLVNLTNHSYFNLSGNVKNDILSHELTLKSDQFVQLGDGAIPTGKLLD
FT                   VANTPFDFREGKQFKDGVDSEHPQITLVGGGYDHPFILSENHNEEICLVDNESGRKLIV
FT                   ETDEPAVVLYTSNWMSDDLNMRGVTSKKHIGVCLETQHHPDAVHHEHFPTIVLNKDEEY
FT                   RTETVFRFLVE"
FT   gene            complement(632363..633970)
FT                   /locus_tag="Bcell_0554"
FT   CDS_pept        complement(632363..633970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0554"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: amt:Amet_3317 alpha-N-arabinofuranosidase;
FT                   PFAM: glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28836"
FT                   /db_xref="GOA:E6TXM2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM2"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADU28836.1"
FT                   /translation="MAKIQNPILTGFNPDPSICRAGEDYYIAVSTFEWFPGVGIYHSKD
FT                   LKNWRLVSRPLNRLSQLNMMGNPDSGGIWAPALSYSDGKFWLIYTDVKVTEGQWKDSHN
FT                   YLVTCDTIDGEWSEPIYMNSSGFDPSLFHNDDGKKYFVNMVWDHRVSHHNFYGIVLQEY
FT                   SVEEKKLIGKKEVIFTGTDIKLTEAPHLYKVNGYYYLLTAEGGTKYDHQATIARSKDLW
FT                   GPYEVHPENPLITSFPYPRNPLQKAGHASIVETHTNEWFLVHLTGRPLPKEGHALLDPR
FT                   GYCPLGRETAIQRLEWKDDWPYVVGGNQPAAEIEGPAIDEVTWEKDVPEKDDFDGENLN
FT                   LHFQTLRIPLGEEIVSLKDKPGHLRIHGRESLTSKFTQAYVARRWQHFNFTAETKVAFQ
FT                   PETFQQAAGLVNYYNTQNWTALQVTWHEEKGRILDLTTCDNFTFDQPLKGKEIVVPDHT
FT                   EYVYMRVDVTTNTYRYSYSFDGNEWVEIDIDFYSYKLSDDYIQGGGFFTGAFVGMQCQD
FT                   TSGASLPADFDYFVYKEK"
FT   gene            complement(633999..635180)
FT                   /locus_tag="Bcell_0555"
FT   CDS_pept        complement(633999..635180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0555"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: oih:OB3124
FT                   transcriptional repressor of the xylose operon"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28837"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM3"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADU28837.1"
FT                   /translation="MKMTETFNQHVVKRRNKSLILHSIKELSPVSRADLASKTGLNKGT
FT                   VSSLVNELLEEQLILESGPGVSSGGRRPVMLLFNQSAGYSIGIDIGVNYILATLTDLQG
FT                   SICNEKLVKVKKLTFSETTSMLFQVIDELIESMPSSAYGVVGIGVGVPGTVSTSGKILL
FT                   APNLKWKDIDLKGVIEEKYKVPVQIENEANAGAYGEKKFGAGKEFHNIVYISGGIGIGV
FT                   GLILNGKLFKGHNGLSGELGHMTINIDGPECNCGNKGCWELYASEQALIKMADESRIFD
FT                   DGDVTLEQLVKLAEEGNEKTIAIIEKLADYLVVGMNNIINTFNPEQIIIGNRLAALQHW
FT                   LEEKLKNQLSKQVMTAHQKDLELHFSLLEKRSAALGVSAFSTEKFLATNIAEG"
FT   gene            635421..636737
FT                   /locus_tag="Bcell_0556"
FT   CDS_pept        635421..636737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0556"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oih:OB3123 sugar ABC transporter sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28838"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADU28838.1"
FT                   /translation="MFKKKAITSLVALMASAVVIAGCSDDSSTEGDSNGASGDSGDSKT
FT                   ISFMHLWPQGSSAEHHRIVNEIIADYEAENNVTIDLSVLSNEQYKDQITVLSATNELPD
FT                   VGMTWAAGYLDPFVDGNKFTPLDDLLEDGLRDEFVAGTLEAYEKDGNTYGLPLELNTVY
FT                   VYYNKAIFGEYGLEAPSTYDELEQVIATLNENNVEPIALGNRDRWTGSMWYMYFADRIG
FT                   GSDVLTNAIDRSGSFEDPALVEAAAKVQEMVEADSFASGFNGLADEEAKSMFMNDQAAM
FT                   YMIATWDLPNYTTNEDVPQEFRDNVGYFKFPTVDGSGDRNSFVGGPGVGLFVAEDSDVK
FT                   DEAKEFAAYFVREWGERSVSEAGVIPATIVDGEGLDLPDMYVEVLQDLEDATNLTLYAD
FT                   VQMSASVADTHLDLIQALFGLSITPEEFAKQHEEALSAE"
FT   sig_peptide     635421..635486
FT                   /locus_tag="Bcell_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.780 at
FT                   residue 22"
FT   gene            636783..637715
FT                   /locus_tag="Bcell_0557"
FT   CDS_pept        636783..637715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0557"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB3122 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28839"
FT                   /db_xref="GOA:E6TXM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28839.1"
FT                   /translation="MNPLRILLFHSLNMGLSSMNKVMSNKWFITLYVFPALFLVSVLIF
FT                   IPLILTGYYGLMKWDGIGAMEFIGLENYLRVIQDDKFWQSATHSFLLALFSTLSLAIYL
FT                   AVSMILASKIKGANLLRKIYLIPMLLSSVAIAQLWIKIYNPSNGMLNTILGYLGVQNPP
FT                   LWLADTNIVLYSIFIPILWQYAGFYILIYYAALKGIPESIMEAARIDGASPIQIAYKIK
FT                   LPLIMGIVKVTIVLAIVGSLKYFDLIYVMTGGGPNGASEVMASYMYKLAFGNYNFGYGS
FT                   AVGFMLLLITLIVTIIIRKLTADKDEIQY"
FT   gene            637731..638552
FT                   /locus_tag="Bcell_0558"
FT   CDS_pept        637731..638552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0558"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB3121 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28840"
FT                   /db_xref="GOA:E6TXM6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU28840.1"
FT                   /translation="MGRIGYIFLYVCLGFVALFQIFPIVWLFLFSLKDNREIFAGSPFA
FT                   LPEQIKWQNYLTVWEGGIGNYFWNSIWITGVSIFLTLLFASMAVFVITRMSWKLNKLVL
FT                   GLFMVGLMIPIHSALIPLFSMFLGVGLIDNPLSIVITYTAYNLPITMMILLGFYYTIPK
FT                   EIEEAAIIDGASLHKLFFRIILPITSPVLATTAIINMIYNWNEFVFVNTFISSDRYRTL
FT                   TVGINNFVGQYMTDWGAIGATLVISVLPIIVAFLFFSNKIVEGISSSAVKG"
FT   gene            complement(638590..639198)
FT                   /locus_tag="Bcell_0559"
FT   CDS_pept        complement(638590..639198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0559"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   oih:OB3120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28841"
FT                   /db_xref="GOA:E6TXM7"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM7"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADU28841.1"
FT                   /translation="MSRVLYSMMEWITRFAYINLLWIFFTLVGGFLLGLFPSTVAMFAV
FT                   VRQWLRGSTDLPVFKSFWQYYKKEFLKSNLLGIFIYLISIIFIFNVFFLHANIGELLTW
FT                   TSAPLLAGLLLFIMIFIYTFPIYVHYDLKVFQIFKNAFLTLLVTPIHMFCILISLIAFY
FT                   IIVTVVPALGIIFGASFYSFIAMWFSLHAFEKIRQKQKA"
FT   gene            639372..640871
FT                   /locus_tag="Bcell_0560"
FT   CDS_pept        639372..640871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0560"
FT                   /product="xylulokinase"
FT                   /note="KEGG: bca:BCE_2211 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28842"
FT                   /db_xref="GOA:E6TXM8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM8"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADU28842.1"
FT                   /translation="MKYVIGVDLGTSAVKIILVNQSGEVVNEISKEYALIHEKTGYSEQ
FT                   RPDDWLTNTINGISDLLNDFGGNKNDIEGISFSGQMHGLVLLDENEEPLRNAILWNDTR
FT                   TTAECEEIYEAVGEEKLLQLTKNPALEGFTLPKILWVKKNEPEIFTKVKTFVLPKDYVR
FT                   LKLTGQLHMDYSDAAGTLLFNVSTKKWSNEILNIFGLSNDFCPPLVGSHEQVGTISSDV
FT                   AEKTGLSPHTRVFAGGADNACGAIGAGILEEGSTLASIGTSGVVLSYEDSDDKDFKGTV
FT                   HYFNHGAPDAYYTMGVTLSAGHSLSWFKEVFAKEEDFNELLAEVDTIPPGANGLLFTPY
FT                   LVGERTPHVDSTIRASFIGIDSAHERKDFVRAVLEGITFSLNESVEIFRNQGKRIDTVV
FT                   SIGGGAKNEVWLQMQADIFNAKIVKHASEQGPGMGAAMLAAYGCGWFSSMKECADTFLK
FT                   VDKEFLPIEENVKQYEELFQLYKKVYTETKELNMDLVKFRK"
FT   gene            complement(640983..641294)
FT                   /locus_tag="Bcell_0561"
FT   CDS_pept        complement(640983..641294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28843"
FT                   /db_xref="InterPro:IPR041270"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXM9"
FT                   /inference="similar to AA sequence:KEGG:Bsel_1847"
FT                   /protein_id="ADU28843.1"
FT                   /translation="MDKIDVIARRILGWKQNSLHKWYNHEEGLFIENFNPYENMEHAML
FT                   IVSRLERFGFHYTKQSETEACFSNAYVKECSSGDTLALAITNAAYSLAEVNTISSEWL"
FT   gene            complement(641382..643115)
FT                   /locus_tag="Bcell_0562"
FT   CDS_pept        complement(641382..643115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0562"
FT                   /product="histidine kinase"
FT                   /note="KEGG: bpf:BpOF4_18085 sporulation-specific
FT                   ATP-dependent protein histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28844"
FT                   /db_xref="GOA:E6TXN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6TXN0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU28844.1"
FT                   /translation="MLVLPINKITSSQTVKSSGAHILYMYNEYKKYVQNLVSFIHEGLI
FT                   ENEIILIVEYKNTINLSKKELEKKGLTNAQIENIKWVFANEFYINENQFDANGAGKKLI
FT                   HLLQPFIDQGYNIRTWGQVPIINQDAILDQLNGYECHCDDFTSKRKTKSVCAYNAITTP
FT                   SFMQNVLLKTHTYFMTDDDYNLSPFYNRKHSKTASVEEVDRLRRMEEQNKDLLDRNTHL
FT                   IFENNLVKLNNEVIKQNESKLRTVINELPIPIIIRNNKYIIFYNSEAEAQFSIDNQHVV
FT                   AENLLSSFFENYARNIKHQHEVQEQMFILKNEKKKYYLVKSINISFEGEPAVLHSFVDV
FT                   TKEKENENLMIRSEKMNIAGELAASIAHELRNPLTAIKGFFKMLRDTEKYKERYFQIIE
FT                   DELSRIEQISSELLTLAKPHTEKRQDQNIVNLIEEVKFLLSSQSNMKCIEVILEVSSNE
FT                   LYVNCEVTKIKQVFINLVKNAIEAMQEGGNIKIKVERIGNIIQAKVIDHGSGIPEELLS
FT                   KIGEPFYTTKEKGTGIGLMVCYQIIESHGGTIHFDSKVNIGTTFTITLPALVKSLSTQS
FT                   Q"
FT   gene            643374..643703
FT                   /locus_tag="Bcell_0563"
FT   CDS_pept        643374..643703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28845"
FT                   /db_xref="GOA:E6TYA7"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYA7"
FT                   /inference="similar to AA sequence:KEGG:Bsel_2567"
FT                   /protein_id="ADU28845.1"
FT                   /translation="MSLILYDLILVVFGMILGVMIKDPLKNIFTGKYKENARQKKRVKL
FT                   LVSIRGSEKPLTTEELAQNVFNSKLKIVEVHQLLRDIEEIGFIKGITSKDKDTRKTKWR
FT                   YIKEK"
FT   gene            643745..644599
FT                   /locus_tag="Bcell_0564"
FT   CDS_pept        643745..644599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0564"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28846"
FT                   /db_xref="GOA:E6TYA8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYA8"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADU28846.1"
FT                   /translation="MDFKPKAIFLDMDGTILNHDNKVTIRTKEIIDEIRKSGIYVFVAT
FT                   GRALNEIPGVIPDGFEVDAYITSNGMAGYVGDEAVFEHSLSRELVELIIEKARENKMYY
FT                   ELFPYEADRITLKQDKVYVVNEIREPKPHSVGINEWSSRKQAVKSEIAWKDQVEGEKFS
FT                   KFYFFSRSKDHINRWKEVLEELKKQVDFSTSISSKHNVELMVANVNKATGIKQMLKHFQ
FT                   LTEEDTIAMGDSNNDLPMFDFVSYAVAMKNAPSEIKEKAQDVTQFTCDEDGVYHYLKSM
FT                   LVL"
FT   gene            complement(644700..645230)
FT                   /locus_tag="Bcell_0565"
FT   CDS_pept        complement(644700..645230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28847"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYA9"
FT                   /inference="similar to AA sequence:KEGG:Bsph_0469"
FT                   /protein_id="ADU28847.1"
FT                   /translation="MNRMQVVSIVLLVIVLIAVAAYSFLGNEDRNDVHVSDKNEDVEEI
FT                   IISEPAEEEVIVGNVPTKEEVEEEFPLNLPEHAVQNFIHWMSHQKVAADQKWGKMLITD
FT                   ERITRIIEVIEANNYDHEDVYTSILTRWQVGDFSQAVEDHNTIWRLQNGTIGEATRLLT
FT                   PEEERQYIEKNFE"
FT   sig_peptide     complement(645159..645230)
FT                   /locus_tag="Bcell_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.505 at
FT                   residue 24"
FT   gene            645536..646606
FT                   /locus_tag="Bcell_0566"
FT   CDS_pept        645536..646606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0566"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="KEGG: oih:OB0772 endoglucanase; PFAM: peptidase M42
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28848"
FT                   /db_xref="GOA:E6TYB0"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB0"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADU28848.1"
FT                   /translation="MQKLLEQLTALHGPCGYEQPVSEWIRDTIQPFVDEVTIDPLGNVI
FT                   GTKKGSKPGPKVIMTAHMDEIGFIVKKIEKNGLIRFEKLGGHDDRILLTQKVQVRTKSS
FT                   YLTGVIGSISAHYAKFDDATKVRNHRQLYIDIGAKNVEDAKRLGVTVGAPITWLPSIDY
FT                   LGDDSTGRFVGKGFDDRAGCAVIIKTLQELEGKSFSGEVSAIFTVQEEVGLRGAQVATR
FT                   QVDADVGIAIDTTAVSDTPEETMDQTLALGAGTGIKVLDMSLISHPTVKEYLIDLAEEK
FT                   QIPYQLEVFPGIGTDGGAMSLTNRGIPTGVLSIPSRYAHSPVEVIDINDLHATKNLLKE
FT                   FILSLSEQSQFPFIKK"
FT   gene            complement(646684..647004)
FT                   /locus_tag="Bcell_0567"
FT   CDS_pept        complement(646684..647004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28849"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB1"
FT                   /inference="similar to AA sequence:KEGG:MAP3821"
FT                   /protein_id="ADU28849.1"
FT                   /translation="MYGTGFQRQVPGAGISPLGAGLLGAGLGYLGGAMTTPGGFGGFGA
FT                   PAAPGAVGGFGAPATPGAFGPGVHGGFAPQHGVPHAGTGFGHPGWGHPGPVPGVRPRPF
FT                   FF"
FT   gene            complement(647315..648100)
FT                   /locus_tag="Bcell_0568"
FT   CDS_pept        complement(647315..648100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0568"
FT                   /product="ribonuclease BN"
FT                   /note="KEGG: gwc:GWCH70_0418 ribonuclease BN; TIGRFAM:
FT                   ribonuclease BN; PFAM: ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28850"
FT                   /db_xref="GOA:E6TYB2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB2"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADU28850.1"
FT                   /translation="MELAISLYLRFKEHRLIELAAQCSYYLLLSIFPFLIFILTLFSFL
FT                   PLTLEFDINVIQDVVPAEIFQFIEGQWTRITSQHNTGLLSFSIIFTIWTASLALNTILR
FT                   LLNRAYHVTEERKMLKGRLISIFLTIGMFAVVLVALGLQVIGATLKDVLPFDFNIFKFN
FT                   LLRWGISSLVLFIVFMLLYLVGPNIRLKLRDVYIGAIFATLGWLLTTSMFTFYLDNFAN
FT                   YTATYGTIGAVIALMVWFHLSSVIILLGGEINAELKEKG"
FT   gene            648430..649650
FT                   /locus_tag="Bcell_0569"
FT   CDS_pept        648430..649650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0569"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmw:Mmwyl1_4177 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28851"
FT                   /db_xref="GOA:E6TYB3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU28851.1"
FT                   /translation="MSQNTINSSSENSYRHIKKLLLLSVAMVWTMTTWFSMTAVLPELT
FT                   ELWSLTSTQGSLVTIMVQAGFVVGSLLSAFLNLPDRLDLSRMFFGAALVAGFATIATAL
FT                   FSSSYASALIFRFLTGVALAGVYGPGLKLMATWFKVRRGMALGFVVGALTLGSASPHLF
FT                   RGFSVGSWEIVLMVSGLASILAGLLVVFTVNNGPYPLPKAPFDPAAIPRALRHTPVRLA
FT                   NYGYFGHMWELYAMWAWFGLFLLNSLQTSGVENPSSLASFLTFIVIAAGFFGAWFGGMI
FT                   ADKFGRERLTLWSLATSGSIALLIGFFYGKSIWIIVILGIIWGISIIADSAQFSALITE
FT                   HADQRFVGSVLTFQLAVGFAITMIVILLVPVLEAIVGWQYAFLLLVPGPVLGFLAMLRL
FT                   HKVTSKV"
FT   sig_peptide     648430..648546
FT                   /locus_tag="Bcell_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.661) with cleavage site probability 0.654 at
FT                   residue 39"
FT   gene            complement(649804..650721)
FT                   /locus_tag="Bcell_0570"
FT   CDS_pept        complement(649804..650721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0570"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: gym:GYMC10_2615
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28852"
FT                   /db_xref="GOA:E6TYB4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB4"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU28852.1"
FT                   /translation="MRKMKLGSSSLEVPVISVGCMRINSLEKPAAERFVQTAIEHGANF
FT                   FDHADIYGGGSCEEIFADAVSMSDDVREKMILQSKCGIRDGMFDFSKEHILHSVDGILK
FT                   RLNTDYLDILLLHRPDTLVEPEEVAEAFDQLESAGKVRHFGVSNQNPMQIELLKKYVKQ
FT                   PIVANQLQLSITNTTMMDSGFNVNMENDAAVNRDGSILDYCRLHDITIQPWSPFQYGFF
FT                   EGVFLNNEKFPELNQKINEIAVKYEVSNTTIAIAWILRHPAKMQPVIGTTNEERLKDCI
FT                   KASEINLTREEWYSIYRAAGNVLP"
FT   gene            651895..652449
FT                   /locus_tag="Bcell_0571"
FT   CDS_pept        651895..652449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_2491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28853"
FT                   /db_xref="GOA:E6TYB5"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB5"
FT                   /inference="similar to AA sequence:KEGG:Bsph_2491"
FT                   /protein_id="ADU28853.1"
FT                   /translation="MIGGKVMKRNFYFVFIGIIVVGLVSYFSLNNGESTTEGEASNIKE
FT                   LVHDYSTGNVGGNEVASITSHELIVTDSDQKETIYDLPADEFFVSIAPYVTETHPCAIH
FT                   SLTGCQGELANAEFDIYIEDEEGNVILDEAVTSLENGFIDLWLPRDKTYHSIITFDGKT
FT                   VESEFSTFEGDNTCITTMQLM"
FT   gene            652754..653560
FT                   /locus_tag="Bcell_0572"
FT   CDS_pept        652754..653560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0572"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; KEGG: ion transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28854"
FT                   /db_xref="GOA:E6TYB6"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB6"
FT                   /inference="protein motif:PFAM:PF00520"
FT                   /protein_id="ADU28854.1"
FT                   /translation="MWVDTMGVLGTLRTNVGKMVEHKHFQMLIIGIILLNGLIIIVETY
FT                   ARGNDLLLIFDQIIVWIFVLEMVLKLFGLGTKRYFSDGWNIFDFSIVVASIAFYATPFV
FT                   SVLRLIRVLRLIRMIPAIPALRKIIDALMKSIPALTGVLGLCMLIFTIYAIIGTTFFSD
FT                   VLDYEFFGSFHTSLFTLMQVVTFESWASQVARPIINEVPWAWFYFVSFIIIGALVILNL
FT                   VVAVILNYLGQEDEEVREEQMERLYKENRELKEDIQEIKQMLLSKK"
FT   gene            complement(653849..655693)
FT                   /locus_tag="Bcell_0573"
FT   CDS_pept        complement(653849..655693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0573"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   KEGG: lsp:Bsph_0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28855"
FT                   /db_xref="GOA:E6TYB7"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB7"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADU28855.1"
FT                   /translation="MISEMQLVFLILAITTICFLVPRFRADLVAAIALLSLLLTGLITV
FT                   PEAFAGFSNTVVIMVAALFIVGEGVFQSGLAQKAGNLLIKTTKNSEWKLTVFMLILVAV
FT                   LSGFISNTGTVAILLPVVVSLCRQMQLHPGKLLIPLAFASSMGGALTLIGTAPNLIASE
FT                   SLQDAGYGALNFFTFTPIGLIMLLVGIIYLWFVGRKMLDKPIDKRAGESEKFNAGELVD
FT                   QYGLTDHIFSVKIPEGNELIGKSIKELRLPSTYSLMMLEVIKKESKSFKRLTGSRQAHP
FT                   ISVEPTYVIEADDIFVVYGEGEAVERLMSDTGALPVKNATHKIEESHLAEVILTPQSRL
FT                   INKTIREVNFREKYGLTVLAMKHQFEDARRFSDEETLLYGDAILVHGNWKEINLLSAEK
FT                   NDTVVLKSAAEDTELTNQTHKSWIAGFILLGMLLAMVFEWVPAVVAIVVAAVLMVLTDC
FT                   VRQTDQAYQSINWQTVILIACMLPMATALENTGGVTFISEGLIGSLGVIGPLAVLAGLY
FT                   AITSLFSQFISNTATAVLLFPVAILTAEQMGVSPIPMVMAVAFSSSMAFATPVATPPNA
FT                   MVMAAGKYTFLDFIKVGIPLQILIALVAILLLPMFFPF"
FT   gene            complement(656165..656434)
FT                   /locus_tag="Bcell_0574"
FT   CDS_pept        complement(656165..656434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgu:100228837 hyaluronan synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28856"
FT                   /db_xref="GOA:E6TYB8"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB8"
FT                   /inference="similar to AA sequence:KEGG:100228837"
FT                   /protein_id="ADU28856.1"
FT                   /translation="MDEVFTIKVHSLKIGLTIMVISAVLYAATLITASIYSIVLIDIGS
FT                   WNSEFGLYGSALREVGTLPLTLAISFAVVGVYFIIIGITYKETK"
FT   gene            657599..658912
FT                   /locus_tag="Bcell_0575"
FT   CDS_pept        657599..658912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC3259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28857"
FT                   /db_xref="InterPro:IPR025057"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYB9"
FT                   /inference="similar to AA sequence:KEGG:BC3259"
FT                   /protein_id="ADU28857.1"
FT                   /translation="MKKLFVYLLITCIFTIGCSAEETESQDEIDEVIENEEQEFEQLSK
FT                   EEYVETIGELQQKMQKELEEWVVISHDYSSNTYVEQNQQQIDVLLSVVEKYKELAAPEE
FT                   FAEVQSYYVKGMNLFEEGFGLYMDMLRNRDESLEETTNTTLKDGQDHWNYAFLLLSLKE
FT                   PIPMGDGTITTDDMMSLDRLAGMDIESVINNISKDGSELVGKWGFYYDDESFNVSIILH
FT                   SDGSYEGYPNDAYPDDSNAMKGTWYYNYLVQELVISNDEYFEDGESIEPPRPNMIMEIQ
FT                   SFVDGELLMMDKESLNSFLYVQEGEIRQDRPTSEKESDESIVNSDGEIARDSSYETLIG
FT                   TWSYMNLDHDEYRAIYIPDRGDGYYMIRTPDLNVNFFGEWNYDEESSILTFSINNYDLE
FT                   RGEFSGQTDQLTFHIHSQGESELEVEESGNTFILEKDF"
FT   sig_peptide     657599..657661
FT                   /locus_tag="Bcell_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.714 at
FT                   residue 21"
FT   gene            complement(659105..660232)
FT                   /locus_tag="Bcell_0576"
FT   CDS_pept        complement(659105..660232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0576"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="KEGG: bha:BH3958 carboxynorspermidine decarboxylase;
FT                   TIGRFAM: carboxynorspermidine decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28858"
FT                   /db_xref="GOA:E6TYC0"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC0"
FT                   /inference="protein motif:TFAM:TIGR01047"
FT                   /protein_id="ADU28858.1"
FT                   /translation="MRFEELPTPCYVVDEALVEKNLKILNGVMARTGCKIVLAQKAFSM
FT                   TAMYPLIGEYLNGTTASGLFEARLGHEEMGKENHVFAPAYRDDEIDEIISICDHIIFNS
FT                   FSQLDKFKDKALQAGKKVGLRINPECSTQVGHEIYDPCASGSRFGVTKKHFRPDLLDGV
FT                   SGLHFHTLCQQNSDDLETTLHAVEEKFGEWLPQMEWINFGGGHHITREDYDIPLLEKCI
FT                   KRMQENYGLSVYLEPGEAVALDAGYMITTVLDTHQNGMDIAILDTSASCHMPDVLEMPY
FT                   RPPLFNSGETGEKPFTYRLGGQTCLAGDVIGDYSFDKPLQSGDRLVFGDMAIYSMVKNT
FT                   TFNGMPLPAIAIKAKDGDCHIVQQFGYQDFKMRLG"
FT   gene            complement(660233..661465)
FT                   /locus_tag="Bcell_0577"
FT   CDS_pept        complement(660233..661465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0577"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: bha:BH3957
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28859"
FT                   /db_xref="GOA:E6TYC1"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC1"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ADU28859.1"
FT                   /translation="MGKALIIGCGGVATVAIHKCVQNSEVFEEICIASRTKSKCDDLKA
FT                   KLDGGKTKITTAQVDANNVDELIALIEEVKPDVVMNLALPYQDLTIMDACLATKTNYLD
FT                   TANYEPEDTAKFEYKWQWDYRERFEKAGITALLGSGFDPGVTGVFSAYALKHHFDEIEY
FT                   IDILDCNAGDHGYPFATNFNPEINIREVSANGRYWENGEWIETKPMEIKRTYNFPEVGE
FT                   KDMYLLYHEELESLAVNIPGIKRIRFFMTFGESYLTHLKCLENVGLTSIEPIEYEGKEI
FT                   IPLQFLKALLPDPASLGPRTKGKTNIGCIFKGKKDGKDKTYYVYNVCDHEACFQEVGSQ
FT                   AVSYTTGVPAMIGAMMLMNGTWNKPGVYNIEEFDPDPFMEALNKWGLPWQESFDPELVD
FT                   AEPIKEPEYSK"
FT   gene            662282..663217
FT                   /locus_tag="Bcell_0578"
FT   CDS_pept        662282..663217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0578"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: hor:Hore_03950
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28860"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC2"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU28860.1"
FT                   /translation="MKQRVLGSTGKTISEIGLGSWQLGNAKDWDVMSEKEGIELVHHAL
FT                   SLGCNFFDTAPNYGLGKSEEILGKALKGKRNEVIISSKFGHQDDGSINFDPHEIENSVH
FT                   KSLKRLQTDYLDTLLLHNPPFEYLNGGSHHFEVLEKLKREGKILSYGASVDSSKEMFQV
FT                   IETTNSQVMEVMFNIFHQETSEAFKAAKENGIGLIIKVPLDSGWLSGKYGSNSTFTDIR
FT                   RRWSKDIIERRTNMLKEIKKIVDPSQSLTQSALQFILAHEEVSTIIPGAKNIIQLNENV
FT                   SASQGMMDETKVEQLKSLWKKHLQNNSLPW"
FT   gene            663263..666235
FT                   /locus_tag="Bcell_0579"
FT   CDS_pept        663263..666235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0579"
FT                   /product="SMP-30/Gluconolaconase/LRE-like region-containing
FT                   protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: ote:Oter_1271
FT                   SMP-30/gluconolaconase/LRE domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28861"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC3"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADU28861.1"
FT                   /translation="MSKTDIVHSYSFYQDRLEDDQAVYLTSENFEVKGDGQADDTSAIQ
FT                   AAINQVKDTFNFGIVFVPEGIYRISETIYIPKAVRLIGYGKKRPTFILGENTPGFQEEV
FT                   PSDKGRANYMFWFTDTVPKEGEEVKDANAGTFYSALSNIDIKISKGNPSAVALRTHFAQ
FT                   HSFIAHVDIHIGDGKAGIFDVGNEIEDVRFFGGDYGIYTTKTSPAWPFMMVDTYFEGQR
FT                   KAAIQSKEAGLTITRMVAKNTPTVIETTEGFYEKLYIEDSRFENISGPALVISNEHNSF
FT                   TQVNVRNVSCSRVAMFAQFRESEKKVEGRITDYKVRTLTHGVCMEDIDAAADIQTIYDF
FT                   KELDHFSLNIQSNIPSLPPMSTWVNIKTLGAIGDGECNDTEAIQKAIDTYRTIYLPQGC
FT                   YVVNDTITLREDTVLIGLNPISTQIIVKDNTESFSGFGAPKPLLEAPKGGANIVFGIGL
FT                   DTGARNTRAVGCKWMAGAESYMNDVKFMGGHGAMSKDLSYVPLYNDSRTADYNPDLRWD
FT                   SQYWSLWVTNGGGGVFKDIWTASPYASAGLYVSHTDTPGYIYAMSVEHHVRNEVKFKDV
FT                   ENWQALALQFEEEAAESTNCLPLELQNCKNITFANLYFFRTIWLDTPYPYAMKTWDCES
FT                   LELLNVHNFTQVKYTMDNVLFDVNTSTEVRPWQISRLFLSGKQNKTNKNRISERHDSFE
FT                   KLAGGFEFVDAMCQDSKGNLFFVDSRLKRIYKWSAKEECLSLVTDIHHRPRSIACDEED
FT                   RLLVVVEYFPSKGATINGKPEVYSKTEDAKGSSYSFWYNTGSTIKVYSIDPNKPEESMQ
FT                   VLETRPLASVETVKKALYPANRWRDSGDFLTATVEEPQECYVAEDGVTIIPVTYDLMRA
FT                   CSLLEAYPEKHFYGVDEYYKRTVKYDVTANGLLTNPRILIEKGEFNVATDIKGNIYVPD
FT                   GEIYVFNKDGEILKELKVPERPACILFSNQQENDLFLYMTARSSLYKTRISLANNKDNE
FT                   E"
FT   gene            666301..666477
FT                   /locus_tag="Bcell_0580"
FT   CDS_pept        666301..666477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28862"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU28862.1"
FT                   /translation="MLDLKQRENLRFKEKNVSNSLIKLLLTFFLICCKIRYELTYTQMK
FT                   RGEVYEPSMERNL"
FT   gene            666449..667069
FT                   /locus_tag="Bcell_0581"
FT   CDS_pept        666449..667069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpf:CPF_1131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28863"
FT                   /db_xref="GOA:E6TYC5"
FT                   /db_xref="InterPro:IPR021683"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC5"
FT                   /inference="similar to AA sequence:KEGG:CPF_1131"
FT                   /protein_id="ADU28863.1"
FT                   /translation="MNLVWKGIYKSVDQLPKGDLPERAVKFKEPDNLVQLNIIASLFVI
FT                   PVLILIAIAVFLKFVIAGGEVTFTVFNLWGFLLAFLMILPHEMLHAMLFPKGKEVELWV
FT                   SPKAMAAFVVCTAPISKGRFIFLSLLPNIVFGFIPLVVWIVLPVGGAIENILFSFATLS
FT                   LLFGVGDYLNVFNAARQMPNGALTQLSGMNSYWFMPEEEQKAQ"
FT   gene            667539..668030
FT                   /locus_tag="Bcell_0582"
FT   CDS_pept        667539..668030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0582"
FT                   /product="transcription activator effector binding protein"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: bcl:ABC0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28864"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC6"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADU28864.1"
FT                   /translation="MEKYKVVKIPAYRAIGLKWEGSWSEISGLKEVIQEAGDRREELSH
FT                   IVAPVVQLGLSYHTRQDGFTHYSAYEVTREQEVPDGMIEIDIPEMTYLVTNHKKGGNIG
FT                   KTYDDIAQYLKESNYEPYRDETVPFENLPIKHEKYPLDRDLDDPHFEILIPIEKKEKDM
FT                   "
FT   gene            668253..668942
FT                   /locus_tag="Bcell_0583"
FT   CDS_pept        668253..668942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0583"
FT                   /product="Procollagen-proline dioxygenase"
FT                   /EC_number="1.14.11.2"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: bca:BCE_4314
FT                   prolyl 4-hydroxylase alpha subunit; SMART: Prolyl
FT                   4-hydroxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28865"
FT                   /db_xref="GOA:E6TYC7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC7"
FT                   /inference="protein motif:PRIAM:1.14.11.2"
FT                   /protein_id="ADU28865.1"
FT                   /translation="MTMDAKNLPMNELPVKEPTIFDHVGNKIITDDRKIDIIARIKEPL
FT                   IVLLGNVLSEEECDQLISLSKDRIERSKISNKSVHDLRTSSSMFFDDAENDVVSTVEKR
FT                   VSQIMKIPVDHGEGIQILNYAIGQEYKAHYDYFSSGNSKVNNPRISTLVMYLNDVEAGG
FT                   ETYFPKLNFYVAPKKGMAVYFEYFYNDTTLNELTLHGGAPVVIGDKWAATQWMRRKATS
FT                   NVSSFTI"
FT   gene            669740..671407
FT                   /locus_tag="Bcell_0584"
FT   CDS_pept        669740..671407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0584"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   bpf:BpOF4_10935 dihydroxyacid dehydratase phosphogluconate
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28866"
FT                   /db_xref="GOA:E6TYC8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC8"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADU28866.1"
FT                   /translation="MANHSKSRSNVFNDINKAPNRAMIRAMGITDEDFEKPFIGVASTW
FT                   SEVTPCNMHIDELARKAKQGAKEGGGTPFIFNTITVSDGISMGTEGMRFSLPSREVIAD
FT                   SIETVVGAQNYDGVVAIGGCDKNMPGCMIAIGRLNLPSVFVYGGTIRPGKNDGEDIDIV
FT                   SAFEAVGKYNNGDIDSDGLNKIECNACPGAGACGGMYTANTMASAIEAMGMSLPGSSSN
FT                   PAESPEKMEDCIEAGKAVLNLANQGILPKDIMTKKAFENAITVVMALGGSTNAVLHLLA
FT                   LAHTVDVELDLDDFERIRQRVPHIADLKPSGKYVMEELSKVGGVPAVMKLLLEKGLLHG
FT                   ECLTVTGKTVAENLAEVDHLKEGQNIVSFEKPKRENGPLVILKGNLAPEGAVAKMSGLK
FT                   IKNITGPARVFDSEKEATEAVLNNKINAGDVIVIRYVGPKGGPGMAEMLSITAIVVGKG
FT                   LGEKVGLITDGRFSGGTHGLVVGHISPEAQVGGPIALITEGDLITIDSETQELTVNITE
FT                   EEFAERLKDWTAPEQNIRGTLKKYARLVSSASKGAITD"
FT   gene            complement(671555..672106)
FT                   /locus_tag="Bcell_0585"
FT   CDS_pept        complement(671555..672106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcell_0585"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bcg:BCG9842_B2716 cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcell_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADU28867"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6TYC9"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADU28867.1"
FT